NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F000697

Metatranscriptome Family F000697

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F000697
Family Type Metatranscriptome
Number of Sequences 930
Average Sequence Length 182 residues
Representative Sequence DWVAKVDADAVFVPSRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDSCKASQEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Number of Associated Samples 308
Number of Associated Scaffolds 930

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.84 %
% of genes near scaffold ends (potentially truncated) 96.45 %
% of genes from short scaffolds (< 2000 bps) 98.82 %
Associated GOLD sequencing projects 262
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.925 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(76.882 % of family members)
Environment Ontology (ENVO) Unclassified
(88.710 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.215 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.47%    β-sheet: 0.00%    Coil/Unstructured: 70.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.14 %
UnclassifiedrootN/A0.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10052158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1490Open in IMG/M
3300008832|Ga0103951_10162731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum1046Open in IMG/M
3300008832|Ga0103951_10255804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata884Open in IMG/M
3300008832|Ga0103951_10285579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata845Open in IMG/M
3300008832|Ga0103951_10333319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata792Open in IMG/M
3300008834|Ga0103882_10014575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata887Open in IMG/M
3300008835|Ga0103883_1006323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata953Open in IMG/M
3300008835|Ga0103883_1017660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata753Open in IMG/M
3300008928|Ga0103711_10019657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata906Open in IMG/M
3300008929|Ga0103732_1008324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum1322Open in IMG/M
3300008929|Ga0103732_1019098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata971Open in IMG/M
3300008930|Ga0103733_1006373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1548Open in IMG/M
3300008930|Ga0103733_1053490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata640Open in IMG/M
3300008931|Ga0103734_1004939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1626Open in IMG/M
3300008932|Ga0103735_1007066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1344Open in IMG/M
3300008932|Ga0103735_1040262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata680Open in IMG/M
3300008935|Ga0103738_1001057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata2269Open in IMG/M
3300008935|Ga0103738_1012289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1059Open in IMG/M
3300008937|Ga0103740_1000853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata2116Open in IMG/M
3300008937|Ga0103740_1006296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1164Open in IMG/M
3300008937|Ga0103740_1008250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1066Open in IMG/M
3300008938|Ga0103741_1010725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1446Open in IMG/M
3300008956|Ga0104261_1041066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300008958|Ga0104259_1002764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1343Open in IMG/M
3300008958|Ga0104259_1003124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1289Open in IMG/M
3300008998|Ga0103502_10135895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata887Open in IMG/M
3300008998|Ga0103502_10194428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra741Open in IMG/M
3300008998|Ga0103502_10265848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300008998|Ga0103502_10280076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata613Open in IMG/M
3300008998|Ga0103502_10282654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300008998|Ga0103502_10288962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata604Open in IMG/M
3300009022|Ga0103706_10045988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata893Open in IMG/M
3300009022|Ga0103706_10049434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata868Open in IMG/M
3300009022|Ga0103706_10073627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata748Open in IMG/M
3300009022|Ga0103706_10079175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata728Open in IMG/M
3300009022|Ga0103706_10080148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata725Open in IMG/M
3300009022|Ga0103706_10123007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata619Open in IMG/M
3300009022|Ga0103706_10144098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300009023|Ga0103928_10371301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300009028|Ga0103708_100054664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata888Open in IMG/M
3300009028|Ga0103708_100067338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata828Open in IMG/M
3300009028|Ga0103708_100081649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata776Open in IMG/M
3300009028|Ga0103708_100129570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata667Open in IMG/M
3300009028|Ga0103708_100179049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300009028|Ga0103708_100265208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300009028|Ga0103708_100280273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300009195|Ga0103743_1001717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata2037Open in IMG/M
3300009195|Ga0103743_1004789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1523Open in IMG/M
3300009214|Ga0103830_1005865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata942Open in IMG/M
3300009214|Ga0103830_1008750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata819Open in IMG/M
3300009214|Ga0103830_1012647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata716Open in IMG/M
3300009216|Ga0103842_1012263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata769Open in IMG/M
3300009216|Ga0103842_1015484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata725Open in IMG/M
3300009268|Ga0103874_1036063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300009269|Ga0103876_1015429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata852Open in IMG/M
3300009269|Ga0103876_1018314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata814Open in IMG/M
3300009269|Ga0103876_1020608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata787Open in IMG/M
3300009269|Ga0103876_1021839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata774Open in IMG/M
3300009269|Ga0103876_1044848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata617Open in IMG/M
3300009272|Ga0103877_1002604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata784Open in IMG/M
3300009272|Ga0103877_1004250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata718Open in IMG/M
3300009272|Ga0103877_1008526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata628Open in IMG/M
3300009272|Ga0103877_1009955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata608Open in IMG/M
3300009272|Ga0103877_1017816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300009272|Ga0103877_1021019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300009274|Ga0103878_1008264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata907Open in IMG/M
3300009274|Ga0103878_1016690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata735Open in IMG/M
3300009276|Ga0103879_10006126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata810Open in IMG/M
3300009276|Ga0103879_10008031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata771Open in IMG/M
3300009279|Ga0103880_10003472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1146Open in IMG/M
3300009279|Ga0103880_10023411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata738Open in IMG/M
3300009279|Ga0103880_10025322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata723Open in IMG/M
3300009279|Ga0103880_10033104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata673Open in IMG/M
3300009279|Ga0103880_10062479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300009279|Ga0103880_10090144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300009334|Ga0103841_1001811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata830Open in IMG/M
3300009357|Ga0103827_1004158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata775Open in IMG/M
3300009402|Ga0103742_1020807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata817Open in IMG/M
3300009543|Ga0115099_10238626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata718Open in IMG/M
3300009592|Ga0115101_1000754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata610Open in IMG/M
3300009599|Ga0115103_1427428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata620Open in IMG/M
3300009599|Ga0115103_1453120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata691Open in IMG/M
3300009606|Ga0115102_10290847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata936Open in IMG/M
3300009606|Ga0115102_10710823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300009606|Ga0115102_10820064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1188Open in IMG/M
3300010981|Ga0138316_10262534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata711Open in IMG/M
3300010981|Ga0138316_10476343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300010981|Ga0138316_10609453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300010981|Ga0138316_11640533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata572Open in IMG/M
3300010985|Ga0138326_10027031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300010985|Ga0138326_10028206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata586Open in IMG/M
3300010985|Ga0138326_10358929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300010987|Ga0138324_10249650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata836Open in IMG/M
3300010987|Ga0138324_10249660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata836Open in IMG/M
3300010987|Ga0138324_10249661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata836Open in IMG/M
3300010987|Ga0138324_10284288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata788Open in IMG/M
3300010987|Ga0138324_10376829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata691Open in IMG/M
3300010987|Ga0138324_10446495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata637Open in IMG/M
3300012472|Ga0129328_1084003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata919Open in IMG/M
3300018515|Ga0192960_101694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1008Open in IMG/M
3300018515|Ga0192960_102601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata844Open in IMG/M
3300018515|Ga0192960_103026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata792Open in IMG/M
3300018515|Ga0192960_106085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata575Open in IMG/M
3300018526|Ga0193100_101475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata822Open in IMG/M
3300018534|Ga0193486_104750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata781Open in IMG/M
3300018534|Ga0193486_104752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata781Open in IMG/M
3300018534|Ga0193486_105099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata755Open in IMG/M
3300018546|Ga0193014_103000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra798Open in IMG/M
3300018555|Ga0193296_102570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata723Open in IMG/M
3300018555|Ga0193296_102765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata700Open in IMG/M
3300018555|Ga0193296_102813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata695Open in IMG/M
3300018555|Ga0193296_105462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300018556|Ga0192942_104104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata661Open in IMG/M
3300018580|Ga0193510_1005993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata816Open in IMG/M
3300018585|Ga0193221_1003676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata878Open in IMG/M
3300018588|Ga0193141_1003725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata993Open in IMG/M
3300018588|Ga0193141_1004600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra927Open in IMG/M
3300018592|Ga0193113_1011088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata922Open in IMG/M
3300018592|Ga0193113_1011775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata899Open in IMG/M
3300018592|Ga0193113_1016940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata768Open in IMG/M
3300018592|Ga0193113_1023949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata644Open in IMG/M
3300018600|Ga0192851_1002688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1065Open in IMG/M
3300018600|Ga0192851_1005808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata826Open in IMG/M
3300018600|Ga0192851_1009712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata681Open in IMG/M
3300018600|Ga0192851_1009821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata678Open in IMG/M
3300018600|Ga0192851_1010429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata662Open in IMG/M
3300018600|Ga0192851_1010903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata650Open in IMG/M
3300018600|Ga0192851_1013837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata587Open in IMG/M
3300018600|Ga0192851_1014088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300018600|Ga0192851_1018371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300018608|Ga0193415_1009324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata827Open in IMG/M
3300018608|Ga0193415_1014749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata662Open in IMG/M
3300018608|Ga0193415_1017777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300018611|Ga0193316_1009217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1030Open in IMG/M
3300018611|Ga0193316_1012643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata897Open in IMG/M
3300018615|Ga0192957_1033857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata816Open in IMG/M
3300018616|Ga0193064_1008229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata862Open in IMG/M
3300018616|Ga0193064_1011283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata772Open in IMG/M
3300018616|Ga0193064_1017700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata646Open in IMG/M
3300018616|Ga0193064_1018513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata634Open in IMG/M
3300018628|Ga0193355_1008122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata906Open in IMG/M
3300018628|Ga0193355_1010448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata824Open in IMG/M
3300018635|Ga0193376_1009414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata815Open in IMG/M
3300018635|Ga0193376_1010998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata766Open in IMG/M
3300018635|Ga0193376_1016433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300018635|Ga0193376_1026047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300018636|Ga0193377_1008037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata846Open in IMG/M
3300018636|Ga0193377_1010697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata756Open in IMG/M
3300018636|Ga0193377_1015102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata653Open in IMG/M
3300018637|Ga0192914_1005987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata869Open in IMG/M
3300018643|Ga0193431_1009314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata953Open in IMG/M
3300018643|Ga0193431_1012080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata865Open in IMG/M
3300018643|Ga0193431_1012265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata860Open in IMG/M
3300018643|Ga0193431_1022806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata659Open in IMG/M
3300018643|Ga0193431_1026141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata618Open in IMG/M
3300018643|Ga0193431_1030032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata579Open in IMG/M
3300018648|Ga0193445_1020369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata854Open in IMG/M
3300018648|Ga0193445_1022038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata824Open in IMG/M
3300018648|Ga0193445_1022454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata817Open in IMG/M
3300018648|Ga0193445_1023835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata793Open in IMG/M
3300018648|Ga0193445_1054289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300018651|Ga0192937_1028055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata661Open in IMG/M
3300018652|Ga0192993_1032012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300018653|Ga0193504_1016999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata756Open in IMG/M
3300018653|Ga0193504_1021943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata677Open in IMG/M
3300018657|Ga0192889_1020634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1035Open in IMG/M
3300018657|Ga0192889_1038541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata705Open in IMG/M
3300018657|Ga0192889_1041414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata671Open in IMG/M
3300018657|Ga0192889_1051333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata575Open in IMG/M
3300018657|Ga0192889_1060935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300018659|Ga0193067_1028030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata840Open in IMG/M
3300018659|Ga0193067_1053637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata591Open in IMG/M
3300018659|Ga0193067_1057006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata568Open in IMG/M
3300018659|Ga0193067_1062579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300018659|Ga0193067_1063311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300018662|Ga0192848_1015421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata861Open in IMG/M
3300018662|Ga0192848_1016212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata843Open in IMG/M
3300018662|Ga0192848_1018584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata796Open in IMG/M
3300018662|Ga0192848_1018883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata791Open in IMG/M
3300018662|Ga0192848_1019729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata777Open in IMG/M
3300018662|Ga0192848_1022240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata737Open in IMG/M
3300018662|Ga0192848_1023306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata722Open in IMG/M
3300018662|Ga0192848_1030522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata635Open in IMG/M
3300018662|Ga0192848_1040812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300018668|Ga0193013_1041939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata635Open in IMG/M
3300018675|Ga0193384_1014452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata835Open in IMG/M
3300018683|Ga0192952_1002038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1250Open in IMG/M
3300018683|Ga0192952_1005458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata962Open in IMG/M
3300018683|Ga0192952_1010639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata799Open in IMG/M
3300018683|Ga0192952_1023363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata622Open in IMG/M
3300018684|Ga0192983_1047450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata593Open in IMG/M
3300018686|Ga0192840_1032381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300018691|Ga0193294_1010701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1040Open in IMG/M
3300018691|Ga0193294_1013446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata936Open in IMG/M
3300018691|Ga0193294_1021027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata751Open in IMG/M
3300018691|Ga0193294_1022798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata721Open in IMG/M
3300018691|Ga0193294_1023245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata713Open in IMG/M
3300018691|Ga0193294_1026414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata668Open in IMG/M
3300018691|Ga0193294_1031085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata613Open in IMG/M
3300018691|Ga0193294_1033805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata586Open in IMG/M
3300018691|Ga0193294_1043701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300018691|Ga0193294_1043867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300018692|Ga0192944_1036063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata717Open in IMG/M
3300018692|Ga0192944_1050204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300018695|Ga0193259_1038043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata979Open in IMG/M
3300018696|Ga0193110_1012454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata849Open in IMG/M
3300018696|Ga0193110_1036240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata579Open in IMG/M
3300018698|Ga0193236_1019643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata896Open in IMG/M
3300018698|Ga0193236_1022826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata839Open in IMG/M
3300018698|Ga0193236_1026808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata778Open in IMG/M
3300018698|Ga0193236_1027142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata773Open in IMG/M
3300018698|Ga0193236_1028127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata760Open in IMG/M
3300018698|Ga0193236_1033527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata695Open in IMG/M
3300018698|Ga0193236_1037127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata659Open in IMG/M
3300018698|Ga0193236_1038885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata643Open in IMG/M
3300018698|Ga0193236_1054903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300018699|Ga0193195_1007584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum1026Open in IMG/M
3300018699|Ga0193195_1020843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata736Open in IMG/M
3300018699|Ga0193195_1023316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata705Open in IMG/M
3300018699|Ga0193195_1047423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300018701|Ga0193405_1043621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300018704|Ga0192954_1012443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata976Open in IMG/M
3300018704|Ga0192954_1029955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata714Open in IMG/M
3300018704|Ga0192954_1048648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata575Open in IMG/M
3300018706|Ga0193539_1057934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata620Open in IMG/M
3300018706|Ga0193539_1058644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata614Open in IMG/M
3300018706|Ga0193539_1062847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300018706|Ga0193539_1073481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300018707|Ga0192876_1032271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata967Open in IMG/M
3300018708|Ga0192920_1043299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata824Open in IMG/M
3300018709|Ga0193209_1056468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300018709|Ga0193209_1056470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300018709|Ga0193209_1057590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata548Open in IMG/M
3300018709|Ga0193209_1064004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300018711|Ga0193069_1010177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata928Open in IMG/M
3300018711|Ga0193069_1022690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata709Open in IMG/M
3300018711|Ga0193069_1022830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata707Open in IMG/M
3300018711|Ga0193069_1025545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata677Open in IMG/M
3300018711|Ga0193069_1037962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata578Open in IMG/M
3300018711|Ga0193069_1037967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata578Open in IMG/M
3300018713|Ga0192887_1015789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata927Open in IMG/M
3300018718|Ga0193385_1016192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata867Open in IMG/M
3300018718|Ga0193385_1037746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata566Open in IMG/M
3300018718|Ga0193385_1043893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300018720|Ga0192866_1034285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata830Open in IMG/M
3300018720|Ga0192866_1059901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata588Open in IMG/M
3300018720|Ga0192866_1059902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata588Open in IMG/M
3300018720|Ga0192866_1065374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300018723|Ga0193038_1079125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300018730|Ga0192967_1013079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1232Open in IMG/M
3300018731|Ga0193529_1045091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata808Open in IMG/M
3300018731|Ga0193529_1067848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300018731|Ga0193529_1070389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata616Open in IMG/M
3300018731|Ga0193529_1072053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata607Open in IMG/M
3300018731|Ga0193529_1079282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300018731|Ga0193529_1080924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300018734|Ga0193290_1027022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata665Open in IMG/M
3300018734|Ga0193290_1027102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata664Open in IMG/M
3300018734|Ga0193290_1027761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata656Open in IMG/M
3300018734|Ga0193290_1035297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300018734|Ga0193290_1036734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300018738|Ga0193495_1056044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300018740|Ga0193387_1033343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata745Open in IMG/M
3300018740|Ga0193387_1036943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata707Open in IMG/M
3300018740|Ga0193387_1048452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300018740|Ga0193387_1052389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300018740|Ga0193387_1060797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300018741|Ga0193534_1033322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata800Open in IMG/M
3300018741|Ga0193534_1033694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata795Open in IMG/M
3300018741|Ga0193534_1040266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata722Open in IMG/M
3300018741|Ga0193534_1054189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata605Open in IMG/M
3300018743|Ga0193425_1027816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata763Open in IMG/M
3300018743|Ga0193425_1032399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata716Open in IMG/M
3300018743|Ga0193425_1034429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata698Open in IMG/M
3300018743|Ga0193425_1035480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata688Open in IMG/M
3300018743|Ga0193425_1043344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata628Open in IMG/M
3300018743|Ga0193425_1057059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300018747|Ga0193147_1031105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata902Open in IMG/M
3300018747|Ga0193147_1036576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata834Open in IMG/M
3300018752|Ga0192902_1052402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata755Open in IMG/M
3300018752|Ga0192902_1068068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata643Open in IMG/M
3300018758|Ga0193058_1044834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata680Open in IMG/M
3300018758|Ga0193058_1056536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata615Open in IMG/M
3300018762|Ga0192963_1033289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata875Open in IMG/M
3300018762|Ga0192963_1045391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata733Open in IMG/M
3300018764|Ga0192924_1016506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata850Open in IMG/M
3300018764|Ga0192924_1017255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata835Open in IMG/M
3300018764|Ga0192924_1023563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata734Open in IMG/M
3300018764|Ga0192924_1028534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata675Open in IMG/M
3300018764|Ga0192924_1036321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata604Open in IMG/M
3300018765|Ga0193031_1024216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata917Open in IMG/M
3300018767|Ga0193212_1037852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata716Open in IMG/M
3300018769|Ga0193478_1044875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata715Open in IMG/M
3300018769|Ga0193478_1047742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata692Open in IMG/M
3300018769|Ga0193478_1063687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata591Open in IMG/M
3300018769|Ga0193478_1066433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata577Open in IMG/M
3300018770|Ga0193530_1050075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata816Open in IMG/M
3300018770|Ga0193530_1054725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata777Open in IMG/M
3300018770|Ga0193530_1083047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300018771|Ga0193314_1052947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata703Open in IMG/M
3300018776|Ga0193407_1049427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata606Open in IMG/M
3300018777|Ga0192839_1019538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1003Open in IMG/M
3300018777|Ga0192839_1033176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata796Open in IMG/M
3300018777|Ga0192839_1034287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata784Open in IMG/M
3300018777|Ga0192839_1034396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata783Open in IMG/M
3300018777|Ga0192839_1074120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300018780|Ga0193472_1022849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata685Open in IMG/M
3300018780|Ga0193472_1028637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata612Open in IMG/M
3300018780|Ga0193472_1031200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300018782|Ga0192832_1015533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata926Open in IMG/M
3300018782|Ga0192832_1031765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata702Open in IMG/M
3300018782|Ga0192832_1056787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300018783|Ga0193197_1031994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata795Open in IMG/M
3300018783|Ga0193197_1036935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300018783|Ga0193197_1053926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300018783|Ga0193197_1055960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata589Open in IMG/M
3300018783|Ga0193197_1061366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300018783|Ga0193197_1069102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300018793|Ga0192928_1049932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata749Open in IMG/M
3300018794|Ga0193357_1028972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata887Open in IMG/M
3300018794|Ga0193357_1028977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata887Open in IMG/M
3300018794|Ga0193357_1029236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata884Open in IMG/M
3300018794|Ga0193357_1040629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata764Open in IMG/M
3300018794|Ga0193357_1043670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300018794|Ga0193357_1049469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata695Open in IMG/M
3300018794|Ga0193357_1053051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata671Open in IMG/M
3300018794|Ga0193357_1065310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300018794|Ga0193357_1069338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata582Open in IMG/M
3300018794|Ga0193357_1082514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300018794|Ga0193357_1089890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300018796|Ga0193117_1050143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata702Open in IMG/M
3300018796|Ga0193117_1051793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata689Open in IMG/M
3300018796|Ga0193117_1054673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata667Open in IMG/M
3300018802|Ga0193388_1032488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra833Open in IMG/M
3300018802|Ga0193388_1037651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata773Open in IMG/M
3300018802|Ga0193388_1049208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata672Open in IMG/M
3300018802|Ga0193388_1049342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata671Open in IMG/M
3300018802|Ga0193388_1053018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata645Open in IMG/M
3300018802|Ga0193388_1071695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300018804|Ga0193329_1046068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata872Open in IMG/M
3300018804|Ga0193329_1049009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata842Open in IMG/M
3300018804|Ga0193329_1078981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300018804|Ga0193329_1091088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300018804|Ga0193329_1101796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300018804|Ga0193329_1105250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300018807|Ga0193441_1063811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata648Open in IMG/M
3300018812|Ga0192829_1099551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300018819|Ga0193497_1036379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra913Open in IMG/M
3300018819|Ga0193497_1074884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata621Open in IMG/M
3300018820|Ga0193172_1076156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300018821|Ga0193412_1055522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata620Open in IMG/M
3300018834|Ga0192877_1156168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300018837|Ga0192927_1053547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata629Open in IMG/M
3300018844|Ga0193312_1019627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata843Open in IMG/M
3300018844|Ga0193312_1022381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata809Open in IMG/M
3300018844|Ga0193312_1023491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata796Open in IMG/M
3300018844|Ga0193312_1061600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300018845|Ga0193042_1075469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata956Open in IMG/M
3300018845|Ga0193042_1075766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata953Open in IMG/M
3300018845|Ga0193042_1075767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata953Open in IMG/M
3300018845|Ga0193042_1077630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata936Open in IMG/M
3300018845|Ga0193042_1077631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata936Open in IMG/M
3300018845|Ga0193042_1085162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata872Open in IMG/M
3300018845|Ga0193042_1100698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata760Open in IMG/M
3300018845|Ga0193042_1113986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata683Open in IMG/M
3300018845|Ga0193042_1135759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata581Open in IMG/M
3300018847|Ga0193500_1042789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata789Open in IMG/M
3300018847|Ga0193500_1044728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata772Open in IMG/M
3300018847|Ga0193500_1045732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata763Open in IMG/M
3300018847|Ga0193500_1063032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata637Open in IMG/M
3300018848|Ga0192970_1027806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1050Open in IMG/M
3300018849|Ga0193005_1065836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300018850|Ga0193273_1013607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata945Open in IMG/M
3300018850|Ga0193273_1016589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata891Open in IMG/M
3300018850|Ga0193273_1077768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300018853|Ga0192958_1116731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata629Open in IMG/M
3300018854|Ga0193214_1047373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata831Open in IMG/M
3300018854|Ga0193214_1072416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata645Open in IMG/M
3300018854|Ga0193214_1080801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300018854|Ga0193214_1104972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300018858|Ga0193413_1059007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300018858|Ga0193413_1082650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300018859|Ga0193199_1046446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra970Open in IMG/M
3300018859|Ga0193199_1059348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata851Open in IMG/M
3300018859|Ga0193199_1066508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata797Open in IMG/M
3300018859|Ga0193199_1066515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata797Open in IMG/M
3300018859|Ga0193199_1077041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata729Open in IMG/M
3300018859|Ga0193199_1114849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300018861|Ga0193072_1088231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata598Open in IMG/M
3300018865|Ga0193359_1049219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata812Open in IMG/M
3300018865|Ga0193359_1069733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata673Open in IMG/M
3300018865|Ga0193359_1072931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata656Open in IMG/M
3300018865|Ga0193359_1075877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300018865|Ga0193359_1083012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata608Open in IMG/M
3300018865|Ga0193359_1098472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300018867|Ga0192859_1031617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata826Open in IMG/M
3300018867|Ga0192859_1032467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata817Open in IMG/M
3300018867|Ga0192859_1032795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata814Open in IMG/M
3300018867|Ga0192859_1054688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata653Open in IMG/M
3300018867|Ga0192859_1068508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300018867|Ga0192859_1068730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300018867|Ga0192859_1069767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata578Open in IMG/M
3300018867|Ga0192859_1073365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300018867|Ga0192859_1079368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300018867|Ga0192859_1080454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300018867|Ga0192859_1085344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300018867|Ga0192859_1086908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300018867|Ga0192859_1087219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300018872|Ga0193162_1037783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra942Open in IMG/M
3300018872|Ga0193162_1097582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300018873|Ga0193553_1090165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata799Open in IMG/M
3300018873|Ga0193553_1099301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata744Open in IMG/M
3300018882|Ga0193471_1062929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata711Open in IMG/M
3300018883|Ga0193276_1047055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata890Open in IMG/M
3300018883|Ga0193276_1051945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata847Open in IMG/M
3300018883|Ga0193276_1056951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata808Open in IMG/M
3300018883|Ga0193276_1080041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata672Open in IMG/M
3300018883|Ga0193276_1083232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata657Open in IMG/M
3300018883|Ga0193276_1089680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata630Open in IMG/M
3300018885|Ga0193311_10046788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata626Open in IMG/M
3300018888|Ga0193304_1036669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra926Open in IMG/M
3300018893|Ga0193258_1136997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra814Open in IMG/M
3300018896|Ga0192965_1174531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata594Open in IMG/M
3300018903|Ga0193244_1033016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata935Open in IMG/M
3300018903|Ga0193244_1035285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata907Open in IMG/M
3300018903|Ga0193244_1053662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata743Open in IMG/M
3300018903|Ga0193244_1056782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata722Open in IMG/M
3300018903|Ga0193244_1058415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata712Open in IMG/M
3300018903|Ga0193244_1060206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata701Open in IMG/M
3300018903|Ga0193244_1062102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata690Open in IMG/M
3300018903|Ga0193244_1064240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata678Open in IMG/M
3300018903|Ga0193244_1069302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata652Open in IMG/M
3300018903|Ga0193244_1069943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata649Open in IMG/M
3300018903|Ga0193244_1076393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata619Open in IMG/M
3300018903|Ga0193244_1094534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300018903|Ga0193244_1095122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300018903|Ga0193244_1095654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata548Open in IMG/M
3300018903|Ga0193244_1098082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300018904|Ga0192874_10034852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata940Open in IMG/M
3300018904|Ga0192874_10048585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata802Open in IMG/M
3300018908|Ga0193279_1035388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1022Open in IMG/M
3300018908|Ga0193279_1065281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata758Open in IMG/M
3300018908|Ga0193279_1068398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300018908|Ga0193279_1096539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata608Open in IMG/M
3300018908|Ga0193279_1117003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300018926|Ga0192989_10118116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata660Open in IMG/M
3300018927|Ga0193083_10033165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata718Open in IMG/M
3300018929|Ga0192921_10117262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata870Open in IMG/M
3300018929|Ga0192921_10158427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata704Open in IMG/M
3300018930|Ga0192955_10040490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1023Open in IMG/M
3300018930|Ga0192955_10041068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1018Open in IMG/M
3300018930|Ga0192955_10075071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata815Open in IMG/M
3300018930|Ga0192955_10118186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata671Open in IMG/M
3300018934|Ga0193552_10129520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata715Open in IMG/M
3300018934|Ga0193552_10164641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300018934|Ga0193552_10172506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata615Open in IMG/M
3300018942|Ga0193426_10079196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata726Open in IMG/M
3300018942|Ga0193426_10092867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata672Open in IMG/M
3300018943|Ga0193266_10130391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata644Open in IMG/M
3300018947|Ga0193066_10066032All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300018947|Ga0193066_10066041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1026Open in IMG/M
3300018947|Ga0193066_10118539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata773Open in IMG/M
3300018947|Ga0193066_10119351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata770Open in IMG/M
3300018947|Ga0193066_10120839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata765Open in IMG/M
3300018947|Ga0193066_10145424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata691Open in IMG/M
3300018947|Ga0193066_10169986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300018947|Ga0193066_10176682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata616Open in IMG/M
3300018947|Ga0193066_10182979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata603Open in IMG/M
3300018947|Ga0193066_10215396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300018947|Ga0193066_10234053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300018951|Ga0193128_10086133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata751Open in IMG/M
3300018951|Ga0193128_10086146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata751Open in IMG/M
3300018951|Ga0193128_10094456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata718Open in IMG/M
3300018951|Ga0193128_10130892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata607Open in IMG/M
3300018957|Ga0193528_10110438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1022Open in IMG/M
3300018957|Ga0193528_10138511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata902Open in IMG/M
3300018957|Ga0193528_10142228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata888Open in IMG/M
3300018957|Ga0193528_10144862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata879Open in IMG/M
3300018957|Ga0193528_10153053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata851Open in IMG/M
3300018957|Ga0193528_10156751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata839Open in IMG/M
3300018957|Ga0193528_10157037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata838Open in IMG/M
3300018957|Ga0193528_10175511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata782Open in IMG/M
3300018957|Ga0193528_10178397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata774Open in IMG/M
3300018957|Ga0193528_10195778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata729Open in IMG/M
3300018957|Ga0193528_10201902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata714Open in IMG/M
3300018957|Ga0193528_10208880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata698Open in IMG/M
3300018957|Ga0193528_10216002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata682Open in IMG/M
3300018957|Ga0193528_10276499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300018957|Ga0193528_10284934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata557Open in IMG/M
3300018961|Ga0193531_10159076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata874Open in IMG/M
3300018961|Ga0193531_10171617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata832Open in IMG/M
3300018961|Ga0193531_10191753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata773Open in IMG/M
3300018961|Ga0193531_10220728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata701Open in IMG/M
3300018961|Ga0193531_10290622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300018964|Ga0193087_10196034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata649Open in IMG/M
3300018966|Ga0193293_10023041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata894Open in IMG/M
3300018966|Ga0193293_10029259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata836Open in IMG/M
3300018966|Ga0193293_10042831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata747Open in IMG/M
3300018966|Ga0193293_10087199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata592Open in IMG/M
3300018966|Ga0193293_10093613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata577Open in IMG/M
3300018966|Ga0193293_10098668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata566Open in IMG/M
3300018966|Ga0193293_10133528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300018970|Ga0193417_10176420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata680Open in IMG/M
3300018972|Ga0193326_10027820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata852Open in IMG/M
3300018972|Ga0193326_10038437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata751Open in IMG/M
3300018974|Ga0192873_10259723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata750Open in IMG/M
3300018974|Ga0192873_10304882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata676Open in IMG/M
3300018976|Ga0193254_10036562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1105Open in IMG/M
3300018976|Ga0193254_10114439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata624Open in IMG/M
3300018976|Ga0193254_10138561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata557Open in IMG/M
3300018978|Ga0193487_10056070All Organisms → cellular organisms → Eukaryota → Sar1430Open in IMG/M
3300018978|Ga0193487_10071344All Organisms → cellular organisms → Eukaryota → Sar1260Open in IMG/M
3300018978|Ga0193487_10148477All Organisms → cellular organisms → Eukaryota → Sar811Open in IMG/M
3300018978|Ga0193487_10168294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata745Open in IMG/M
3300018978|Ga0193487_10192209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata679Open in IMG/M
3300018978|Ga0193487_10205253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300018978|Ga0193487_10212860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata630Open in IMG/M
3300018978|Ga0193487_10221475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata612Open in IMG/M
3300018978|Ga0193487_10229856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata596Open in IMG/M
3300018978|Ga0193487_10236582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300018978|Ga0193487_10272995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata523Open in IMG/M
3300018978|Ga0193487_10284261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300018979|Ga0193540_10094382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata823Open in IMG/M
3300018979|Ga0193540_10107551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata775Open in IMG/M
3300018979|Ga0193540_10139946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata678Open in IMG/M
3300018979|Ga0193540_10149451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata654Open in IMG/M
3300018979|Ga0193540_10156097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata639Open in IMG/M
3300018979|Ga0193540_10219012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300018980|Ga0192961_10153255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata701Open in IMG/M
3300018980|Ga0192961_10168186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata665Open in IMG/M
3300018980|Ga0192961_10230216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300018981|Ga0192968_10056638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1074Open in IMG/M
3300018982|Ga0192947_10222125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata615Open in IMG/M
3300018985|Ga0193136_10066534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata984Open in IMG/M
3300018985|Ga0193136_10096368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata848Open in IMG/M
3300018985|Ga0193136_10110985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata797Open in IMG/M
3300018986|Ga0193554_10109355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata941Open in IMG/M
3300018987|Ga0193188_10038736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata793Open in IMG/M
3300018988|Ga0193275_10138690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata732Open in IMG/M
3300018988|Ga0193275_10166161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata677Open in IMG/M
3300018989|Ga0193030_10096916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata900Open in IMG/M
3300018989|Ga0193030_10249030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300018989|Ga0193030_10265875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata561Open in IMG/M
3300018995|Ga0193430_10046078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata962Open in IMG/M
3300018995|Ga0193430_10054762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata898Open in IMG/M
3300018995|Ga0193430_10055974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata890Open in IMG/M
3300018995|Ga0193430_10056119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata889Open in IMG/M
3300018995|Ga0193430_10066861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata826Open in IMG/M
3300018995|Ga0193430_10077888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata773Open in IMG/M
3300018995|Ga0193430_10080010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata764Open in IMG/M
3300018995|Ga0193430_10088926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata729Open in IMG/M
3300018995|Ga0193430_10104926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata674Open in IMG/M
3300018995|Ga0193430_10119823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300018995|Ga0193430_10122640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata625Open in IMG/M
3300018995|Ga0193430_10141064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300018995|Ga0193430_10152001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata563Open in IMG/M
3300018995|Ga0193430_10169422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata533Open in IMG/M
3300018995|Ga0193430_10178343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300018996|Ga0192916_10116466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata801Open in IMG/M
3300018996|Ga0192916_10146692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata706Open in IMG/M
3300018996|Ga0192916_10147274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata704Open in IMG/M
3300018996|Ga0192916_10206851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300018996|Ga0192916_10227227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300018997|Ga0193257_10170196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata651Open in IMG/M
3300018997|Ga0193257_10176056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata636Open in IMG/M
3300018997|Ga0193257_10187330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300018997|Ga0193257_10219644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300018998|Ga0193444_10046658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1077Open in IMG/M
3300018998|Ga0193444_10075185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata876Open in IMG/M
3300018998|Ga0193444_10079059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata856Open in IMG/M
3300018998|Ga0193444_10098816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata769Open in IMG/M
3300018998|Ga0193444_10104754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata747Open in IMG/M
3300018998|Ga0193444_10117541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata705Open in IMG/M
3300018998|Ga0193444_10175591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata563Open in IMG/M
3300018998|Ga0193444_10179527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300018998|Ga0193444_10191818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300018998|Ga0193444_10202300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata518Open in IMG/M
3300018999|Ga0193514_10077911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1184Open in IMG/M
3300018999|Ga0193514_10107433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1017Open in IMG/M
3300018999|Ga0193514_10123578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata948Open in IMG/M
3300018999|Ga0193514_10138257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata892Open in IMG/M
3300018999|Ga0193514_10150470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata851Open in IMG/M
3300018999|Ga0193514_10202578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata713Open in IMG/M
3300018999|Ga0193514_10205090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata708Open in IMG/M
3300018999|Ga0193514_10227973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata661Open in IMG/M
3300018999|Ga0193514_10237231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata643Open in IMG/M
3300018999|Ga0193514_10278327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata576Open in IMG/M
3300019000|Ga0192953_10027468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1078Open in IMG/M
3300019000|Ga0192953_10045474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata925Open in IMG/M
3300019000|Ga0192953_10076929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata772Open in IMG/M
3300019000|Ga0192953_10084815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata744Open in IMG/M
3300019001|Ga0193034_10098973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata667Open in IMG/M
3300019001|Ga0193034_10124520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata610Open in IMG/M
3300019003|Ga0193033_10131744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata727Open in IMG/M
3300019007|Ga0193196_10107706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1136Open in IMG/M
3300019007|Ga0193196_10139177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1019Open in IMG/M
3300019007|Ga0193196_10194867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata871Open in IMG/M
3300019007|Ga0193196_10217772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata823Open in IMG/M
3300019007|Ga0193196_10265102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata741Open in IMG/M
3300019007|Ga0193196_10268332All Organisms → cellular organisms → Eukaryota → Sar736Open in IMG/M
3300019007|Ga0193196_10272346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata730Open in IMG/M
3300019007|Ga0193196_10287250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata708Open in IMG/M
3300019007|Ga0193196_10329553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata652Open in IMG/M
3300019007|Ga0193196_10342090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata637Open in IMG/M
3300019007|Ga0193196_10373758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300019007|Ga0193196_10385351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300019007|Ga0193196_10425831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300019007|Ga0193196_10461389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300019007|Ga0193196_10468938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300019007|Ga0193196_10485502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300019010|Ga0193044_10078345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1089Open in IMG/M
3300019010|Ga0193044_10092444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1000Open in IMG/M
3300019010|Ga0193044_10116273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata881Open in IMG/M
3300019010|Ga0193044_10118699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata871Open in IMG/M
3300019010|Ga0193044_10148767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata765Open in IMG/M
3300019010|Ga0193044_10159210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata734Open in IMG/M
3300019010|Ga0193044_10195988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata643Open in IMG/M
3300019010|Ga0193044_10217547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata600Open in IMG/M
3300019010|Ga0193044_10229571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata579Open in IMG/M
3300019010|Ga0193044_10230117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata578Open in IMG/M
3300019010|Ga0193044_10236008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata568Open in IMG/M
3300019011|Ga0192926_10259372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata744Open in IMG/M
3300019011|Ga0192926_10301925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata685Open in IMG/M
3300019011|Ga0192926_10422425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300019012|Ga0193043_10175576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata879Open in IMG/M
3300019012|Ga0193043_10187635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra837Open in IMG/M
3300019012|Ga0193043_10201549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata792Open in IMG/M
3300019012|Ga0193043_10250790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata670Open in IMG/M
3300019012|Ga0193043_10268827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata635Open in IMG/M
3300019012|Ga0193043_10307682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300019012|Ga0193043_10338306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300019012|Ga0193043_10358823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300019017|Ga0193569_10206599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata866Open in IMG/M
3300019017|Ga0193569_10214369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata845Open in IMG/M
3300019017|Ga0193569_10234736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata794Open in IMG/M
3300019017|Ga0193569_10329690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata619Open in IMG/M
3300019019|Ga0193555_10140270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata853Open in IMG/M
3300019019|Ga0193555_10144840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata836Open in IMG/M
3300019019|Ga0193555_10149102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata821Open in IMG/M
3300019019|Ga0193555_10150322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata817Open in IMG/M
3300019019|Ga0193555_10156960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata794Open in IMG/M
3300019019|Ga0193555_10158419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata789Open in IMG/M
3300019019|Ga0193555_10172964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata744Open in IMG/M
3300019020|Ga0193538_10238286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata596Open in IMG/M
3300019021|Ga0192982_10048153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1256Open in IMG/M
3300019021|Ga0192982_10068563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1113Open in IMG/M
3300019022|Ga0192951_10146932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata828Open in IMG/M
3300019024|Ga0193535_10134325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata805Open in IMG/M
3300019035|Ga0192875_10144688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata610Open in IMG/M
3300019036|Ga0192945_10228006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata594Open in IMG/M
3300019037|Ga0192886_10103688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata838Open in IMG/M
3300019039|Ga0193123_10143606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata930Open in IMG/M
3300019039|Ga0193123_10366639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300019040|Ga0192857_10051522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata973Open in IMG/M
3300019040|Ga0192857_10054019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata961Open in IMG/M
3300019040|Ga0192857_10067330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata905Open in IMG/M
3300019040|Ga0192857_10077524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata870Open in IMG/M
3300019040|Ga0192857_10081317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata858Open in IMG/M
3300019040|Ga0192857_10093938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata822Open in IMG/M
3300019040|Ga0192857_10097907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata812Open in IMG/M
3300019040|Ga0192857_10102861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata800Open in IMG/M
3300019040|Ga0192857_10114270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata774Open in IMG/M
3300019040|Ga0192857_10120653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata761Open in IMG/M
3300019040|Ga0192857_10128645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata746Open in IMG/M
3300019040|Ga0192857_10143783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata720Open in IMG/M
3300019040|Ga0192857_10157289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata698Open in IMG/M
3300019040|Ga0192857_10160610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata693Open in IMG/M
3300019040|Ga0192857_10230646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata608Open in IMG/M
3300019040|Ga0192857_10256714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300019040|Ga0192857_10313532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300019040|Ga0192857_10317835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300019049|Ga0193082_10399468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata744Open in IMG/M
3300019050|Ga0192966_10160852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata800Open in IMG/M
3300019053|Ga0193356_10092063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1005Open in IMG/M
3300019053|Ga0193356_10103699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata956Open in IMG/M
3300019053|Ga0193356_10109479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata935Open in IMG/M
3300019053|Ga0193356_10125047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata882Open in IMG/M
3300019053|Ga0193356_10133902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata855Open in IMG/M
3300019053|Ga0193356_10142873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata830Open in IMG/M
3300019053|Ga0193356_10152087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata806Open in IMG/M
3300019053|Ga0193356_10178611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata745Open in IMG/M
3300019053|Ga0193356_10199143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata705Open in IMG/M
3300019053|Ga0193356_10226642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata659Open in IMG/M
3300019053|Ga0193356_10230308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata654Open in IMG/M
3300019053|Ga0193356_10240268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata639Open in IMG/M
3300019053|Ga0193356_10252679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata622Open in IMG/M
3300019053|Ga0193356_10288942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata577Open in IMG/M
3300019053|Ga0193356_10309610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300019053|Ga0193356_10316532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300019053|Ga0193356_10337445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300019053|Ga0193356_10344113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300019053|Ga0193356_10344118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300019053|Ga0193356_10353593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300019054|Ga0192992_10116745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata784Open in IMG/M
3300019054|Ga0192992_10174989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata682Open in IMG/M
3300019054|Ga0192992_10190995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata661Open in IMG/M
3300019055|Ga0193208_10315339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata808Open in IMG/M
3300019055|Ga0193208_10320582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata802Open in IMG/M
3300019055|Ga0193208_10377873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300019055|Ga0193208_10415480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata704Open in IMG/M
3300019055|Ga0193208_10437347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata685Open in IMG/M
3300019055|Ga0193208_10475670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata655Open in IMG/M
3300019055|Ga0193208_10658985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300019070|Ga0193485_101414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra957Open in IMG/M
3300019088|Ga0193129_1014703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata624Open in IMG/M
3300019088|Ga0193129_1017429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata577Open in IMG/M
3300019091|Ga0192935_1008733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata891Open in IMG/M
3300019091|Ga0192935_1008794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata889Open in IMG/M
3300019091|Ga0192935_1010108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata836Open in IMG/M
3300019091|Ga0192935_1014432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata710Open in IMG/M
3300019091|Ga0192935_1018036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300019094|Ga0193040_1005146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata734Open in IMG/M
3300019094|Ga0193040_1005995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata710Open in IMG/M
3300019094|Ga0193040_1009032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata646Open in IMG/M
3300019094|Ga0193040_1009388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata640Open in IMG/M
3300019094|Ga0193040_1009558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata637Open in IMG/M
3300019094|Ga0193040_1012821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata592Open in IMG/M
3300019099|Ga0193102_1017358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata667Open in IMG/M
3300019100|Ga0193045_1034925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata840Open in IMG/M
3300019100|Ga0193045_1044398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata730Open in IMG/M
3300019100|Ga0193045_1051901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata660Open in IMG/M
3300019100|Ga0193045_1053999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata643Open in IMG/M
3300019103|Ga0192946_1024620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata901Open in IMG/M
3300019108|Ga0192972_1039113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata929Open in IMG/M
3300019111|Ga0193541_1030031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata908Open in IMG/M
3300019111|Ga0193541_1045079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata771Open in IMG/M
3300019111|Ga0193541_1069155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata621Open in IMG/M
3300019112|Ga0193106_1017248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300019112|Ga0193106_1043363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300019115|Ga0193443_1013986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata793Open in IMG/M
3300019115|Ga0193443_1029194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300019119|Ga0192885_1046579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata580Open in IMG/M
3300019120|Ga0193256_1030470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata908Open in IMG/M
3300019120|Ga0193256_1033667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata869Open in IMG/M
3300019120|Ga0193256_1036535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra835Open in IMG/M
3300019120|Ga0193256_1052872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata690Open in IMG/M
3300019125|Ga0193104_1021716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata858Open in IMG/M
3300019126|Ga0193144_1012444All Organisms → Viruses → Predicted Viral1062Open in IMG/M
3300019126|Ga0193144_1013496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1041Open in IMG/M
3300019126|Ga0193144_1014736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1018Open in IMG/M
3300019126|Ga0193144_1022857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra905Open in IMG/M
3300019126|Ga0193144_1030773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata828Open in IMG/M
3300019126|Ga0193144_1031934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra819Open in IMG/M
3300019126|Ga0193144_1041517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata752Open in IMG/M
3300019126|Ga0193144_1076973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300019131|Ga0193249_1071813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata827Open in IMG/M
3300019133|Ga0193089_1073470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata825Open in IMG/M
3300019133|Ga0193089_1079368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata788Open in IMG/M
3300019133|Ga0193089_1084785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata757Open in IMG/M
3300019133|Ga0193089_1094720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata706Open in IMG/M
3300019134|Ga0193515_1034720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata918Open in IMG/M
3300019134|Ga0193515_1048076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata771Open in IMG/M
3300019134|Ga0193515_1048329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata769Open in IMG/M
3300019134|Ga0193515_1049718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata756Open in IMG/M
3300019134|Ga0193515_1051503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata741Open in IMG/M
3300019134|Ga0193515_1051848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata738Open in IMG/M
3300019136|Ga0193112_1047488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1007Open in IMG/M
3300019136|Ga0193112_1062362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata884Open in IMG/M
3300019136|Ga0193112_1141077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300019139|Ga0193047_1035471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata908Open in IMG/M
3300019143|Ga0192856_1020123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata822Open in IMG/M
3300019143|Ga0192856_1020160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata822Open in IMG/M
3300019143|Ga0192856_1027522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata743Open in IMG/M
3300019143|Ga0192856_1037755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata666Open in IMG/M
3300019143|Ga0192856_1043554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata630Open in IMG/M
3300019143|Ga0192856_1043918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata628Open in IMG/M
3300019143|Ga0192856_1052641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300019143|Ga0192856_1052750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300019143|Ga0192856_1052951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata582Open in IMG/M
3300019143|Ga0192856_1057875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata561Open in IMG/M
3300019143|Ga0192856_1059397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300019143|Ga0192856_1061751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300019143|Ga0192856_1069769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300019143|Ga0192856_1071367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300019144|Ga0193246_10157925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata786Open in IMG/M
3300019150|Ga0194244_10018384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra903Open in IMG/M
3300019150|Ga0194244_10106002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300019151|Ga0192888_10120486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata864Open in IMG/M
3300019151|Ga0192888_10120496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata864Open in IMG/M
3300019151|Ga0192888_10122609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata854Open in IMG/M
3300019151|Ga0192888_10127396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata833Open in IMG/M
3300019151|Ga0192888_10132894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata810Open in IMG/M
3300019151|Ga0192888_10133776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata806Open in IMG/M
3300019151|Ga0192888_10137056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra793Open in IMG/M
3300019151|Ga0192888_10144442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata765Open in IMG/M
3300019151|Ga0192888_10159739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata714Open in IMG/M
3300019151|Ga0192888_10173954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata672Open in IMG/M
3300019152|Ga0193564_10144239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata748Open in IMG/M
3300019152|Ga0193564_10224991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300019153|Ga0192975_10238131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata627Open in IMG/M
3300019214|Ga0180037_1001055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata770Open in IMG/M
3300021305|Ga0210296_1102079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata922Open in IMG/M
3300021317|Ga0210309_1086805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300021336|Ga0210307_1061058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata699Open in IMG/M
3300021863|Ga0063140_104247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300021863|Ga0063140_104594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300021865|Ga0063110_101770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata691Open in IMG/M
3300021869|Ga0063107_101209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra980Open in IMG/M
3300021879|Ga0063113_105449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata737Open in IMG/M
3300021881|Ga0063117_1010194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata655Open in IMG/M
3300021881|Ga0063117_1011634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata770Open in IMG/M
3300021882|Ga0063115_1003468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata656Open in IMG/M
3300021886|Ga0063114_1033660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata691Open in IMG/M
3300021889|Ga0063089_1048473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata816Open in IMG/M
3300021891|Ga0063093_1024539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata742Open in IMG/M
3300021891|Ga0063093_1040005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata604Open in IMG/M
3300021893|Ga0063142_1038723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata763Open in IMG/M
3300021893|Ga0063142_1067447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata747Open in IMG/M
3300021893|Ga0063142_1118231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300021896|Ga0063136_1091575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300021898|Ga0063097_1000589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra953Open in IMG/M
3300021899|Ga0063144_1099138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300021905|Ga0063088_1067206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata689Open in IMG/M
3300021906|Ga0063087_1133071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300021910|Ga0063100_1079736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata809Open in IMG/M
3300021911|Ga0063106_1028105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300021912|Ga0063133_1030894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300021925|Ga0063096_1055326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300021925|Ga0063096_1061478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata874Open in IMG/M
3300021927|Ga0063103_1028519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300021930|Ga0063145_1023440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata879Open in IMG/M
3300021940|Ga0063108_1044212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata809Open in IMG/M
3300021941|Ga0063102_1000206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata673Open in IMG/M
3300021941|Ga0063102_1018865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1322Open in IMG/M
3300021941|Ga0063102_1053685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata539Open in IMG/M
3300021950|Ga0063101_1002521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300021950|Ga0063101_1077204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300022369|Ga0210310_1018978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata697Open in IMG/M
3300028575|Ga0304731_10308190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata711Open in IMG/M
3300028575|Ga0304731_11054578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300028575|Ga0304731_11193553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata572Open in IMG/M
3300028575|Ga0304731_11635766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300030749|Ga0073969_10018239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra804Open in IMG/M
3300030750|Ga0073967_10002597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata735Open in IMG/M
3300030750|Ga0073967_10007932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata682Open in IMG/M
3300030750|Ga0073967_10009579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300030750|Ga0073967_10009632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata701Open in IMG/M
3300030787|Ga0073965_10000141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata811Open in IMG/M
3300030787|Ga0073965_11732415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata853Open in IMG/M
3300030788|Ga0073964_10000883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata656Open in IMG/M
3300030801|Ga0073947_1814611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300030801|Ga0073947_1889860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata573Open in IMG/M
3300030857|Ga0073981_11708319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata742Open in IMG/M
3300030859|Ga0073963_11428292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata786Open in IMG/M
3300030871|Ga0151494_1110331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata627Open in IMG/M
3300030871|Ga0151494_1220281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300030871|Ga0151494_1286499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata770Open in IMG/M
3300030918|Ga0073985_11030666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300030919|Ga0073970_11191409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata839Open in IMG/M
3300030921|Ga0073951_11144164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata716Open in IMG/M
3300030924|Ga0138348_1225214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata712Open in IMG/M
3300030924|Ga0138348_1610407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata582Open in IMG/M
3300030951|Ga0073937_10002284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata579Open in IMG/M
3300030951|Ga0073937_10018263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300030951|Ga0073937_10025200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata664Open in IMG/M
3300030951|Ga0073937_11945963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300030951|Ga0073937_12024711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata790Open in IMG/M
3300030953|Ga0073941_10003794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300030953|Ga0073941_10007579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata861Open in IMG/M
3300030953|Ga0073941_10007714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300030953|Ga0073941_10012448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300030953|Ga0073941_12112494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300030953|Ga0073941_12180714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata655Open in IMG/M
3300030953|Ga0073941_12187079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata600Open in IMG/M
3300030954|Ga0073942_11796611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300030954|Ga0073942_11896816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata616Open in IMG/M
3300030955|Ga0073943_11630765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300031032|Ga0073980_11302283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata745Open in IMG/M
3300031037|Ga0073979_10029280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata872Open in IMG/M
3300031037|Ga0073979_12293552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300031037|Ga0073979_12388664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata678Open in IMG/M
3300031037|Ga0073979_12462175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata565Open in IMG/M
3300031063|Ga0073961_10015462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata923Open in IMG/M
3300031063|Ga0073961_10019265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata892Open in IMG/M
3300031063|Ga0073961_11854879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300031113|Ga0138347_10999775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata821Open in IMG/M
3300031120|Ga0073958_11425890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300031126|Ga0073962_10013800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata640Open in IMG/M
3300031522|Ga0307388_10570694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata749Open in IMG/M
3300031550|Ga0307392_1046067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300031709|Ga0307385_10390238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300031717|Ga0307396_10303739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata763Open in IMG/M
3300031717|Ga0307396_10518058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata573Open in IMG/M
3300031737|Ga0307387_10421895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata817Open in IMG/M
3300031738|Ga0307384_10482505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300031739|Ga0307383_10273160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata813Open in IMG/M
3300031739|Ga0307383_10284926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata796Open in IMG/M
3300031742|Ga0307395_10387928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata607Open in IMG/M
3300031750|Ga0307389_10716030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata653Open in IMG/M
3300031750|Ga0307389_10995506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300031750|Ga0307389_11175945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300031752|Ga0307404_10248217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata736Open in IMG/M
3300032517|Ga0314688_10431707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata715Open in IMG/M
3300032518|Ga0314689_10211125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1004Open in IMG/M
3300032518|Ga0314689_10242194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata939Open in IMG/M
3300032518|Ga0314689_10422379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata700Open in IMG/M
3300032519|Ga0314676_10419648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata796Open in IMG/M
3300032520|Ga0314667_10457396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata710Open in IMG/M
3300032521|Ga0314680_10307554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata963Open in IMG/M
3300032522|Ga0314677_10594029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300032616|Ga0314671_10279402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata906Open in IMG/M
3300032650|Ga0314673_10148073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1088Open in IMG/M
3300032650|Ga0314673_10195384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata978Open in IMG/M
3300032650|Ga0314673_10245730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata889Open in IMG/M
3300032650|Ga0314673_10466243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata651Open in IMG/M
3300032651|Ga0314685_10279415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata920Open in IMG/M
3300032708|Ga0314669_10209480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1005Open in IMG/M
3300032708|Ga0314669_10700941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300032713|Ga0314690_10413883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata670Open in IMG/M
3300032714|Ga0314686_10204351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata969Open in IMG/M
3300032724|Ga0314695_1266477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata657Open in IMG/M
3300032730|Ga0314699_10409888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300032742|Ga0314710_10119453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1010Open in IMG/M
3300032746|Ga0314701_10249679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata801Open in IMG/M
3300032747|Ga0314712_10424599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300032748|Ga0314713_10178959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata885Open in IMG/M
3300032748|Ga0314713_10333473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata646Open in IMG/M
3300032748|Ga0314713_10373008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata607Open in IMG/M
3300032751|Ga0314694_10309115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata676Open in IMG/M
3300033572|Ga0307390_10269805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1006Open in IMG/M
3300033572|Ga0307390_10274937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata998Open in IMG/M
3300033572|Ga0307390_10580424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata698Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine76.88%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.26%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.90%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.69%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water2.04%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.72%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.75%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.54%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.11%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.11%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008928Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E3EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008937Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3CEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008956Marine microbial communities from eastern North Pacific Ocean - P8 free-living McLaneEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009214Microbial communities of water from the North Atlantic ocean - ACM51EnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009268Eukaryotic communities of water from the North Atlantic ocean - ACM43EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009272Eukaryotic communities of water from the North Atlantic ocean - ACM45EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009334Microbial communities of water from the North Atlantic ocean - ACM46EnvironmentalOpen in IMG/M
3300009357Microbial communities of water from the North Atlantic ocean - ACM13EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018526Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000185 (ERX1782407-ERR1711866)EnvironmentalOpen in IMG/M
3300018534Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789412-ERR1719179)EnvironmentalOpen in IMG/M
3300018546Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002959 (ERX1789637-ERR1719441)EnvironmentalOpen in IMG/M
3300018555Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001618 (ERX1809464-ERR1739837)EnvironmentalOpen in IMG/M
3300018556Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001478 (ERX1789635-ERR1719475)EnvironmentalOpen in IMG/M
3300018580Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003039 (ERX1789370-ERR1719227)EnvironmentalOpen in IMG/M
3300018585Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000269 (ERX1782265-ERR1712044)EnvironmentalOpen in IMG/M
3300018588Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000538 (ERX1782191-ERR1712140)EnvironmentalOpen in IMG/M
3300018592Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782094-ERR1712047)EnvironmentalOpen in IMG/M
3300018600Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000535 (ERX1782170-ERR1711950)EnvironmentalOpen in IMG/M
3300018608Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002024 (ERX1782181-ERR1712102)EnvironmentalOpen in IMG/M
3300018611Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001660 (ERX1782173-ERR1712095)EnvironmentalOpen in IMG/M
3300018615Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782230-ERR1712123)EnvironmentalOpen in IMG/M
3300018616Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018635Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782126-ERR1712207)EnvironmentalOpen in IMG/M
3300018636Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897)EnvironmentalOpen in IMG/M
3300018637Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000837 (ERX1782121-ERR1712056)EnvironmentalOpen in IMG/M
3300018643Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782462-ERR1712152)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018651Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001512 (ERX1782264-ERR1711863)EnvironmentalOpen in IMG/M
3300018652Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782207-ERR1711900)EnvironmentalOpen in IMG/M
3300018653Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003013 (ERX1789553-ERR1719190)EnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018662Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878)EnvironmentalOpen in IMG/M
3300018668Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002464 (ERX1782441-ERR1712149)EnvironmentalOpen in IMG/M
3300018675Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001994 (ERX1789575-ERR1719413)EnvironmentalOpen in IMG/M
3300018683Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782475-ERR1712204)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018686Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000593 (ERX1789430-ERR1719415)EnvironmentalOpen in IMG/M
3300018691Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001616 (ERX1782222-ERR1712214)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018695Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789500-ERR1719457)EnvironmentalOpen in IMG/M
3300018696Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000864 (ERX1782143-ERR1711870)EnvironmentalOpen in IMG/M
3300018698Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001473 (ERX1809465-ERR1739846)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018704Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782253-ERR1711956)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018707Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789613-ERR1719509)EnvironmentalOpen in IMG/M
3300018708Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782185-ERR1711899)EnvironmentalOpen in IMG/M
3300018709Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782278-ERR1712213)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018718Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001994 (ERX1789426-ERR1719437)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018734Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001612 (ERX1789403-ERR1719254)EnvironmentalOpen in IMG/M
3300018738Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002938 (ERX1789371-ERR1719226)EnvironmentalOpen in IMG/M
3300018740Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789647-ERR1719307)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018743Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018758Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018767Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000075 (ERX1782420-ERR1711944)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018771Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001658 (ERX1789535-ERR1719438)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018777Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000589 (ERX1789605-ERR1719349)EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018802Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789649-ERR1719297)EnvironmentalOpen in IMG/M
3300018804Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001738 (ERX1789642-ERR1719208)EnvironmentalOpen in IMG/M
3300018807Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002356 (ERX1789611-ERR1719493)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018820Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000312 (ERX1789518-ERR1719511)EnvironmentalOpen in IMG/M
3300018821Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789489-ERR1719145)EnvironmentalOpen in IMG/M
3300018834Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789722-ERR1719319)EnvironmentalOpen in IMG/M
3300018837Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782235-ERR1712073)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018845Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809760-ERR1740122)EnvironmentalOpen in IMG/M
3300018847Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003005 (ERX1789704-ERR1719166)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018849Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002287 (ERX1789411-ERR1719439)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018853Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782437-ERR1712106)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018858Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789628-ERR1719293)EnvironmentalOpen in IMG/M
3300018859Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000012 (ERX1789645-ERR1719429)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018865Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001824 (ERX1789688-ERR1719211)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018893Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789445-ERR1719354)EnvironmentalOpen in IMG/M
3300018896Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789685-ERR1719483)EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018904Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789433-ERR1719416)EnvironmentalOpen in IMG/M
3300018908Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001584 (ERX1789660-ERR1719479)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018943Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001290 (ERX1789547-ERR1719206)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018951Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782096-ERR1711860)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018970Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789437-ERR1719295)EnvironmentalOpen in IMG/M
3300018972Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001734 (ERX1789632-ERR1719168)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018987Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789590-ERR1719255)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019035Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789492-ERR1719296)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019070Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002963 (ERX1789706-ERR1719363)EnvironmentalOpen in IMG/M
3300019088Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782331-ERR1712049)EnvironmentalOpen in IMG/M
3300019091Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001510 (ERX1782237-ERR1711876)EnvironmentalOpen in IMG/M
3300019094Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001489 (ERX1809466-ERR1739840)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019115Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002358 (ERX1782231-ERR1711979)EnvironmentalOpen in IMG/M
3300019119Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000701 (ERX1789718-ERR1719442)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019144Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001503 (ERX1789695-ERR1719376)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021317Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021863Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S20 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021865Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021879Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021882Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021886Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021891Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-20M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021906Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030749Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030750Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030787Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030801Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030871Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030918Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030919Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030921Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030924Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_V_5 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030953Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030954Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030955Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031063Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031120Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031126Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031550Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1005215823300008832MarineMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103951_1016273123300008832MarineVKKLQNQLVPAAGMYLENCKFVDYGLFGNLEVFSRVAFTTLLQNIDECKADPAINWKRGIKNGKYGPMGEDLFAQSCLDKNGVRRVEAFDITTDGACPATRPADQKKNKKWKPDCSTTSTAAMHPFKKTAEWVKCFEATIAAHGY*
Ga0103951_1025580413300008832MarineHQKSQNLGIFQCEYSAVFSDISVEVGGGMMTNVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103951_1028557913300008832MarineIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFMTLLSNIDLCNASAEINWKVGVKKGKYGPMGEDLFAQTCLDTKGVRRVEAFDITTDGACPADRPQDQKENKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ*
Ga0103951_1033331913300008832MarineKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPANRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY*
Ga0103882_1001457513300008834Surface Ocean WaterGLQTIKVEDADNDWHFAKRKETGAWINTGMFTQVWKAIASGGKTSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS*
Ga0103883_100632313300008835Surface Ocean WaterTIPVDDVEGHFHFAKRKVSGSWVNTGLFSQVWKKITKHVYTDWTVKVDADAVFIPNRLRSWLGGQLVPYNGIYLENCKFVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATIDAFGDR*
Ga0103883_101766013300008835Surface Ocean WaterSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS*
Ga0103711_1001965713300008928Ocean WaterMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAAFSDVSVDVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKGEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103732_100832423300008929Ice Edge, Mcmurdo Sound, AntarcticaMRIWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA*
Ga0103732_101909823300008929Ice Edge, Mcmurdo Sound, AntarcticaMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNKLVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTAAFGA*
Ga0103733_100637313300008930Ice Edge, Mcmurdo Sound, AntarcticaMYCFSVYTKNTGSTKQSHELEILQHQYLQQLGIFQCEESDVFSDVSVEVGGGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNKLVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTAAFGA*
Ga0103733_105349013300008930Ice Edge, Mcmurdo Sound, AntarcticaVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA*
Ga0103734_100493933300008931Ice Edge, Mcmurdo Sound, AntarcticaMYCFSVYTKNTGSTKQSHELEILQHQYLQQLGIFQCEESDVFSDVSVEVGGGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNKLVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCGSTATPAMHPFKKTQEWVQCYEATTAAFGA*
Ga0103735_100706613300008932Ice Edge, Mcmurdo Sound, AntarcticaMYCFSVYTKNTGSTKQSHELEILQHQYLQQLGIFQCEESDVFSDVSVEVGGGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNKLVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTSTPAMHPFKKTQEWVQCYEATTAAFGA*
Ga0103735_104026213300008932Ice Edge, Mcmurdo Sound, AntarcticaPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS*
Ga0103738_100105713300008935Ice Edge, Mcmurdo Sound, AntarcticaLTRSQTRLEPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS*
Ga0103738_101228913300008935Ice Edge, Mcmurdo Sound, AntarcticaTDWVMKLDADAIFIPSRMRVWLKQNKLVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTAAFGA*
Ga0103740_100085333300008937Ice Edge, Mcmurdo Sound, AntarcticaVLDTAKKLACAKRKVSGTWVNTGMFSQIWKQISTDGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA*
Ga0103740_100629613300008937Ice Edge, Mcmurdo Sound, AntarcticaMDPILQDAVPVGQKMYCFSVFTQDTGSTKQSHELDILKHQHSNHLGIFQCDYSDVFSDVSVQVGTGLMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEGNKYQNADWVMKLDADAIFVPNRMRIWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA*
Ga0103740_100825013300008937Ice Edge, Mcmurdo Sound, AntarcticaKQSHELEILQHQYSQQLGIFQCEESDVFSDVSVEVGGGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNKLVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTAAFGA*
Ga0103741_101072513300008938Ice Edge, Mcmurdo Sound, AntarcticaMYCFSVYTKNTGSTKQSHELEILQHQYKQKLGIFQCEESDVFSDDSAEVGGGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMKVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDMCKTTINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCGSTATPAMHPFKKTQEWVQCYEATTAAFGA*
Ga0104261_104106613300008956Ocean WaterFQCEYSDVFSDVSVQVGQGLMTKVVTDQEGDWHFAKRTVSGTWVNTGMFSQIWKPISADGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVEYGYFGNLEVFSKAAWSSLIDKIDDCKADSQINWKVGIHDGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPSDRPIDQ
Ga0104259_100276413300008958Ocean WaterMYCFSVYTKDTGSTKTSHELDILQHQHQQQLGIFQCEYSDVFSDVSVQVGQGLMTKVVTDQEGDWHFAKRKVSGTWVNTGMFSQIWKQISADGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIENIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA*
Ga0104259_100312413300008958Ocean WaterMDPILQDAVPVGQKMYCFSVYTKDTGSTKQSHELEILQHQHSQHLGLFQCDYSDVFSDVSVEVGSGYMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQNADWVLKLDADAIFVPNRMRVWLKTNELVPPAGIYLENCKNVDYGYFGNLEVFSREAFSTLIKNIDTCKQSLNWKVGVKDGKYGPMGEDLFAQSCLDSVGVRRREAFDITTDGACPADRPKDEQKNKKWKPNCEWAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103502_1013589513300008998MarineTGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS*
Ga0103502_1019442813300008998MarineMDPILQDAVPVGQTMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIASRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKN
Ga0103502_1026584813300008998MarineWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQACLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103502_1028007623300008998MarineWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTSAFGA*
Ga0103502_1028265413300008998MarineWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103502_1028896213300008998MarineWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103706_1004598813300009022Ocean WaterDKSLFDNSDYFIKADADGVFLPQRLLDTLKGYKEPAEGIYVENCRKVQYGFFGNLEVFSNMAFSILLANLDKCRSSLPWKVGIRNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKTSTAAMHPFKKEAEWFECFEATTAAFGY*
Ga0103706_1004943423300009022Ocean WaterTKDTGSSKPSHELEILQHQYSQHLGIFQCDYSDVFSDVSAEVGSGLMTTVVTDVEGDWHFAKRKTSGTWVNTGIFTQIWKKIAEEGKYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSRQAFSTLLQNIDVCKKSLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103706_1007362713300009022Ocean WaterLEILQHQYSQHLGIFQCDYSDVFSDVSVEVGSGLMTTVITDVEGDWHFAKRKTSGTWVNTGIFTQIWRRIAADGKYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSEINWKVGIKNGKYGPMGEDLFAQTCLDKWGVRRIEAFDITTDGACPADRPIDQQKNKK*
Ga0103706_1007917513300009022Ocean WaterWLSGRADTEHGVYFENCRDVQMGFFGNLEVISNMAFSVLLANMDKCRTTLPWKIGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAATATPAMHPFKKMADWIKCHDETVSAFGS*
Ga0103706_1008014813300009022Ocean WaterSRLTKKLESQMVPANGIYLENCKYVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS*
Ga0103706_1012300713300009022Ocean WaterCKYVEYGYFGNLGGFSKAAFSTLTAKIDDCKADSKINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS*
Ga0103706_1014409813300009022Ocean WaterGEMGKYQSADWVMKVDADAIFVPSRMRTWLFANRLVPPAGIYLENCKYVDYGYFGNLEVYSKQAFTTLIQNIDVCKSSINWKLGVKNGKYGPMGEDLFAQTCLDSKGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYESTTAAFGA*
Ga0103928_1037130113300009023Coastal WaterVDGDWHFAKRKVSGAWVNTGMFTQVWRAIAQNGKFWRAAWTAKVDADAVFVPSRLRTWVGKQRVPEAGIYLENCKFVDYGYFGNLEVYSQAAFWTLLQNIDMCKATLNWKVGVKNGMYGPMGEDLFAQTCLDKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCSKASTAAMHPFKKKE
Ga0103708_10005466423300009028Ocean WaterRRIGLFQCDQSDVFADVDVEVGPGLRTIQVDDVEGDFHLAKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLAEQRVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDEQKNKKWKPNCAYTSTAAMHPFKKKDEWFQCWEATVAAFGQ*
Ga0103708_10006733813300009028Ocean WaterTGAWVNTGMFSQVWKTIASGGKYQSADWVAKVDADAVFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPMCAWTATPAMHPFKKVADWIKCHDATTGSFGS*
Ga0103708_10008164913300009028Ocean WaterAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ*
Ga0103708_10009284113300009028Ocean WaterVATSLGGLMTNKLVDVDGDWKFAKRKLTGEYVNTGIHYQAWKAIKEAGVYSSYDWTVKADADAVFFPNKLVEHLRGMPVPAEGVYLENCPFVEYGYFGNLEVFSKNAFGTLLSQMEDCYAGLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103708_10012957013300009028Ocean WaterVKVDADAVFLPVRLRAKLATQKVTENGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103708_10017904913300009028Ocean WaterYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSREAFSTLTKNIDVCKKTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103708_10026520813300009028Ocean WaterFHWAKRKVSGSWVNTGIFTQVWKKITKHNSADWVAKVDADAVFIPNRLRGWLQSQRVPDEGIYLENCKYVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQHNNKKWKPNCAETSTAAMHPFKKK
Ga0103708_10028027313300009028Ocean WaterLSVLNSATVPAEGLYMENCKFVDYGYFGNLEVYSQAAFWALLQNIDMCKATLNWKVGVKNGMYGPMGEDLFAQTCLDKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCSKASTAAMHPFKKKEEWISCHWATVDKFGK*
Ga0103743_100171733300009195Ice Edge, Mcmurdo Sound, AntarcticaMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA*
Ga0103743_100478913300009195Ice Edge, Mcmurdo Sound, AntarcticaMDPILQDAEKVGQKMYCFSVYTKNTGSTKQSHELEILQHQYLQQLGIFQCEESDVFSDVSVEVGGGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNKLVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTAAFGA*
Ga0103830_100586513300009214River WaterVNTGMFTQVWKAIASGGKASSADWVVKVDADAVFIPSRLRNKLGAQLVPPSGIYLENCKYVEYGYFGNLEVFSQAAWSMLVDKIDDCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATVNAFGS*
Ga0103830_100875013300009214River WaterPVDDVEGDFHFAKRKVSGSWVNTGLFSQVWKKITKHVYTDWTVKVDADAVFIPNRLRSWLGGQLVPYNGIYLENCKFVDYGYFGNLEVLSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATIDAFGDR*
Ga0103830_101264713300009214River WaterIGGKYQSADWVVKVDADAVFVPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNNAFVTLLQKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETTGAFGS*
Ga0103842_101226313300009216River WaterGQLVPYNGIYLENCKFVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATIDAFGDR*
Ga0103842_101548413300009216River WaterDAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS*
Ga0103874_103606313300009268Surface Ocean WaterDFHFAKRKETGAWVNTGMFTQVWRAIAIGGKYQSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTA
Ga0103876_101542923300009269Surface Ocean WaterDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS*
Ga0103876_101831413300009269Surface Ocean WaterAWVNTGMFAQVWKAIASGGKYLSADWVAKVDADAVFVPSRLATKLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFGTLIDKIDDCKADTEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPMDQQKNKKWTPNCASTATPAMHPFKKVADWIACHDATMAAFGN*
Ga0103876_102060813300009269Surface Ocean WaterGMFTQVWKAIASGSKYQSADWVVKVDADAVFVPSRLATKLVSQLVPPSGIYLENCKYVEYGYFGNLEVFSQAAFNTLVDKIDDCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCALTATPAMHPFKKVADWIQCHDATVNAFGS*
Ga0103876_102183913300009269Surface Ocean WaterTVVADVEGDWYFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103876_104484813300009269Surface Ocean WaterYVEYGYFGNLEVFSSAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS*
Ga0103877_100260413300009272Surface Ocean WaterAIASGGKTSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS*
Ga0103877_100425013300009272Surface Ocean WaterVFADVTAQVGDGLMTIPVDDVEGDFHFAKRKVSGSWVNTGLFSQVWKKITKHVYTDWTVKVDADAVFIPNRLRSWLGGQLVPYNGIYLENCKFVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATIDAFGDR*
Ga0103877_100852613300009272Surface Ocean WaterAIAIGGKYQSADWVVKVDADAVFVPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNNAFVTLLQKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWVKCHDETTGAFGS*
Ga0103877_100995513300009272Surface Ocean WaterEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDSMCKAFRPKGEKTNAKWRPNCALTSTAAMHPFMKPFDYFDC
Ga0103877_101781613300009272Surface Ocean WaterGAWVNAGMFAQVWKAIASGGKYQSADWVAKVDADAVFVPSRLAKKLESQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFGTLIDKIDDCKADTEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIAC
Ga0103877_102101913300009272Surface Ocean WaterGLSTIMVTDAENDFHFAKRKETGAWVNTGLFTQVWKAIASGGKYQSADWVAKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVHRIEAFDITPDGACPADRPIDQQK
Ga0103878_100826413300009274Surface Ocean WaterLNTGMSTRVWKAIASGGKTSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS*
Ga0103878_101669013300009274Surface Ocean WaterVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS*
Ga0103879_1000612613300009276Surface Ocean WaterSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0103879_1000803113300009276Surface Ocean WaterSAEWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS*
Ga0103880_1000347213300009279Surface Ocean WaterTAQVGDGLMTIPVDDVEGDFHFAKRKVSGSWVNTGLFSQVWKKITKHVYTDWTVKVDADAVFIPNRLRSWLGGQLVPYNGIYLENCKFVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATIDAFGDR*
Ga0103880_1002341113300009279Surface Ocean WaterVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS*
Ga0103880_1002532213300009279Surface Ocean WaterADWVVKVDADAVFVPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNNAFVTLLQKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTHGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWVKCHDETTGAFGS*
Ga0103880_1003310413300009279Surface Ocean WaterADWVAKVDADAVFVPSRLAKKLESQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFGTLIDKIDDCKADTEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIACHDATIAAFGS*
Ga0103880_1006247913300009279Surface Ocean WaterNKLGAQLVPPSGIYLENCKYVEYGYFGNLEVFSQAAWSTLVDKIDDCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDISTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIKCHDETTGAFGS*
Ga0103880_1009014413300009279Surface Ocean WaterNDFHFAKRKETGAWVNTGLFTQVWKAIASGGKYQSADWVAKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKH
Ga0103841_100181113300009334River WaterGKTSSADWVVKVDADAVFIPSRLRIKLGAQLVPQSGIYLENCKYVEYGYFGNLEVFSQAAWSTLVDKIDDCKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS*
Ga0103827_100415813300009357River WaterRKVSGSWVNTGLFSQVWKKITKHVYTDWTAKVDADAVFIPNRLRSWLGGQLVPHDGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATIDAFGDR*
Ga0103742_102080713300009402Ice Edge, Mcmurdo Sound, AntarcticaLKDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGNKYQNADWVMKLDADAIFVPNRMRIWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA*
Ga0115099_1023862613300009543MarineGDFHLAKRKISGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWDATVAAFGQ*
Ga0115101_100075413300009592MarineFVANRMKVWLKQNELVPPAGIYLENCRYVEYGYFGNLEVFSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA*
Ga0115103_142742813300009599MarineLEILQHQYSQQLGIFQCEESDVFSDVSVEVGGGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMKVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTTINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKK*
Ga0115103_145312013300009599MarineFSDASVQVGTGLMTTVVTDVEGDWHFAKRKMSGTWVNTGMFTQIWKKIAEGNKYQNADWVMKLDADAIFVPNRMRVWLKQNELVPPAGLYLENCKYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA*
Ga0115102_1029084713300009606MarineMDPILQDAVPVGQKMYCFSVFTQDTGSTKQSHELDILKHQHSNHLGIFQCDYSDVFSDASVQVGTGLMTTVVTDVEGDWHFAKRKMSGTWVNTGMFTQIWKKIAEGNKYQNADWVMKLDADAIFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFATLIENIDSCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEQKNKKWKPNCAWAATPAMHPFKKTEEWIQCYEATTAAFGA*
Ga0115102_1071082313300009606MarineYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0115102_1082006413300009606MarineMYCFAVYTENTGSTKQSHELEILQHQYSQQLGIFQCAESDVFSDVSAEVGSGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNELVPTAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPDCASTATPAMHPFKK
Ga0138316_1026253413300010981MarineKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ*
Ga0138316_1047634323300010981MarineWVVKVDADAVFVPSRLSNKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFTTLVDKIDVCKADSHINWKVGVKNGKYGPMGEDLFAQACLDKFEVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS*
Ga0138316_1060945313300010981MarineIAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVTAFGK*
Ga0138316_1164053313300010981MarineSSSADWVVKVDADAVFVPSRLSNKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSRAAFDTLTEKIDDCKADSKINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS*
Ga0138326_1002703113300010985MarineWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPETGIYLENCKFVKYGYFGNLEVFSKAAFNTLLANMDACKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKNVRRVEAFDITTDGACPADRPKDQKNNKKWKPNCAWVSTPAMHPFKKLDEWVQCHEATVAAFGK*
Ga0138326_1002820613300010985MarineRKTSGAWVNTGMFTKIWKAIEASGKFRSADWIAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK*
Ga0138326_1035892923300010985MarineSSSADWVVKVDADAVFVPSRLSNKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFTTLVDKIDVCKADSHINWKVGVKNGKYGPMGEDLFAQACLDKFEVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS*
Ga0138324_1024965013300010987MarineGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSAKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS*
Ga0138324_1024966013300010987MarineGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS*
Ga0138324_1024966113300010987MarineGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS*
Ga0138324_1028428813300010987MarineTIKVVDTDNDFHFAKRKETGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSNKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFTTLVDKIDVCKADSHINWKVGVKNGKYGPMGEDLFAQACLDKFEVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS*
Ga0138324_1037682913300010987MarineTIKVVDTDNDFHFAKRKETGAWVNTGMFAQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSNKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSRAAFDTLTEKIDDCKADSKINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS*
Ga0138324_1044649513300010987MarineSWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK*
Ga0129328_108400313300012472AqueousGMFTQVWKAVAQNGKFWKAAWTAKVDADAVFVPSRLRTWFRKQRVPDAGIYLENCKFVDYGYFGNLEVYSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHSERKNKKWKPNCAKASTAAMHPFKKLDEWISCHWATVDAFGK*
Ga0192960_10169423300018515MarineCTQPQGIMDPILQDAQPVGQSMYCFSVYTKDTGSTKQSHELEILQHQHQQQLGIFQCEYSDVFSDVSVSVGQGLMTKVVTDQEGDWHFAKRKVSGTWVNTGMFSQIWKQISADGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA
Ga0192960_10260113300018515MarineDVFSDVSVEVGNGQMTTVVTDVEGDWHFAKRKVSGTWVNTGIFTQIWKKIAEGGKYQSADWVLKLDADAIFVPNRMRVWLKQHALVPPAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192960_10302613300018515MarineAIASGGKASSADWVVKVDADAVFVPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSQAAWSTLIDKIDDCKADSQINWKVGIHDGKYGPMGEDLFAQACLDKFAVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVADWRECHDATMAAFGS
Ga0192960_10608513300018515MarineNKYQNADWVMKLDADAIFVPNRMRVWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0193100_10147513300018526MarineWKAIASGGKTSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVRDWAACHDATMDAFGLTLA
Ga0193486_10475013300018534MarineMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193486_10475213300018534MarineMTTVVTDVEGDWHFAKRKVPGTWVNTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193486_10509913300018534MarineMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSRQAFSTLIQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193014_10300013300018546MarineMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193296_10257013300018555MarineINTGMFTKIWKAVEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANMDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDITTDGACPADRPADQKKNKKWKPNCAYVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193296_10276513300018555MarineFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193296_10281313300018555MarineTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQKVDWVMKVDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193296_10546213300018555MarineADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192942_10410413300018556MarineVEGDFHFAKRKVSGSWVNTGLFSQVWKKITKHVYTDWTVKVDADAVFIPNRLRSWLGGQLVPYNGIYLENCKFVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATIDAFGDR
Ga0193510_100599313300018580MarineKETGAWVNTGMFTQVWKAIASGGKTSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193221_100367613300018585MarineRKVSGTWVNTGIFSQVWRKIGQSGKVENVNWVAKVDADAVFIPNRLRQKLGAQMVPTRGIYLENCKFVDYGYFGNLEVYSTAAFKTLLENLDMCKATLNWKVGIKNGKYGPMGEDLFAQTCLDKVGTRRVEAFDITVDGACPADRPEAQKTNKKWKPDCQYASTPAMHPFKKLEEWVQCYDATVAAFGS
Ga0193141_100372513300018588MarineDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193141_100460013300018588MarineDQILQDAVPVGQTMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193113_101108813300018592MarineEVEVGPGLSTIRVVDAENDFHFAKRKSSGAWVNTGMFTQVWRAIAIGGKYQSADWVVKVDADAVFVPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNNAFVTLIQKIDNCKADTQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWVKCHDETTGAFGS
Ga0193113_101177513300018592MarineGEGDFHFAKRKNSGAWVNTGMFKQVWKAIGSGDKYKTASWVVKVDVDAVFLPSRLTKKLESQMVPATGIYLENCKFVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0193113_101694013300018592MarineGMMTIAVQDTEGDFHVAKRKTTGAWINTGMFTKIWKAVEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANMDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDITTDGACPADRPADQKKNKKWKPNCAYVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193113_102394913300018592MarineFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEAFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192851_100268813300018600MarineGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192851_100580813300018600MarineIQVNDVEGDFHLAKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0192851_100971213300018600MarineVQDTDGDFHFAKRKISGSWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192851_100982113300018600MarineMGEASGKFRSADWIAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSRAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192851_101042913300018600MarineLENCKYVDYGYFGNLEVFSKAAFVTLVANIDQCKASSEINWKVGVKNGKYGPMGEDLFAQTCLDLKGVRRIEAFDITTDGACPADRPQDQQKNKKWKPNCAWTATAAMHPFKKTDEWLKCYDATIAAFPEQ
Ga0192851_101090313300018600MarineADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192851_101383713300018600MarineRLTKKLQNQLVPANGIYLENCKFVDYGYFGNLEVFSRAAFATLLQNIDSCKATLNWKVGIKDGKFGPMGEDLFAQTCLDKLGVRRIEAFDITTDGACPADRPADQSKNKKWKPTCSWVSTAAMHPFKKTQEWVECYEQTTAAFGF
Ga0192851_101408813300018600MarineDADAVFVPSRLRQKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSSAAFNKLVEKIDTCKADSQINWKVGVKNGKYGPMGEDLFAQVCLDKYGSHRVEAFDITTDGACPADRPIGQQKNKKWKPTCEWTATAAMHPFKKVADWIKCHDATTAAFGS
Ga0192851_101837123300018600MarineAFSTLVQHIDSCKQSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193415_100932413300018608MarineRTIQVNDVEGDFHLAKRKVSGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCGETSTAAMHPFKKKDEWFQCWEETVAAFGH
Ga0193415_101474913300018608MarineCKFVDYGYFGNLEVFSQVAFKTLIANIDMCKASTEINWKVGIKNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQHDNKKWKPNCAETSTAAMHPFKIKDEWFQCWEATTAAFGK
Ga0193415_101777713300018608MarineSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193316_100921713300018611MarineGPGLRTIKVDDVEGDFHWAKRKDTGGWVNTGMFTQVWKKTFKHQYVSWVAKVDADAVFIPNRLRTWLSRQLVPDNGIYLENCKFVEYGYFGNLEVFSKAAFTTLLANIDQCKASTDINWKIGVHDGKYGPMGEDLFAQSCLDTKGVRRVEAFDITTDGACPADRPQDQKKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193316_101264313300018611MarineADWVAKVDADAVFIPNRLRTWLSRQLVPYNGIYLENCKFVEYGYFGNLEVFSKAAFVTLLANIDQCKASPEINWKLGVHEGKFGPMGEDLFAQTCLDTKGVRRVEAFDITTDGACPADRPQDQKKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0192957_103385713300018615MarineMTKVVTDQEGDWHIAKRKVSGTWVNTGMFSQIWKQISADGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA
Ga0193064_100822913300018616MarineFACEQQDVFADVEVAVGPSLNTIKVVDTDNDFHFAKRKTTGTWVNTGLFTQVWKAIANGGKYHSAGWVAKVDADAVFVPSRLAKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDKWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVSAFGS
Ga0193064_101128313300018616MarineVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193064_101770013300018616MarineMGLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193064_101851313300018616MarineFACEQQDVFADVEVAVGPSLNTIKVVDTDNDFHFAKRKTTGTWVNTGLFTQVWKAIANGGKYHSAGWVAKVDADAVFVPSRLAKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDKWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKK
Ga0193355_100812213300018628MarineIMVTDVEGDFHFAKRKNSGAWVNTGMFKQVWKAIGSGDKYKTASWVVKVDVDAVFLPSRLTKKLESQMVPANGIYLENCKYVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0193355_101044813300018628MarineQVWKAIASGSKWQSVDWVVKVDADAVFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0193376_100941413300018635MarineTGAWVNTGMFTQVWKAIASGGKTSSADWVVKVDADAVFIPSRLSEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEHKNKKWKPTCAWTATSAMHPFKKVRDWAACHDATMDAFGLTLA
Ga0193376_101099823300018635MarineKVDADAVFVPSRLANKLQHQLVPATGIYLENCKFVDYGYFGNLEVYSRVAFSTLLENIDACKASKEINWKVGIKNGKYGPMGEDLFAQACLDNLGVRRVEAFDITTDGACPADRPADQRKNKKWKPDCTVTSTAAMHPFKKKTEWVKCYEETIAAYA
Ga0193376_101643313300018635MarineIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193376_102604713300018635MarineSGSKASSADWVVKVDADAVFVPSRLRQKLGAQMVPPSGVYLENCKYVEYGYFGNLEVFSQAAWSTLVAKIDVCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0193377_100803713300018636MarineWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATVAAFGS
Ga0193377_101069723300018636MarineADAVFVPSRLANKLQHQLVPATGIYLENCKFVDYGYFGNLEVYSRVAFSTLLENIDACKASKEINWKVGIKNGKYGPMGEDLFAQACLDNLGVRRVEAFDITTDGACPADRPADQRKNKKWKPDCTVTSTAAMHPFKKKTEWVKCYEETIAAYA
Ga0193377_101510213300018636MarineITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCGETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0192914_100598713300018637MarineQDFHFAKRLETGAWVNTGMFSQVWKSIASGGKYQSADWVAKVDADAVFVPSRLSKLLQSQLVPPSGVYLENCKYVDYGYFGNLEVFSKAAFVTLTEKIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKWGVRRVEAFDITTDGACPADRPVDQQKNKKWTPTCAATATPAMHPFKKVADWIKCHDATVAAFGS
Ga0193431_100931423300018643MarineKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193431_101208013300018643MarineWGPGLRTIRVDDVEGDFHLAKRKISGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCGETSTAAMHPFKKKDEWFQCWEETVAAFGH
Ga0193431_101226513300018643MarineIFQCDYSDVFSDVSVEVGSGLMTKVVTDVEGDWHFAKRKTSGTWVNTGIFTQIWKKIGAEGTYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSRQAFSTLLQNIDTCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193431_102280613300018643MarineTWGLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0193431_102614113300018643MarineHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDSCKASSEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193431_103003213300018643MarineNWVAKVDGDAVFIPTRLRSWLSKQRVPAPGIYLENCKFVDYGYFGNLEVFSTAAFRTLLQNINTCKSSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPEDQKTNKKWKPECSYVSTPAMHPFKKLNEWISCYEATGKAFGY
Ga0193445_102036913300018648MarineGLFSQVWKAIASGSKWQSADWVVKVDADAVFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFG
Ga0193445_102203813300018648MarineGVFQCEQSDVFSDVDVEVGPGLRTIQVNDVEGDFHLAKRKISGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDSCKASKEINWKVGIKNGKYGPMGEDLFAQTCLDMRGVRRVEAFDITTDGACPADRPQDQQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193445_102245413300018648MarineFHFAKRKETGAWVNTGMFAQVWKAIASGGKYQSADWVAKVDADAVFVPSRLATKLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFDTLIDKIDDCKADSEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIACHDATVAAFGS
Ga0193445_102383513300018648MarineHFAKRKETGAWVNTGLFTQVWKAIASGGKYQSADWVAKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193445_105428913300018648MarineDYGYFGNLEVFSSAAFSTLVDKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0192969_105002513300018649MarineFSVFTQDTGSTKQSHELDILKHQHSNHLGIFQCDYSDVFSDVSVQVGTGLMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEGNKYQNVDWVMKLDADAIFVPNRMRIWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVG
Ga0192937_102805523300018651MarineDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192993_103201213300018652MarineSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193504_101699913300018653MarineGKTSSADWVVKVDADAVFIPSRLSEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVRDWAACHDATMDAFGLTLA
Ga0193504_102194313300018653MarineIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTSAFGA
Ga0192889_102063413300018657MarineKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192889_103854113300018657MarineGIYLENCKYVDYGYFGNLEVFSRQAFSTLISNIDTCKQTTNWKLGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPGDRPEAEKKNKKWKPDCASAATPAMHPFKKLGEWQACYDATQQAFGS
Ga0192889_104141413300018657MarineGIYLENCKYVEYGYFGNLEVFSKAAWNTLIEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0192889_105133313300018657MarineDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASVATPAMHPFKKTQEWIQCY
Ga0192889_106093513300018657MarineAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDQQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193067_102803013300018659MarineYSAVFSDVSVEVGDGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193067_105363713300018659MarineKASSADWVVKVDADAVFVPSRLRQKLGAQMVPPSGVYLENCKYVEYGYFGNLEVFSQAAWSTLVAKIDVCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0193067_105700613300018659MarineVKVDADAVFVPSRLRQKLGAQMVPPSGVYLENCKYVEYGYFGNLEVFSQAAWSKLVAMIDVCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0193067_106257913300018659MarineQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDACNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0193067_106331113300018659MarineDAVFVPSRLVRWLQGQRVPSNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGIEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192848_101542113300018662MarineDNDFHFAKRKTTGTWVNTGLFTQVWKAVASEGKYHSAGWVAKVDADAVFVPSRLSKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKTDSQINWKVGVKNGKYGPMGEDLFAQTCLDRWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVSAFGS
Ga0192848_101621213300018662MarineSDVEADLGPGAKTIVVQDTDGDFHFAKRKISGSWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192848_101858413300018662MarineVGPGMMTIAVQDTEGDFHVAKRKTTGAWINTGMFTKIWKAVEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANMDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDITTDGACPADRPADQKKNKKWKPNCAYVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192848_101888323300018662MarineKVDVDAVFLPSRLTKKLQSQMVPSSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKTSTAAMHPFKKEAEWFECFEATTAAFGY
Ga0192848_101972913300018662MarineTKITKHVYTDWTAKVDGDAVFIPNRLRSWLGGQLVPSAGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0192848_102224013300018662MarineTKITKHVYTDWTAKVDGDAVFIPNRLRSWLGGQLVPSAGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKEEWFQCWQATIDAFGDR
Ga0192848_102330613300018662MarineATKLQSQLVPLRGIYLENCKFVDYGYFGNLEVFSRAAFDTLIDKIDDCKADSEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPICASTATPAMHPFKKVADWIACHDATVAAFGS
Ga0192848_103052213300018662MarineMVPSSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPDCSKASTAAMHPFKKEAEWFKCFEATTAAFGY
Ga0192848_104081213300018662MarineGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVA
Ga0193013_104193913300018668MarineVNTGLFTQVWKKITKHVYTDWTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0193384_101445213300018675MarineGDFHFAKRKNSGAWVNTGMFKQVWKAIGSGDKYKTASWVVKVDVDAVFLPSRLTKKLESQMVPANGIYLENCKYVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0192952_100203823300018683MarineMDPILQDAVPVGQKMYCFAVYTENTGSTKQSHELEILQHQYSEKLGIFQCEESDVFSDVGVEYGSGVMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQACLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTSAFGA
Ga0192952_100545813300018683MarineYTKDTGSTKTSHELDILKHQHVQHLGIFQCDYSDVFSDVSVEVGSGYMTTVVTDVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQSADWVMKLDADAIFVPNRMRVWLKQNELVPPAGIYLENCKHVDYGYFGNLEVFSREAFSTLIKNIDTCKQTLDWKVGVKDGKYGPMGEDLFAQSCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYEATTAAFGA
Ga0192952_101063913300018683MarineADWIAKVDADAVFVPSRLSKKLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS
Ga0192952_102336313300018683MarineFVPSRMKVWLKQNELVPPAGVYLENCKYVDYGYFGNFEVYSREAFTTLIRNIDTCKQTLNWKVGVENGKWGPMGEDLFAQKCLDSVGVRRKEALDITTDGACPGDRPVAEKNNKKWKPNCASAATPAMHPFKKTDEWIKCYDATTAAFGA
Ga0192983_104745013300018684MarineKVDADAVFVPSRLRTWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKNGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCAKASTAAMHPFKKKEEWISCHSATVDAFGK
Ga0192840_103238113300018686MarineSGSWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193294_101070123300018691MarineMDPILQDAVPVGQKMYCFSLYTKDTGSSKPSHELEILQHQYSQHLGIFQCDYSDVFSDVSVEVGSGLMTKVVTDVEGDWHFAKRKTSGTWINTGIFTQIWKRIAAEGQYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSRQAFSTLLQNIDMCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193294_101344613300018691MarineYSKGLSVFACDEQDVFADVDVEVGQGLRTIKVIDTENDFHFAKRKETGAWVNTGLFSQVWKAIASGSKWQSADWVVKVDADAVFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0193294_102102713300018691MarineAQVWKAIASGGKYQSADWVAKVDADAVFVPSRLATKLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFDTLIDKIDDCKADSEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIACHDATVAAFGS
Ga0193294_102279813300018691MarineAKTIVVQDTDGDFHFAKRKISGSWVNTGMFTKIWRAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193294_102324513300018691MarineASSADWVVKVDADAVFVPSRLRQKLGAQMVPPSGVYLENCKYVEYGYFGNLEVFSQAAWSKLVAMIDVCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATAAMHPFKKVADWIQCHDATVNAFGS
Ga0193294_102641413300018691MarineFSKKISIFACQEYDVFGDVEVEVGAGLKTTMVTDVDGDFHFAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPDCSKASTAAMHPFKKEAEWF
Ga0193294_103108513300018691MarineIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGVRRKEAFDITTDGACPSDRPKDEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193294_103380513300018691MarineRIAADGKYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSREAFSTLTKNIDVCKKTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193294_104370113300018691MarineIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193294_104386713300018691MarineGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFG
Ga0192944_103606323300018692MarineVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQACLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTSAFGA
Ga0192944_105020413300018692MarineVWLKQHALVPPAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193259_103804313300018695MarineARCLKNCTPSAHQSCTQPQGIMDPILQDAQPVGQKMYCFSVYTKDTGSTKQSHELEILQHQKQQQLGIFQCDYSDVFSDVSVEIGQGMMTKVVTDTEGDWHFAKRKVSGTWVNTGMFSQIWKQISADGNYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKATLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWKQCYEATTAAFGA
Ga0193110_101245413300018696MarineQTIKVVDAENDWHFAKRKETGAWVNTGMFTQVWKAIASGGKTSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEHKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS
Ga0193110_103624013300018696MarineKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193236_101964313300018698MarineFHFAKRKETGAWVNTGMFSQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193236_102282613300018698MarineFHFAKRKETGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHADTVNAFGS
Ga0193236_102680813300018698MarineDWVVKVDADAVFVPSRLRNKLGAQLVPPSGIYLENCKYVEYGYFGNLEVFSQAAWSTLVDKIDDCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATVNAFGS
Ga0193236_102714213300018698MarineKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDMTTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0193236_102812713300018698MarineNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA
Ga0193236_103352713300018698MarineKYVDYGYFGNLEVFSQAAFATLVEKIDVCKADSQIDWKVGIKNGKYGPMGEDLFAQTCLDSWDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVSAFGS
Ga0193236_103712713300018698MarineVSGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPSRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDSCKASQEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193236_103888513300018698MarineMGKRKTTGTWVNTGMFTQVWKAVASGGKYHSAGWVAKVDADAVFVPSRLSKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAATATPAMHPFKKVADWIKCHDDTVSAFGS
Ga0193236_105490313300018698MarineMGKRKTTGTWVNTGMFTQVWKAVASGGKYHSAGWVAKVDADAVFVPSRLSKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDRWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFK
Ga0193195_100758423300018699MarineVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVRDWAACHDATMDAFGLTLA
Ga0193195_102084313300018699MarineKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193195_102331613300018699MarineHGRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0193195_104742313300018699MarineMVPPSGVYLENCKYVEYGYFGNLEVFSQAAWSTLVAKIDVCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKLGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0193405_104362113300018701MarineGDFHLAKRKISGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCGETSTAAM
Ga0192954_101244313300018704MarineGIFQCEESDVFSDVGVEYGSGVMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQACLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTSAFGA
Ga0192954_102995513300018704MarineMGMFTQIWKKIAEGNKYQNADWVMKLDADAIFVPNRMRVWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFG
Ga0192954_104864813300018704MarinePAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193539_105793413300018706MarineADVEVEVGPGLRTIQVVDVDNDFHFAKRKQTGAWVNTGMFSQVWKAIASGSKYQSSDWVVKVDADAVFVPSRLSTKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSSAAFATLTDKIDDCKADSQINWRVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWI
Ga0193539_105864413300018706MarineNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193539_106284713300018706MarineNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193539_107348113300018706MarineGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192876_103227113300018707MarineFQCEESDVFSDVAVEYGSGVMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKSSINWKLGVQNGKWGPMGEDLFAQACLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTSAFGA
Ga0192920_104329913300018708MarineSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192920_106467613300018708MarineNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193209_105646813300018709MarineNCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193209_105647013300018709MarineNCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193209_105759013300018709MarineSADWVLKVDADAVFVPNRLRAKLGAQMVPPTGVYLENCKYVEYGYFGNLEIFSQAAWSTLVANIDVCKADSQINWKVGVHDGKYGPMGEDLFAQTCLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHADTVNAFGS
Ga0193209_106400413300018709MarineNCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193069_101017713300018711MarineEQWDVFADVEVAVGPGLNTIKIEDAEQDFHFAKRLETGAWVNTGMFSQVWKSIASGGKYQSADWVAKVDADAVFVPSRLSKLLQSQLVPPSGVYLENCKYVDYGYFGNLEVFSKAAFVTLTEKIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKWGVRRVEAFDITTDGACPADRPVDQQKNKKWTPTCAATATPAMHPFKKVADWIKCHDATVAAFGS
Ga0193069_102269013300018711MarineLFTQVWKKITKHVYTDWTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDMCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPLDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0193069_102283013300018711MarineKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193069_102554513300018711MarineSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKVDSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDITTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0193069_103796213300018711MarineHGGIYLENCKYVDFGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193069_103796713300018711MarineHGDVFSDVDVEVGPGLRTIQVNDVEGDFHLAKRKISGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFVPSRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDSCKASSEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAW
Ga0192887_101578913300018713MarineGDVEVEVGEGLKTIMVTDVDGDFHFAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDSCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0193385_101619223300018718MarineDVEVEVGPGLKTIMVKDVESDFHFAKRKSTGAWVNTGMFTQVWKAIAKGGKFKSAAWVAKVDADAVFVPSRLANKLQHQLVPATGIYLENCKFVDYGYFGNLEVYSRVAFSTLLENIDACKASKEINWKVGIKNGKYGPMGEDLFAQACLDNLGVRRVEAFDITTDGACPADRPADQRKNKKWKPDCTVTSTAAMHPFKKKTEWVKCYEETIAAYA
Ga0193385_103774613300018718MarineFTQVWKAIASGGKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDITTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0193385_104389313300018718MarineDWTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0192866_103428513300018720MarineVSGSWVNTGMFTQVWKKITKHNSADWVAKVDGDAVFIPNRLRGWLQSQMVPDEGIYLENCKYVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQKCLGMLGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATTAAFGK
Ga0192866_105990113300018720MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKW
Ga0192866_105990213300018720MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKW
Ga0192866_106537413300018720MarineYFGNLEVFSHAAFVTLVDKIDDCKADAQINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0193038_107912513300018723MarineWRKLVDKIDECKAQINWKVGVHGGKYGPMGEDLFAQACLDKFGVRRFEAFDITTDGACPADRPLDQQKNKKWKPTCAWTATPAMHPFKKVAEWIQCHDATVAAFGS
Ga0192967_101307923300018730MarineHANNLGMFTCDQYDVFSDVHVEVGPGLSTIQVHDVEGDWHFAKRKVSGAWVNTGMFTQVWKAVAQDGKFWKAAWTAKVDADAVFVPSRLRSWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKNGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCAKASTAAMHPFKKKEEWISCHEATVDAFGK
Ga0193529_104509113300018731MarineDVEVEVGPGLQTIKVVDADNDFHFAKRKETGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193529_106784813300018731MarineIFQCDESDVFSDVSEDVGSGMMTTVVSDVEGDFHFAKRKSTGAWVNTGMFIQVWRKIAEGGKYQNADWVLKLDADAVFVPNRMRVWLKQNNLVPPSGIYLENCKYVDYGYFGNLEVFSRQAFSTLISNIDTCKQTTNWKLGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPGDRPEAEKKNKKWKPDCASAATPAMHPFKK
Ga0193529_107038923300018731MarineGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193529_107205313300018731MarineRFRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDTTTDGACPADRPHDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193529_107928213300018731MarineQHALVPPAGIYLENCKHVDYGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGIKNGKHGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193529_108092413300018731MarineYVQYGYFGNLEVFSSAAFATLTDKIDDCKADSQINWRVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0193290_102702213300018734MarineSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVRDWAACHDATMDAFGLTLA
Ga0193290_102710213300018734MarineSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVNDWAACHEATMGAFGLTLS
Ga0193290_102776113300018734MarineSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193290_103529713300018734MarineIFTQIWKKIGAEGTYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSRQAFSTLLQNIDTCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193290_103673413300018734MarineWTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0193495_105604413300018738MarineIQNGGKYEQANWVAKVDADAVFIPTRLRSWLSKQMVPAPGIYLENCKFVDYGYFGNLEVFSTAAFRTLLQNINTCKSSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPEDQKTNKKWKPECSYASTPAMHPFKKLNEWISCYEATGNAFGF
Ga0193387_103334313300018740MarineSSADWVAKVDADAVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193387_103694313300018740MarineAVFSDVSVEVGGGVMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193387_104845213300018740MarinePEEGIYLENCKFVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193387_105238913300018740MarineKAVEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANMDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDITTDGACPADRPADQKKNKKWKPNCAYVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193387_106079713300018740MarineTTKVTDVEGDFHFAKRKVTGTWVNTGLFTQVWRSIQNGGKYEQANWVAKVDGDAVFIPTRLRSWLSKQRVPAPGIYLENCKFVDYGYFGNLEVFSTAAFRTLLQNINTCKSSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPEDQKTNKKWKPDCSYVS
Ga0193534_103332213300018741MarineGMFTQVWKAIASGGKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDMTTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFG
Ga0193534_103369413300018741MarineDVEVGPGLRTIQVNDVEGDFHLAKRKISGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGAQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDQQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193534_104026613300018741MarinePSRLTKKLESQMVPATGIYLENCKFVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEVEWIKCFEATTAAFGS
Ga0193534_105418913300018741MarineDAVFVPSRLTKKLQNQLVPANGIYLENCKFVDYGYFGNLEVFSRAAFATLLQNIDSCKATLNWKVGIKDGKFGPMGEDLFAQTCLDKLGVRRIEAFDITTDGACPADRPADQSKNKKWKPTCSWVSTAAMHPFKKTQEWVECYEQTTAAFGF
Ga0193425_102781613300018743MarineVSGSWVNTGLFTQVWKKITKHVYTDWTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0193425_103239913300018743MarineQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATVAAFGS
Ga0193425_103442913300018743MarineVPANGIYLENCKYVNYGYFGNLEVFSQAAFTTLLANIDSCNFSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0193425_103548013300018743MarineQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVRDWAACHDATMDAFGLTLA
Ga0193425_104334413300018743MarineDYGYFGNLEVFSKAAFVTLTEKIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKWGVRRVEAFDITTDGACPADRPVDQQKNKKWTPTCAATATPAMHPFKKVADWIKCHDATVAAFGS
Ga0193425_105705913300018743MarineGIYLENCKFVDYGYFGNLEVFSRAAFITLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDITTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDAATVAAFGS
Ga0193147_103110523300018747MarineHFAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0193147_103657613300018747MarineGSGDKYKTASWVVKVDVDAVFLPSRLTKKLESQMVPATGIYLENCKFVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0192902_105240213300018752MarineSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192902_106806813300018752MarineNIGVFACEQAEVFSDVEVEVGPGMMTIAVQDTEGDFHIAKRKTSGAWINTGMFTKIWKAVEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFK
Ga0193058_104483413300018758MarineLSKKLQAQLVPRSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATVAAFGS
Ga0193058_105653613300018758MarineSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0192963_103328913300018762MarineDVEGDFHFAKRKTSGAWVNTGMFSQVWKKINKHVYTDWVAKVDADAVFIPNRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFVALLANIDMCKASTEINWKVGIKNGKYGPMGEDLFAQTCLDLKGVRRVEAFDITTDGACPADRPQEEQKNKKWKPNCGETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0192963_104539123300018762MarineADWVMKLDADAIFVPNRMRIWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTAAFGA
Ga0192924_101650613300018764MarineTGLFTQVWKAVASSGKYHSAGWVAKVDADAVFVPSRLSKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDRWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVSAFGS
Ga0192924_101725513300018764MarineTTAQVGDGLMTIQVDDVEGDFHWAKRKVSGSWVNTGLFTQVWKKITKHVYTDWTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0192924_102356313300018764MarineADAVFVPSRLANKLQHQLVPATGIYLENCKFVDYGYFGNLEVYSRVAFSTLLENIDACKASKEINWKVGIKNGKYGPMGEDLFAQTCLDNLGVRRVEAFDITTDGACPADRPADQQKNKKWKPDCTATSTAAMHPFKKKAEWVKCHEATIAAYAY
Ga0192924_102853413300018764MarineSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEHKNKKWKPTCAWTATSAMHPFKKLKDWAACHEATMDAFGLTLS
Ga0192924_103632113300018764MarineADAVFVPSRLANKLQHQLVPATGIYLENCKFVDYGYFGNLEVYSRVAFSTLLENIDACKASKEINWKVGIKNGKYGPMGEDLFAQTCLDNLGVRRVEAFDITTDGACPADRPADQQKNKKWKPDCTATSTAAMHPFKKKAEWVKCHEATIAAFWY
Ga0193031_102421613300018765MarineDVEVEVGPGLQTIKVVDAENDFHFAKRKETGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193212_103785213300018767MarineTGMFTQIWKKIAEAGEYQNADWVIKVDADAIFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFG
Ga0193478_104487513300018769MarineGTWVNTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSTQAFSTLLQNIDSCKQTLNWKVGVKDGKFGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193478_104774213300018769MarineTKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLIEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193478_106368713300018769MarineQSQMVPDEGIYLENCKYVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQKCLGMLGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193478_106643313300018769MarinePGLRTIQVSDVEGDFHLAKRKISGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASSEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKD
Ga0193530_105007513300018770MarineGMMTIAVQDTEGDFHIAKRKTSGAWINTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193530_105472513300018770MarineQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKHNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193530_108304713300018770MarineENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193314_105294713300018771MarineIFACQEHDVFADVEVDVGPGLRTIKVVDTDNDWHFAKRKETGAWVNTGMFTQVWKAIASGGKASSVDWVVKVDADAVFVPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSQAAWNTLIDKIDDCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKDKKWKPTCAWTATPAMHPFKKVADWMACHDATMAAFGS
Ga0193407_104942713300018776MarineGGKYEQANWVAKVDGDAVFIPTRLRSWLSKQRVPAPGIYLENCKFVDYGYFGNLEVFSTAAFRTLLQNINTCKSSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKDQKTNKKWKPECSYVSTPAMHPFKKLNEWISCYEATGKAFGY
Ga0192839_101953813300018777MarineTQPQGIMDPILQDAVPVGQKMYCFSLYTKDTGSSKPSYELEILQHQYSQHLGIFQCDYSDVFSDVSVEVGSGLMTKVVTDVEGDWHFAKRKTSGTWVNTGIFTQIWKKIGAEGTYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSRQAFSTLLQNIDTCKQTLNWKVGIKNGKYGPMGEDLFAQNCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192839_103317613300018777MarineMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192839_103428713300018777MarineMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEQKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192839_103439613300018777MarineMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPSDRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192839_107412013300018777MarineGIYLENCKYVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0193472_102284913300018780MarineASGGKYQSADWVAKVDADAVFVPSRLATKLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFDTLIDKIDDCKADSEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIACHDATVAAFGS
Ga0193472_102863713300018780MarineSSSADWVVKVDADAVFVLSRLSKKLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATVAAFGS
Ga0193472_103120013300018780MarineENCKYVEYGYFGNLEVFSRAAFDTLTEKIDDCKADSKINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0192832_101553313300018782MarineVQVEVGPGLQTIKVVDAENDWHFAKRKDTGAWVNTGMFTQVWKAIASGGKTSSADWVVKVDADAVFIPSRLSEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQSCLDKFDVRRVEAFDITTDGACPADRPIDEHKNKKWKPTCAWTATSAMHPFKKLKDWAACHEATMDAFGLTLS
Ga0192832_103176513300018782MarineMVPANGIYLENCKYVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKIGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0192832_105678713300018782MarineLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0193197_103199413300018783MarineRKVSGTWVNTGMFTQVWKKMTKHAYTDWTAKVDVDAVFIPNRLRSWLAGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKSSTEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRAEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKYDEWFQCWQATVDAFGQ
Ga0193197_103693513300018783MarineWKAIASGSKASSADWVVKVDADAVFVPSRLRQKLGAQMVPPSGVYLENCKYVEYGYFGNLEVFSQAAWSTLVAKIDVCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0193197_105392613300018783MarineGYFGNLEVYSAAAFQTLLNNIDGCKSQLNWKVGIKNGKYGPMGEDLFAQACLDRVGIRRAEAFDITTDGACPADRPEDQKKNKKWKPDCSQVSTAGMHPFKKLPEWIACFDATTTAFGG
Ga0193197_105596013300018783MarineTWEYGYFGNLEVFSQAAWSTLVAKIDVCKADSEINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQRKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0193197_106136613300018783MarineKMGEMGKYQSADWVMKVDADAIFVPSRMRTWLFANRLVPPAGIYLENCKYVDYGYFGNLEVYSKQAFTTLIQNIDVCKSSINWKLGVKNGKYGPMGEDLFAQTCLDSKGIRRKEAFDITTDGACPADRPEGEKKNKKWKPNCASTSTPAMHPFKKTQEWIECYQATTSSFGA
Ga0193197_106910213300018783MarineIYLENCKYVEYGYFGNLEVFSNNAFVTLIQKIDDCKADAQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWVKCHDETTGAFGS
Ga0192928_104993213300018793MarineADWVVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193357_102897213300018794MarineNDFHFAKRKTTGTWVNTGLFTQVWKAVASGGKYHSAGWVAKVDADAVFVPSRLAKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDRWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVGAFGS
Ga0193357_102897713300018794MarineNDFHFAKRKTTGTWVNTGLFTQVWKAVASSGKYHSAGWVAKVDADAVFVPSRLSKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDRWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVGAFGS
Ga0193357_102923613300018794MarineVEVEVGPGLRTIKVVDTEGDWHFAKRKETGAWVNTGMFTQVWKAIATGWKASSADWVLKVDADAVFVPNRLRAKLGAQMVPPTGVYLENCKYVEYGYFGNLEVFSQAAWSTLVANIDVCKADSQINWKVGVHHGKHGPMGEDLSAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0193357_104062913300018794MarineDNDFHFAKRKQTGAWVNTGMFTQVWKAIASGSKYQSADWVVKVDADAVFVPSRLSKKLASQLVPPRGIYLENCKYVEYGYFGNLEVFSNAAFKTLTEKIDICKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKAAEWASCHDATMGAFGS
Ga0193357_104367013300018794MarineDVEGDWHFAKRKVSGTWVNTGMFTQIWKKMGEMGKYQSADWVMKVDADAIFVPSRMRTWLFANRLVPPAGIYLENCKYVDYGYFGNLEVYSKQAFTTLIQNIDVCKSSINWKLGVKNGKYGPMGEDLFAQTCLDSKGIRRKEAFDITTDGACPADRPEGEKKNKKWKPNCASTSTPAMHPFKKTQEWIECYQATTNNFGA
Ga0193357_104946923300018794MarineWKKIGAEGTYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSRQAFSTLLQNIDMCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193357_105305113300018794MarineRIAADGKYRNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSREAFSTLTKNIDVCKKTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193357_106531013300018794MarineFSQVWKAVQASGKYQKADWVAKVDADAVFIPSRLVRWVQAQRVPDNGIYLENCKFVEYGYFGNLEVFSRVAFDTLLKNLDACKRAPEINWKVGVKNGKYGPMGEDLFAQTCLDLHGVRRVEAFDITTDGACPADRPLDQKTNKKWKPNCAWVSTPAMHPFKKTQEWLQCHEATVAAFGA
Ga0193357_106933813300018794MarineMGVNDVEGDFHLAKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGQQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFMTLLANIDFCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDLKGVRRVEAFDTTTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCW
Ga0193357_108251413300018794MarineGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTSAFGA
Ga0193357_108989013300018794MarineNDFHFAKRKTTGTWVNTGLFTQVWKAVASGGKYHSAGWVAKVDADAVFVPSRLAKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSEINWKVGIKNGKYGPMGEDLFAQTCLDKWGVRRIEAFDITTDGACPADRPIDQQKNKKWTP
Ga0193117_105014313300018796MarineTKKLESQMVPATGIYLENCKFVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKSKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0193117_105179313300018796MarineAWVNTGLFTQVWKAIASGGKYQSADWVAKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193117_105467313300018796MarineWVNTGMFTQVWKAIASGGKYQSADWVVKVDADAVFVPSRLQQKLGAQLVPPSGIYLENCKYVEYGYFGNLEVFSSAAFSTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDVTTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0193388_103248813300018802MarineKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193388_103765113300018802MarineQVWKAIASGGKASSADWVAKVDADAVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193388_104920813300018802MarineVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193388_104934213300018802MarineVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEETVAAFGH
Ga0193388_105301813300018802MarineVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193388_107169513300018802MarineYTDWTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0193329_104606813300018804MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193329_104900913300018804MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKQAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193329_107898113300018804MarineASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVRDWAACHDATMDAFGLTLA
Ga0193329_109108813300018804MarineIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGVRRKEAFDITTDGACPSDRPKDEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTTAFGA
Ga0193329_110179613300018804MarineGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIASRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITT
Ga0193329_110525013300018804MarineLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTSAFGA
Ga0193441_106381113300018807MarineVDYGYFGNLEVYSKQAFTTLIQNIDVCKSSINWKLGVKNGKYGPMGEDLFAQTCLDSKGIRRKEAFDITTDGACPADRPEGEKENKKWKPNCASTSTPAMHPFKKTQEWIECYQATTSSFGA
Ga0192829_109955113300018812MarineNTGMFTKIWKAIEASGKFRSADWIAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCH
Ga0193497_103637913300018819MarineYNCFTTKPGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKISGTWVNTGMFSQIWKKIAEAGEYQNADWVLKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKEEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193497_107488413300018819MarineMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSNKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFTTLVDKIDVCKADSHINWKVGVKNGKYGPMGEDLFAQACLDKFEVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0193172_107615613300018820MarineFTKIWKAIEASGKFRSADWIAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193412_105552213300018821MarineIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDSCKASQEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0192877_115616813300018834MarineFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0192927_105354713300018837MarineNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193312_101962713300018844MarineLKTTMVTDVDGDFHFAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKTSTAAMHPFKKEAEWFECFEATTAAFGY
Ga0193312_102238113300018844MarineSADWVVKVDADAVFIPSRLSEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQSCLDKFDVRRVEAFDITTDGACPADRPIDEHKNKKWKPTCAWTATSAMHPFKKLKDWAACHEATMDAFGLTLS
Ga0193312_102349123300018844MarineDWVVKVDADAVFVPSRLSKKLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATVAAFGS
Ga0193312_106160013300018844MarineDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193042_107546913300018845MarineFAKRKTSGAWVNTGMFSQVWKKINKHVYTDWVAKVDGDAVFIPNRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFVTLLANIDMCKASTEINWKVGIKNGKYGPMGEDLFAQTCLDLKGVRRVEAFDITTDGACPADRPEDEKKNKKWQPKCGETSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193042_107576613300018845MarineVFADVEVEVGPGLQTIKVVDTDNDFHFAKRKETGAWVNTGMFTQVWKAIASGGKASSADWVAKVDADAVFVPSRLATKLQSQLVPPGGLYLENCKYVEYGYFGNLEVFSKAAWNTLIEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193042_107576713300018845MarineVFADVEVEVGPGLQTIKVVDTDNDFHFAKRKETGAWVNTGMFSQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193042_107763013300018845MarineVFADVEVEVGPGLQTIKVVDTDNDFHFAKRKETGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193042_107763113300018845MarineVFADVEVEVGPGLQTIKVVDTDNDFHFAKRKETGAWVNTGMFAQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSAKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193042_108516213300018845MarineDDVEGDFHWAKRKVSGSWVNTGMFTQVWKKITKHNSADWVAKVDGDAVFIPNRLRGWLQSQMVPDEGIYLENCKYVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQKCLGMLGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATTAAFGK
Ga0193042_110069813300018845MarineQSDVFSDVDVEVGPGLRTIKVEDVEGDFHFAKRKETGAWVNTGLFSQVWKKMYKHQSADWVAKVDGDAVFIPNRLRTWLSRQLVPDNGIYLENCKFVDYGYFGNLEVFSKAAFVTLLANIDECKASPEINWMVGIEDGKYGPMGEDLFAQTCLDMKGVRRIEAFDTTTDGACPADRPQDQRKNKHWQPNCAETSTASMHPFKDKDKWLQCWEATVAAFGQ
Ga0193042_111398613300018845MarineDNGIYLEDCKFVDYGYFGNLEVFSRQAFNILLDNIDLCKASTEINWKTGVKNGKYGPMGEDLFAQACLDLKGVRRVEAFDITTDGACPADRPEGEKKNKKWQPNCAETSTAAMHPFKKLEEWTSCYGATVAAFGE
Ga0193042_113575913300018845MarineFSTLIDNIDSCKSTLNWKVGIKDGKYGPMGEDLFAQSCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA
Ga0193500_104278923300018847MarineMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEQKKNKKWKPNCASAATPAMHPFKKTQEWIQCYQATTAAFGA
Ga0193500_104472813300018847MarineMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193500_104573223300018847MarineMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPSDRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193500_106303213300018847MarineAEGKYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSRQAFSTLLQNIDMCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192970_102780633300018848MarineLEILQHQYLQQLGIFQCEESDVFSDVSVEVGGGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNKLVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTAAFGA
Ga0193005_106583613300018849MarineVEGDFHLAKRKISGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQC
Ga0193273_101360723300018850MarineFDCEQYDVFSDVDVEVGSDLRTIKVDDVEGDFHWAKRKVSGSWVNTGIFTQVWKKITKHNSADWVAKVDADAVFIPNRLRGWLQSQRVPDEGIYLENCKYVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQHNNKKWKPNCAETSTAAMHPFKKKDEWFQCWDATTAAFGK
Ga0193273_101658913300018850MarineVNTGLFTQVWKAVASAGKYHSAGWVAKVDADAVFVPSRLAKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDRWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVSAFGS
Ga0193273_107776813300018850MarineQVDDVEGDFHLAKRKISGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKP
Ga0192958_111673113300018853MarineWLKQHALVPPAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDACKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193214_104737313300018854MarineVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKISGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNGLVPAPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193214_107241613300018854MarineVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKISGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCASVATPAMHPFKKTQEWIQCYEATT
Ga0193214_108080113300018854MarineAWVNTGLFSQVWKAIASGSKWQSVDWVVKVDADAVFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0193214_110497213300018854MarineEGKYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSRQAFSTLLQNIDMCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193413_105900713300018858MarineKKLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193413_108265013300018858MarineRKVSGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQC
Ga0193199_104644613300018859MarineVGQKMYCFSVYTKDTGSSKPSSELEIIQHQKSQNLGIFQCDYSAVFSDVSVDVGGGMMTTVVTDVEGDWHFAKRKVSQTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193199_105934813300018859MarineQYSQNIGVFACDQAEVFSDVEADLGPGAKTIVVQDTDGDFHFAKRKISGSWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193199_106650813300018859MarineMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEVGEYQNADWVLKLDADAIFIANRMKIWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSKQAFSTLLQNIDSCKRTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193199_106651513300018859MarineMTTVVTDVEGDWHFAKRKISGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193199_107704113300018859MarineMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEVGEYQNADWVLKLDADAIFIANRMKIWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSKQAFSTLLQNIDSCKRTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAAAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193199_111484913300018859MarineFTQIWKKMGEMGKYQSADWVMKVDADAIFVPSRMRTWLFANRLVPPAGIYLENCKYVDYGYFGNLEVYSKQAFTTLIQNIDVCKSSINWKLGVKNGKYGPMGEDLFAQTCLDSKGIRRKEAFDITTDGACPADRPEGEKKNKKWKPNCASTSTPAMHPFKKTQEWIECYQATTNSFGA
Ga0193072_108823113300018861MarineYFGNLEVFSKAAFSTLIDKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193359_104921913300018865MarineWLSRQLVPDNGIYLENCKFVEYGYFGNLEVFSKAAFTTLLANIDQCKASTDINWKIGVHDGKYGPMGEDLFAQSCLDTKGVRRVEAFDITTDGACPADRPQDQKKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193359_106973313300018865MarineVNTGMFSQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKQNELVPPAGIYLENCRYVDYGYFGNLEVFSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193359_107293113300018865MarineVNTGMFSQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKQNELVPPAGIYLENCRYVDYGYFGNLEVFSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKQAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193359_107587713300018865MarineHIFACDQWDVFSDVEVDIGGVTTTKVTDVEGDFHFAKRKVTGTWVNTGLFTQVWRSIQNGGKYEQANWVAKVDGDAVFIPTRLRSWLSKQRVPAPGIYLENCKFVDYGYFGNLEVFSTAAFRTLLQNINTCKSSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKDQKTNKKWKPECSYVSTPAMHPFKKLNEW
Ga0193359_108301213300018865MarineSDVEVDIGGVMTTKVTDVEGDFHFAKRKVTGTWVNTGLFTQVWRSIQNGGKYEQANWVAKVDGDAVFIPTRLRSWLSKQRVPAPGIYLENCKFVDYGYFGNLEVFSTAAFRTLLQNINTCKSSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKDQKTNKKWKPECSYVSTPAMHPFKKLNEW
Ga0193359_109847213300018865MarineAIASGGKYQSADWVAKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193359_110856313300018865MarineTDKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0192859_103161713300018867MarineIFDCEQYDVFSDVDVEVGSDLRTIKVDDVEGDFHWAKRKVSGTWVNTGIFTQIWKKITKHESADWVAKVDADAVFIPNRLRVWLQSQRVPDEGIYLENCKFVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQKCLGMLGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQCWDATTAAFGK
Ga0192859_103246723300018867MarineFSDVEVEVGPGMMTIAVQDTEGDFHVAKRKTTGAWINTGMFTKIWKAVEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANMDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDITTDGACPADRPADQKKNKKWKPNCAYVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192859_103279513300018867MarineFSDVEVEVGPGMMTIAVQDTEGDFHIAKRKTSGAWINTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192859_105468813300018867MarineQYAREKGLHIFACDQYDVFSDVEADVGLGLKTVQVFEQDDDWHFAKREETGAWVNTGMFTDVWRKIKEGSKYSSVDWVSKVDGDAVFIPNRLKVWLARQMVPAEGAYLENCKHVDYGYFGNLEVFSQAAFARLLVELDGCKQNIDWKIGIKDGKYGPDGEDLFAQRCLDSVGVRRIEAFDISTDGACPADRPVGHEKDKKWKPACGTVKTPAMHPFK
Ga0192859_106850823300018867MarineQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTPAMHPFKKLDEWVQCHEATVAAFGK
Ga0192859_106873013300018867MarineVEAEVGPGLRTIKMEDVENDFHFAKRIDTGGWVNTGLFTQVWKAIASGGKTSTADWVAKVDADAVFVPSRLRQKLQSQFVHPSGIYLENCKYVEYGYFGNLEVFSSAAFSTLVDKIDTCKADSQINWKVGVKNGKYGPMGEDLFAQVCLDKYGVRRIEAFDITTDGACPADRPISQQKNKKWKPTCEWTATAAM
Ga0192859_106976713300018867MarineGTWINTGMFTQIWKKITKHVYADWVAKVDADAVFVPSRLRTWLSSQLVPSNGVYLENCKYVDYGYFGNLEVFSKAAFMTLVANIDLCKASSEINWKVGVKNGKFGPMGEDLFAQTCLDLKGVRRIEAFDITTDGACPADRPQDQQKNKKWKPNCAWTATAAMHPFKKTDEWLTCYDATIAAFPEQ
Ga0192859_107336513300018867MarineVTDVEGDFHFAKRKNSGAWVNTGMFKQVWKAIGSGDKYKTASWVVKVDVDAVFLPSRLTKKLESQMVPANGIYLENCKYVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEA
Ga0192859_107936813300018867MarineGIYLENCKYVEYGYFGNLEVFSSAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0192859_108045413300018867MarineGNLEVFSKAAFNTLLANMDACKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKNVRRVEAFDITTDGACPADRPKDEKNNKKWKPNCAWVSTPAMHPFKKLDEWVQCHEATVAAFGK
Ga0192859_108534413300018867MarineWLGGQLVPSNGIYLENCKYVEYGYFGNLEVFSKAAFMTLLANVDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQKKNKKWKPSCAETSTPAMHPFKKYDEWFQCWQATVDAFGQ
Ga0192859_108690813300018867MarineGIYLENCKYVEYGYFGNLEVFSSAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0192859_108721913300018867MarineADAVFVPSRLVRWLQGQRVPDNGIYLENCKFVQYGYFGNLEVFSKAAFNTLLANMDSCKKDPKINWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRVEAFDISTDGACPADRPVDQKTNKKWKPNCAWVSTPSMHPFKKLDEWVQCHAATVAAFGK
Ga0193162_103778313300018872MarineTKPGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGVMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGNRCKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193162_109758213300018872MarineDFHFAKRKETGAWVNTGLFTQVWKAIASGGKYQSADWVAKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIQNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWI
Ga0193553_109016523300018873MarineTWGVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDITTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0193553_109930113300018873MarineVVKVDADAVFVPSRLSKKLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATVAAFGS
Ga0193471_106292913300018882MarinePKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLIEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193276_104705513300018883MarineIKVVDTDNDFHFAKRKETGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSTKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLTAKIDDCKADSKINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193276_105194513300018883MarineVGPGMMTIAVQDTEGDFHIAKRKTSGAWINTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193276_105695113300018883MarineVGPGMMTIAVQDTEGDFHVAKRKTTGAWINTGMFTKIWKAVEASGKFRSADWVAKIDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANMDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDITTDGACPADRPVDQKKNKKWKPNCAYVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193276_108004113300018883MarineDYGYFGNLEVFSQAAFSTLVEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDRWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVSAFGS
Ga0193276_108323213300018883MarineDYGYFGNLEVFSQAAFSTLVEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDRWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAATATPAMHPFKKVADWIKCHDETVSAFGS
Ga0193276_108968013300018883MarineDVEGDFHLAKRKISGTWVNTGVFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDLKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193311_1004678813300018885MarineSIASGGKYQSADWVAKVDADAVFVPSRLSKLLQSQLVPPSGVYLENCKYVDYGYFGNLEVFSKAAFVTLTEKIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKWGVRRVEAFDITTDGACPADRPVDQQKNKKWTPTCAATATPAMHPFKKVADLIKCHDATIAAFGS
Ga0193304_103666913300018888MarineCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNIGIFQCDYSAVFSDVSVDVGGGMMTTVVTDVEGDWHFAKRKTSGTWVNTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPSDRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193258_113699713300018893MarineEMCSKRSEDCFATGCCDVVGYSCFTTTPGQARCLSNCTPSAKQSCTQPQGIMDPILQDAVPVGQKMYCFALYTENTGSTKQSHELEILQHQHSQQLGIFQCDYSDVFSDVSVEVGNGQMTTVVTDVEGDWHFAKRKVSGTWVNTGIFTQIWKKIAEGGKYQSADWVLKLDADAIFVPNRMRVWLKQHALVPPAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDIT
Ga0192965_117453113300018896MarineSKAAFSTLIDNIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS
Ga0193244_103301613300018903MarineQDVFADVEVEVGPGLSTIRVVDAENDFHFAKRKESGAWVNTGMFTQVWRAIAIGGKYQSADWVVKADADAVFVPSRLSNKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSNNAFVTLIQKIDDCKADAQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETTGAFGS
Ga0193244_103528523300018903MarineADWVVKVDADAVFVPSRLRNKLGAQLVPPSGIYLENCKYVEYGYFGNLEVFSQAAWSTLVDKIDDCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATVNAFGS
Ga0193244_105366223300018903MarineNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193244_105678213300018903MarineNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193244_105841523300018903MarineTKLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFGTLIDKIDDCKADSEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPMDQQKNKKWTPNCASTATPAMHPFKKVADWIACHDATMAAFGN
Ga0193244_106020613300018903MarineRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0193244_106210213300018903MarineADWVVKVDADAVFVPSRLRNKLGAQLVPPSGIYLENCKYVEYGYFGNLEVFSQAAWSTLVDKIDDCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATAAMHPFKKVADWIQCHDATVNAFGS
Ga0193244_106424013300018903MarineLENCKFVDYGYFGNLEVFSQVAFKTLIANIDMCKASTEINWKVGIKNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQHNNKKWQPNCAETSTAAMHPFKIKDEWFQCWEATTAAFGK
Ga0193244_106930213300018903MarineDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193244_106994323300018903MarineDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYQATTAAFGA
Ga0193244_107639313300018903MarineDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193244_109453413300018903MarineHFAKRKETGAWVNTGMFAQVWKAIASGGKYQSADWVAKVDADAVFVPSRLATKLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFDTLIDKIDDCKADSEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWI
Ga0193244_109512213300018903MarineDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQACLDSVGIRRKEAFDITTDGACPADRPKEDKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193244_109565413300018903MarineNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWQPNCASATTPAMHPFKKTEEWKQCYEATTSAFGA
Ga0193244_109808213300018903MarineVDDVEGDFHWAKRKVSGTWVNTGIFTQIWKKITKHNSADWVAKVDADAVFIPNRLRGWLQNQRVPDEGIYLENCKFVDYGYFGNLEVFSQAAFKTLIANIDMCKASAEINWKVGIQNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQHNNKKWKPNCAETSTAAMH
Ga0192874_1003485213300018904MarineKVDTDTVFLPRRLHRWLGKRLVLDDGVYFETCRFVDYGYFGSLEVFSVVAFHAFLENVDMCKASLNWRAGIKNGLYGPMREDLFAQICLDKVGVRRLDAFDITTDGTCPADRPQDQKKNPEWKPNCAEVSAPAMHPFKKSHEWVDCHWATISKFGH
Ga0192874_1004858513300018904MarineACEEHDVFADVEVEVGPGLQTIKVVDAENDWHFAKRKETGAWVNTGMFTQVWKAIASGGKASSADWVVKVDADAVFVPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSQAAWSTLIDKIDDCKADSQINWKVGIHDGKYGPMGEDLFAQACLDKFAVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVADWRECHDATMAAFGS
Ga0193279_103538813300018908MarineLKYQKANNLGIFQCDESDVFSDVSEDVGSGMMTTVVSDVEGDFHFAKRKSTGAWVNTGMFIQVWRKIAEGGKYQNADWVLKLDADAVFVPNRMRVWLKQNNLVPPSGIYLENCKYVDYGYFGNLEVFSRQAFSTLISNIDTCKQTTNWKLGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPGDRPEAEKKNKKWKPDCASAATPAMHPFKKLGEWQACYDATQQAFGS
Ga0193279_106528113300018908MarineWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193279_106839813300018908MarineGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFKKLDEWVQCHEATVAAFG
Ga0193279_109653913300018908MarineENCKYVEYGYFGNLEVFSSAAFATLTDKIDDCKADSQINWRVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0193279_111700313300018908MarineVYLENCKYVQYGYFGNLEVFSKAAFNTLLANMDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDITTDGACPADRPVDQKKNKKWKPNCAYVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192989_1011811613300018926MarineMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEGVKYQNADWVMKLDADAIFVPSRMKVWLKQNELVPPAGVYLENCKYVDYGYFGNFEVYSREAFTTLIRNIDTCKQTLNWKVGVENGKWGPMGEDLFAQKCLDSVGVRRKEALDITTDGACPGDRPVAEKNNKKWKPNCASAATPAMHPFKKTDEWIKCYDATTAAFGA
Ga0193083_1003316513300018927MarineACEQQDVFADVEVAVGPGLQTIKVVDTEGDWHFAKRKTSGAWVNTGMFTQVWKAIASGGKASSADWVVKVDADAVFVPSRLRQKLGAQMVPASGVYLENCKYVEYGYFGNLEVFSQAAWSTLVAKIDVCKAQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0192921_1011726213300018929MarineEVEVGPGLQTIKVEDADNDWHFAKRKETGAWINTGMFTQVWKAIASGGKASSADWVAKVDADAVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0192921_1015842713300018929MarineTWGLMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPANRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0192955_1004049013300018930MarinePQGIMDPILQDAVPVGQKMYCFSVFTQDTGSTKQSHELDILKHQHSNHLGIFQCDYSDVFSDVSVQVGTDLMTTVVTDEEGDWHIAKRKVSGTWVNTGMFTQIWKKIAEGNKYQNADWVMKLDADAIFVPNRMRVWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0192955_1004106813300018930MarineMGGIFQCEEPDVFSDVGVEYGSGVMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQACLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTSAFGA
Ga0192955_1007507113300018930MarineDVSVEVGNGQMTTVVTDVEGDWHFAKRKVSGTWVNTGIFTQIWKKISEGGKYQSADWVLKLDADAIFVPNRMRVWLKQRALVPPAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192955_1011818613300018930MarineASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDSCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0193552_1012952023300018934MarineQSADWVMKVDADAVFIPNRLRTWLSRQLVPDTGIYLENCKFVDYGWFGNLEVFSKAAFATLLANIDECKASPEINWKLGVKEGKYGPMGEDLFAQTCLDLKGVRRVEAFDTTTDGACPADRPQDQKENKKWQPNCAETSTASMHPFKKKEEWFQCWEATVAAFGQ
Ga0193552_1016464113300018934MarineWKKAQKHQSVEWVMKVDADAVFIPNRLRPWLSGQLVPDSGIYLENCKFVEYGYFGNLEVFSKAAFLTLLASIDECKASPEINWKLGVHEGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDQKENKKWKPNCAETATAAMHPFKKKDEWFQCWEATVNAFGQ
Ga0193552_1017250613300018934MarineYGYFGNLEVFSKAAFVTLTEKIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKWGVRRVEAFDITTDGACPADRPVDQQKNKKWTPTCAATATPAMHPFKKVADWIKCHDATIAAFGS
Ga0193426_1007919613300018942MarineRMRVWLKQNELVPPAGTYLENCKYVDYGYFGNLEVYSRQAFSTLLQNIDTCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193426_1009286713300018942MarineTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDMCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0193266_1013039113300018943MarineGIYLENCKYVEYGYFGNLEVFSQAAWNTLIDKIDDCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKDKKWKPTCAWTATPAMHPFKKVADWMACHDATMAAFGS
Ga0193066_1006603213300018947MarineCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193066_1006604113300018947MarineCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMNVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193066_1011853913300018947MarineADWVAKVDADAVFIPSRLRNWLSRQRVPSNGVYLENCKYVDYGYFGNLEVFSKAAFMTLVSNIDACKASSEINWKVGVKNGKFGPMGEDLFAQTCLDLKGVRRVEAFDITTDGACPADRPEDQKKNKKWKPTCAWTSTAAMHPFKKKDEWFKCYDDTIAAFPE
Ga0193066_1011935113300018947MarineGDFHLAKRKISGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193066_1012083913300018947MarineKTIAVQDTDGDFHFAKRKTSGAWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPSNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGIEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193066_1014542413300018947MarineKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0193066_1016998613300018947MarineCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEHKNKKWKPTCAWTATSAMHPFKKLKDWAACHEATMDAFGLTLS
Ga0193066_1017668213300018947MarineDVDAVFVPTRLVRWLQGQRVPSNGVYLENCKFVQYGYFGNLEVFSKAAFSTLLANMDACKTDPQINWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDISTDGACPADRPVDQKKNKKWKPNCAYVSTPAMHPFKKLDEWVQCHEATVAAFGK
Ga0193066_1018297913300018947MarineQNELVPPAGIYLENCKYVEYGYFGNLEVYSRQAFSTLLQNIDMCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193066_1021539613300018947MarineLSKQMVPAPGIYLENCKFVDYGYFGNLEVFSTAAFRTLLQNINTCKSSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPEEQKTNKKWKPDCSYVSTPAMHPFKKLNEWISCYEATGKAFGY
Ga0193066_1023405313300018947MarineHGENCKFVDYGYFGNLEVFSRAAFDTLIDKIDDCKADSEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIACHDATVAAFGS
Ga0193128_1008613313300018951MarineTWGVVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193128_1008614613300018951MarineTWGVVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193128_1009445613300018951MarineVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193128_1013089213300018951MarineLVPPAGIYLENCKHVDYGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193528_1011043813300018957MarineVGSGMMTTVVSDVEGDFHFAKRKSTGAWVNTGMFIQVWRKIAEGGKYQNADWVLKLDADAVFVPNRMRVWLKQNNLVPPSGIYLENCKYVDYGYFGNLEVFSRQAFSTLISNIDTCKQTTNWKLGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPGDRPEAEKKNKKWKPDCASAATPAMHPFKKLGEWQACYDATQQAFGS
Ga0193528_1013851123300018957MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193528_1014222813300018957MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193528_1014486213300018957MarineLEILQHQHSQHLGIFQCDYSDVFSDVSVEVGSGQMTTVVTDVEGDWHFAKRKTSGTWVNTGIFTQIWKKIAEGGKYQNADWVLKLDADAVFVPNRMRIWLKQHALVPPAGIYLENCKHVDYGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGIKNGKHGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTTTAAFGA
Ga0193528_1015305313300018957MarineYELEILQHQQSKQLGIFACEYFDVFSDVTADVGGGITTTVVTDAEGDWHFAKRKVSGAWVNTGMFTQVWKKISEGNKYQNADWVMKLDADAVFVPSRMKVWLKKNELVPRNGIYLENCKYVDFGYFGNLEVYSQVAFATLIANIDTCKQSINWKLGVKNGKYGPMGEDLFAQRCLDSVGVRRKEAFDITTDGACPADRPVEEKENKKWKPNCASTATPAMHPFKKKQDWIKCYDETTAAFGA
Ga0193528_1015675123300018957MarineLEILQHQHSQHLGIFQCDYSDVFSDVSVEVGSGQMTTVVTDVEGDWHFAKRKTSGTWVNTGIFTQIWKKIAEGGKYQNADWVLKLDADAVFVPNRMRIWLKQHALVPPAGIYLENCKHVDYGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGIKNGKHGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193528_1015703713300018957MarineKETGAWVNTGMFTQVWKAIASGGKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDMTTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0193528_1017551113300018957MarineSADWVAKVDADAVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLIEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS
Ga0193528_1017839713300018957MarineHVYTDWVAKVDADAVFIPNRLRSWLGEQLVPTNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPKDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193528_1019577813300018957MarineGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGAQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDQQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193528_1020190213300018957MarineEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKVDADAVFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQACLDSVGVRRKEAFDITTDGACPSDRPKDEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193528_1020888023300018957MarinePPSGIYLENCKYVEYGYFGNLEVFSKAAWDTLIAKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS
Ga0193528_1021600213300018957MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQKADWVMKLDADAVFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAA
Ga0193528_1027649913300018957MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIASRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEE
Ga0193528_1028493413300018957MarineVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193531_1015907613300018961MarineSDVFADVDVEVGPGLRTIRVDDVEGDFHLAKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193531_1017161713300018961MarineSDVFADVDVEVGPGLRTIRVDDVEGDFHLAKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDTTTDGACPADRPHDEQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193531_1019175313300018961MarineSDVFADVDVEVGPGLRTIRVDDVEGDFHLAKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193531_1022072813300018961MarineSDVDVEVGPGLRTIKVEDVEGDFHFAKRKDTGAWVNTGLFSQVWKKMYKHQSASWVAKVDGDAVFIPNRLRTWLSRQLVPDNGIYLENCKFVDYGYFGNLEVFSKAAFVTLLANIDECKASPEINWMVGIKDGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDQRKNKHWQPNCAETSTAAMHPFKHKDQWLQCWEATVAAFGQ
Ga0193531_1029062213300018961MarineIAVQDTEGDFHFAKRKTSGAWINTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGIYLENCKFVQYGYFGNLEVFSKAAFNTLLANMDSCKKDPQINWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDITTDGACPADRPVDQKENKKWKPNCAEVSTPAMHPFKKL
Ga0193087_1019603413300018964MarineKYVDYGYFGNLEVFSQAAFATLLQNIDSCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPANRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0193293_1002304113300018966MarineLEILQHQKSQNIGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193293_1002925913300018966MarineHGVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193293_1004283113300018966MarineADWVAKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193293_1008719913300018966MarinePSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193293_1009361313300018966MarineHGVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANMDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDITTDGACPADRPADQKKNKKWKPNCAYVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193293_1009866813300018966MarineSNAAFATLIEKIDDCKADAQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0193293_1013352813300018966MarineEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193417_1017642023300018970MarineWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPSRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDSCKASQEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193326_1002782013300018972MarinePSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193326_1003843713300018972MarineSIQNGGKYEKANWVAKVDADAVFIPTRLRSWLSKQRVPAPGIYLENCKFVDYGYFGNLEVFSTAAFRTLLQNINTCKSSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKDQKTNKKWKPECSYVSTPAMHPFKKLNEWISCYEATGKAFGY
Ga0192873_1025972313300018974MarineFSDVKVQVGPGLQTIKVVDTEGDWHFAKRKETGAWVNTGMFSQVWKAIATGWKASSADWVVKVDADAVFVPNRLRAKLGAQMVPPTGVYLENCKYVEYGYFGNLEVFSQAAWSTLVANIDVCKADSRINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVANWIQCHADTVNAFGS
Ga0192873_1030488213300018974MarineVAKVDGDAVFIPNRLRGWLQSQRVPDEGIYLENCKYVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQKCLGMLGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQCWDATTAAFGK
Ga0193254_1003656213300018976MarinePILQDAVAVGQKMYCFSVYTENTGSTKQSHELEILQHQFSQQLGIFQCEESDVFSDVSVEVGGGMMTTVVTPAEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTAAFGA
Ga0193254_1011443913300018976MarineNADWVMKLDADAIFVPNRMRVWLKQNELVPPAGLYLENCKYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0193254_1013856113300018976MarineAGIYLENCKHVDYGYFGNLEVFSREAFSTLIKNIDTCKQTLDWKVGVKDGKYGPMGEDLFAQSCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYEATTAAFGA
Ga0193487_1005607013300018978MarineKVAPSARGDPADLECQEMYCFSVYTKDTTSSKPSYEPEVLQHQKPQNLGIIQCDFSAVFSDVSVEVGGGMMTTVATDVQGDWHSAMRKVPGTWTNTSMLTQIRKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKRIALVPPAETYLENCKYVDYGYFGNLEGYSTQAFSTLVQNVGSCKQTLNRKVGIKDGKYSPMDEDLFAQTCLDCVGIRRKEAFEITTHGARPGDRPKEGKKNKKWKPNCATVTIPAMRPFKRSSATKPQLPLRHKWPRNSLSVL
Ga0193487_1007134413300018978MarineVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVPGTWVNTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKRIALVPPAETYLENCKYVDYGYFGNLEGYSTQAFSTLVQNVGSCKQTLNRKVGIKDGKYSPMDEDLFAQTCLDCVGIRRKEAFEITTHGARPGDRPKEGKKNKKWKPNCATVTIPAMRPFKRSSATKPQLPLRHKWPRNSLSVL
Ga0193487_1014847713300018978MarineKVAPSARGDPADMERQRMYRFSVYTKDTTSSKPSYEPEVLQHQKPQNLGIIQCDFSAVFSDVSVEAGGGMMTTVATDVQRDWHSAIRKVPGAWVYTSMFTQIWKKIAAAEEYQNADWMMELGADAIFIANRMKVWLKHIALVPPVGIYLENCKYVDYGYFGNLEVYTTQALSTLVLNVVSYKQTLNRSVGIKAGKYGPMGEDLFAQTCLDSLDNRRKDAFGITTGGACPGDLPKEERRTRSGSQIAHRWPLRRCTPSRRHRSGSSAMKPP
Ga0193487_1016829413300018978MarineFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193487_1019220913300018978MarineGLFTQVWKKITKHVYTDWTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0193487_1020525313300018978MarineQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKISGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQC
Ga0193487_1021286013300018978MarineVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSQTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKKNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQC
Ga0193487_1022147513300018978MarineANRMKVWLKHNELVPPAGVYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPSDRPKEEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193487_1022985613300018978MarineGAWVNTGLFTQVWKAIASGGKYQSADWVAKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193487_1023658213300018978MarineIAADGKYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSREAFSTLTKNIDVCKKTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193487_1027299513300018978MarineNLEVYSRQAFSTLIQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKGEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193487_1028426113300018978MarineYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTSAFGA
Ga0193540_1009438223300018979MarineRKVSGSWVNTGIFSQIWKAIEASGKFRSADWVAKVDADAVFVPTRLVRWLQQQRVPDNGIYLENCKFVQYGYFGNLEVFSKAAFNTLLANLDACKQDPQINWKLGVQGGKYGPMGEDLFAQACLDVHGVRRIEAFDITTDGACPADRPVDQKENKKWKPNCAEVSTAAMHPFKKLDDWVKCHEATVAAFGK
Ga0193540_1010755113300018979MarineHGQDTEGDFHFAKRKTSGAWVNTGMFTKIWKAVEASGKFRSADWVAKVDVDAVFVPTRLVRWLQGQRVPSNGVYLENCKFVQYGYFGNLEVFSKAAFSTLLANMDACKTDPQINWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDISTDGACPADRPVDQKKNKKWKPNCAYVSTPAMHPFKKLDEWVQCHEATVAAFGK
Ga0193540_1013994613300018979MarinePPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDMTTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0193540_1014945113300018979MarinePNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATIDAFGDR
Ga0193540_1015609713300018979MarineYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0193540_1021901223300018979MarineQYGYFGNLEVFSKAAFNTLLTSMDSCKTDPEINWKVGVQGGKFGPMGEDLFAQTCLDTQGVRRVEAFDISTDGACPADRPVDQKKNKKWKPNCAYVSTPAMHPFKKLDEWSQCHDATVAAFGN
Ga0192961_1015325513300018980MarineFTQIWKKIAEGVKYQDADWVMKLDADAIFVPSRMKVWLKQNELVPPAGVYLENCKYVDYGYFGNFEVYSREAFTTLIRNIDTCKQTLNWKVGVENGKWGPMGEDLFAQKCLDSVGVRRKEALDITTDGACPGDRPVAEKNNKKWKPNCASAATPAMHPFKKTDEWIKCYDATTAAFGA
Ga0192961_1016818623300018980MarineFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0192961_1023021613300018980MarineGYFGNLEVFSQVAFQTLVQHIDNCKATLNWKIGVKNGKYGPMGEDLFAQTCLDQVGVRRIEAFDITTDGACPADRPAGQEKDKTWKPECSSVSTPAMHPFKKLPEWIQCHEATVSAFGN
Ga0192968_1005663813300018981MarineMGQKLGIFQCEESDVFSDDSAEVGGGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNKLVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCGSTATPAMHPFKKTQEWVQCYEATTAAFGA
Ga0192947_1022212523300018982MarineGIFIPSRMRVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVEDGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWKQCYQATTSAFGA
Ga0193136_1006653413300018985MarineCDAQDVFADVAVEVGGGLSTIMVTDAENDFHFAKRKETGAWVNTGLFTQVWKAIASGGKYQSADWVAKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193136_1009636813300018985MarineMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193136_1011098513300018985MarineDVEGDFHFAKRKTSGTWINTGMFSQVWKKITKHVYTDWTAKVDGDAVFIPNRLRSWLGGQMVPSTGIYLENCKFVDYGYFGNLEVFSKAAFVTLLANIDMCKSSTEINWKVGVKNGKYGPMGEDLFAQSCLDLKGVRRVEAFDITTDGACPADRPEDEKKNKKWKPTCAETSTAAMHPFKKKEEWVQCWEATVAAFGQ
Ga0193554_1010935513300018986MarinePSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGVCPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193188_1003873613300018987MarineQVPTVTATQETGSSKPSHELEILQHDVSVDVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFG
Ga0193275_1013869013300018988MarineIASGSKWQSVDWVVKVDADAVFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0193275_1016616113300018988MarineHGGYFGNLEVFSKAAFSTLTAKIDDCKADSKINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193030_1009691613300018989MarineGLKTTMVTDVDGDFHFAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPANRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0193030_1024903013300018989MarineADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDTTTDGACPADRPHDEQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193030_1026587513300018989MarineFAKRKETGAWVNTGMFTQVWKAIASGGKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDMTTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDA
Ga0193430_1004607813300018995MarineHGDVEVGPDLRTIKVDDVEGDFHWAKRKVSGSWVNTGIFTQVWKKITKHNSADWVAKVDADAVFIPNRLRGWLQSQRVPDEGIYLENCKYVDYGYFGNLEVFSQAAFKTLIANIDMCKASPEVHWKVGIQNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQHNNKKWKPNCAETSTAAMHPFKKKDEWFQCWDATTAAFGK
Ga0193430_1005476223300018995MarineQHQYSQHLGIFQCDYSDVFSDVSVEVGSGLMTKVVTDVEGDWHFAKRKTSGTWVNTGIFTQIWKKIGAEGTYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSRQAFSTLLQNIDTCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193430_1005597413300018995MarineKVEDADNDWHFAKRKETGAWINTGMFTQVWKAIASGGKASSADWVAKVDADAVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193430_1005611913300018995MarineHGDAENDWHFAKRKETGAWVNTGMFTQVWKAIASGGKTSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVRDWAACHDATMDAFGLTLA
Ga0193430_1006686113300018995MarineDVEVEVGPGMMTIAVQDTEGDFHVAKRKTTGAWINTGMFTKIWKAVEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANMDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDITTDGACPADRPADQKKNKKWKPNCAYVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193430_1007788813300018995MarineFACDQAEVFSDVEADLGPGAKTVVVQDTDGDFHFAKRKISGSWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193430_1008001013300018995MarineTWGVVKVDADAVFVPSRLSAKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193430_1008892613300018995MarineRMWLSRQMVPDNGIYLEDCKFVDYGYFGNLEVFSRVAFKILLENIDMCKASTEINWKLGVKNGKYGPMGEDLFAQACLDLKGVRRVEAFDITTDGACPADRPEDQKESKKWQPNCAETSTAAMHPFKKKADWVNCHAATVAAFGN
Ga0193430_1010492613300018995MarineTGIFTQVWKAIASGRKASSADWVVKVDADAVFVPSRLRQKLGAQMVPPSGVYLENCKYVEYGYFGNLEVFSQAAWSTLVAKIDVCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0193430_1011982313300018995MarineENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKFGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193430_1012264013300018995MarineELDILKEQHARNIGIFLCEQSDVFADVDVEVGPGLRTIRVDDVEGDFHLAKRKISGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKP
Ga0193430_1014106423300018995MarineIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193430_1015200123300018995MarineENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKFGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193430_1016942213300018995MarineENCKYVKYGYFGNLEVFSTAAFKTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193430_1017834313300018995MarineVPPAGIYLENCKYVDYGYFGNLEVYSKQAFTTLIQNIDVCKSSINWKLGVKNGKYGPMGEDLFAQTCLDSKGIRRKEAFDITTDGACPADRPEGEKENKKWKPNCASTSTPAMHPFKKTQEWIDCYQSTTNAFGA
Ga0192916_1011646613300018996MarineEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQKADWVMKLDADAVFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQACLDSVGVRRKEAFDITTDGACPSDRPKDEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192916_1014669213300018996MarineSKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDVCKADSEINWKVGIKNGKYGPMGEAFDITTDGACPADRPVDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVSAFGS
Ga0192916_1014727413300018996MarineEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSQTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCASVATPAMHPFKKTQEWIQCYEATT
Ga0192916_1020685113300018996MarineEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQKADWVMKLDADAVFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASVATPAMHPFKKTQEWIQCY
Ga0192916_1022722713300018996MarineLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS
Ga0193257_1017019613300018997MarineQVWKAIASGRKASSADWVVKVDADAVFVPSRLRQKLGAQMVPPSGVYLENCKYVEYGYFGNLEVFSQAAWSTLVAKIDVCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0193257_1017605613300018997MarineAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193257_1018733013300018997MarineIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193257_1021964413300018997MarineENCKYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0193444_1004665813300018998MarineNCFTTKPGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193444_1007518513300018998MarineSDVFADVDVEVGPGLRTIQVNDVEGDFHLAKRKISGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKFGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193444_1007905913300018998MarineDDVEGDFHWAKRKVSGSWVNTGMFTQVWKKMYKHRSADWIAKVDGDAVFIPNRLRSWLSSQLVPDAGIYLENCKFVDYGYFGNLEVFSKAAFMTLLGSIDECKASPEINWKLGIKDGKYGPMGEDLFAQACLDMKGVRRVEAFDITTDGACPADRPLDQQKNKKWKPNCAETSTAAMHPFKKKEEWFQCWEATVAAFGQ
Ga0193444_1009881623300018998MarineTWGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGKYQNADWVLKLDADAIFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193444_1010475413300018998MarineKRKTSGTWVNTGIFTQIWKKIAAEGKYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVEYGYFGNLEVYSRQAFSTLLQNIDVCKKSLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193444_1011754113300018998MarineDYGYFGNLEVFSKAAFMTLVANIDRCKASSEINWKVGVKNGKFGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDQQKNKKWKPNCAWTSTAAMHPFKKPDEWFKCYDATIAAFPEQ
Ga0193444_1017559113300018998MarineSDVFADVDVEVGPGLRTIRVDDVEGDFHLAKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKP
Ga0193444_1017952713300018998MarineVNTGMFTQVWKAIASGGKASSADWVAKVDADAVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193444_1019181813300018998MarineLVQHIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193444_1020230013300018998MarineYGYFGNLEVFSNAAFATLIQNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193514_1007791113300018999MarineSMMENILQDAVPVGQVMYCFSVYTQDTGSTKPSHELEILQHQRSQNLGIFQCEYSDVFSDVSADLGSGMMTTVVSDVEGDFHFAKRKTSGSWVNTGMYIQIWKKIAEAGQYRNADWVMKLDADAVFVPNRMKVWLKQNELVPPTGIYLENCKYVDYGYFGNLEVFSRQAFSTLISNIDTCKQTTNWKLGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPGDRPEAEKKNKKWKPDCASAATPAMHPFKKLGEWQACYDATQQAFGS
Ga0193514_1010743313300018999MarineSMMENILQDAVPVGQVMYCFSVYTQDTGSTKPSHELEILQHQRSQNLGIFQCEYSDVFSDVSADLGSGMMTTVVSDVEGDFHFAKRKTSGSWVNTGMYIQIWKKIAEAGQYRNADWVMKLDADAVFVPNRMKVWLKQNELVPPTGIYLENCKYVDYGYFGNLEVFSRQAFSTLISNIDTCKQTTNWKLGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPEQEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193514_1012357813300018999MarineFSVYTQNTGTTKPNYELEILQHQQSKQLGIFACEYFDVFSDVTADVGGGITTTVVTDAEGDWHFAKRKVSGAWVNTGMFTQVWKKISEGNKYQNADWVMKLDADAVFVPSRMKVWLKKNELVPRNGIYLENCKYVDFGYFGNLEVYSQVAFATLIANIDTCKQSINWKLGVKNGKYGPMGEDLFAQRCLDSVGVRRKEAFDITTDGACPADRPVEEKENKKWKPNCASTATPAMHPFKKKQDWIKCYDETTAAFGA
Ga0193514_1013825713300018999MarineSQQIGVFACDQTEVFSDVEADLGPGAKTIAVQDTEGDFHFAKRKTSGAWVNTGMFTKIWKAIEASGKFSTADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKFVQYGYFGNLEVFSKAAFNTLLANMDSCKKDPKINWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRVEAFDISTDGACPADRPVDQKTNKKWKPNCAWVSTPSMHPFKKLDEWVQCHAATVAAFGK
Ga0193514_1015047023300018999MarineHGVFSDVSAEVGGGLMTTVVSDAEGDWHFAKRKVSGAWVNTGMFTQVWKKISEGNKYQKADWVMKLDADAVFVPSRMRVWLKQNELVPRNGIYLENCKYVDFGYFGNLEVYSQVAFATLIANIDSCKQSINWKLGVKDGKYGPMGEDLFAQRCLDSVGVRRKEAFDITTDGACPADRPVEEKENKKWKPNCASTATPAMHPFKKKQDWITCYDATTAAFGA
Ga0193514_1020257813300018999MarineTKPSHELEILQHQYSQHLGIFQCEYSDVFSDVSVQLGGGIPIVMTTAVTDVEGDFHFAKRKTSGTWVNTGMYMQIWKKIAEGNKYQNVDWVMKLDADAVFVPNRMKVWLKKNELVPPSGIYLENCKYVDYGYFGNLEVYSREAFSTLLRNIDTCKQTTNWKLGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPESEKKNKKWKPNCASAATPAMHPFKKTQEWI
Ga0193514_1020509013300018999MarineAKVDADAVFVPSRLVKKLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFDTLIDKIDDCKADSEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIACHDATVAAFGS
Ga0193514_1022797323300018999MarineKKLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFDTLIDKIDDCKADSEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIACHDATVAAFGS
Ga0193514_1023723113300018999MarineQVWKAIASGSKYRSVDWVAKVDADAVFVPNRLRKMLSGQRVPDTGVYLENCKYVDYGYFGNLEVFSQVAFQTLLQNIDHCKASLNWKTGIKNGKYGPMGEDLFAQTCLDQVGVRRIEAFHITTDGACPADRPAGQEKNKKWKPECSWVSTPAMHPFKKLPDWINCHEATVSAFGN
Ga0193514_1027832713300018999MarineYLENCKFVDYGYFGNLEGFSKAAFATLLANIDECKASPEINWKLGVKEGKYGPMGEDLFAQTCLDLKGVRRVEAFDTTTDGACPADRPQDQKENKKWQPNCAETSTASMHPFKKKEEWFQCWEATVAAFGQ
Ga0192953_1002746813300019000MarineMDPILQDAVPVGQKMYCFALYTENTGSTKQSHELEILQHQHSQQLGIFQCDYSDVFSDVSVEVGNGQMTTVVTDVEGDWHFAKRKVSGTWVNTGIFTQIWKKIAEGGKYQSADWVLKLDADAIFVPNRMRVWLKQHALVPPAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192953_1004547413300019000MarineIKVEDADNDWHFAKRKETGAWVNTGMFAQVWKAIASGGKASSADWVAKVDADAVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLIEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFGITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0192953_1007692913300019000MarineTWGKVSGTWVNTGMFTQIWKKIAEGVKYQNADWVMKLDADAIFVPSRMKVWLKQNELVPPAGVYLENCKYVDYGYFGNFEVYSREAFTTLIRNIDTCKQTLNWKVGVENGKWGPMGEDLFAQKCLDSVGVRRKEALDITTDGACPGDRPVAEKNNKKWKPNCASAATPAMHPFKKTDEWIKCYDATTAAFGA
Ga0192953_1008481513300019000MarineVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWQPNCASATTPAMHPFKKTEEWKQCYEATTSAFGA
Ga0193034_1009897313300019001MarineYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0193034_1012452013300019001MarineVDSDFHFAKRKSTGAWVNTGMFTQVWKAIANGGKYKSSNWVVKVDADAVFVPSRLEKKLQYQLVPASGIYLENCKFVDYGYFGNLEVYSRVAFSSLLENIDACKASQEINWKVGIKDGKYGPMGEDLFAQACLDKLGVRRVEAFDITTDGACPADRPADQQKNKKWKPDCAVTSTAAMHPFKKKAEWVKCHDATIAAYWY
Ga0193033_1013174413300019003MarineWVVKVDADAVFVPSRLSQKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193196_1010770623300019007MarineHGYNCFTTKPGKAQCLKNCTPSEHQSCTQPQGIMDPILQDAVPVGQKMYCFSLYTKDTGSSKPSYELEILQHQYSQHLGIFQCDYSDVFSDVSVEVGSGLMTKVVTDLEGDWHFAKRKTSGTWVNTGIFTQIWKKIGAEGTYQNADWVLKLDADAVFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSRQAFSTLLQNIDTCKQTLNWKVGIKNGKYGPMGEDLFAQNCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193196_1013917713300019007MarineHGSDVFSDVDVEVGPGMHTTVVTDVEGDWHFAKRKVSGTWVNTGMFSQIWKKMGEMGKYQSADWVMKVDADAIFVPSRMRTWLFANRLVPPAGIYLENCKYVDYGYFGNLEVYSKQAFTTLIQNIDVCKSSINWKLGVKNGKYGPMGEDLFAQTCLDSKGIRRKEAFDITTDGACPADRPEGEKKNKKWKPNCASTSTPAMHPFKKTQEWIECYQATTSSFGA
Ga0193196_1019486723300019007MarineVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKISGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNGLVPAPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAAAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193196_1021777223300019007MarineTWAKRKVSGTWVNTGMFSQIWKAIGSGQKYQQADWVLKADADAVFVPSRLRTWLSKQMVPDAGIYLENCRFVDYGYFGNLEVYSAAAFQTLLNNIDGCKSQLNWKVGIKNGKYGPMGEDLFAQACLDRVGVRRAEAFDITTDGACPADRPEDQKKNKKWKPDCSQVSTAGMHPFKKLPEWIACFDATTTAFGG
Ga0193196_1026510223300019007MarineWVNTGMFSQIWKAIGSGQKYQQADWVLKADADAVFVPNRLRSWLSNQMVPDAGIYLENCRFVDYGYFGNLEVYSTAAFQTLLNNIDSCKSQLNWKVGIKNGKYGPMGEDLFAQACLDSVGVRRAEAFDITTDGACPADRPEDQKKNKKWKPDCSQVSTAAMHPFKKLPEWITCFDATTAAFGG
Ga0193196_1026833213300019007MarineVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKISGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANCMKVYSTQAFSTLVQNIESCKQILNWKVGIKDGKYGPMGEDLFAQTCLDSAGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKKQEWIQCYEATTAAFGA
Ga0193196_1027234613300019007MarineMGRKISGSWVNTGMFSKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193196_1028725013300019007MarineKYQSADWVVKVDADAVFVPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNNAFVTLLQKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0193196_1032955313300019007MarineSKGLSIFACDAQDVFADVVVEVGPGLSTISVVDTENDFHFAKRKETGAWVNTGMFTQVWKAIASGSKYQSADWVVKVDADAVFVPSRLATKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSSAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKV
Ga0193196_1034209013300019007MarineIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193196_1037375813300019007MarineKGLSIFACDAQDVFADVEVEVGPGLSTIRVLDADNDFHFAKRKESGAWVNTGMFTQVWRAIAIGGKYQSADWVVKADADAVFVPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNNAFVTLIQKIDDCKADAQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTP
Ga0193196_1038535123300019007MarineIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYQATTAAFGA
Ga0193196_1042583113300019007MarineMGMFSQVWKAIGQTNKIPSSDWVLKADADAVFVPSRLRTWLTGKLVPDNGEYLENCRFVDYGYFGNLEIFSRAAFEILLNNIDSCKSKLDWKKGIKNGKYGPMGEDLFAQKCLDSDGVRRVEAFDITTDGACPADRPAGQEKNKKWKPNCAEVSTPAMHPFKKLDEWIACHDAAIGAFGPQGE
Ga0193196_1046138913300019007MarineIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTSAFGA
Ga0193196_1046893813300019007MarineCKFVQYGYFGNLEVFSKAAFDTLLANIDACKKDPQINWKVGVQGGKYGPMGEDLFAQTCLDLRGVRRVEAFDITTDGACPADRPVDQKNNKKWKPNCGEVSTPAMHPFKKLDEWIQCHGATVAAFGK
Ga0193196_1048550213300019007MarineTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIASRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKW
Ga0193044_1007834513300019010MarineCFTTKPGMARCLKNCTPSAHQSCTQPQGMMDPILQDAQPVGQSMYCFSVYTKDTGSTKQSHELEILQHQKQQQLGIFQCEYSDVFSDVSVEVGQGMMTKVVTDVEGDWHFAKRKVTGTWVNTGMFSQIWKQISADGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWQPNCASATTPAMHPFKKTEEWKQCYEATTSAFGA
Ga0193044_1009244413300019010MarineMGAVPVGQKMYCFAVYTENTGSTKQSHELEILQHQYSEKLGIFQCEESDVFSDVGVEYGSGVMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQACLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTSAFGA
Ga0193044_1011627323300019010MarineDVFADVDVEVGPGLRTIQVSDVEGDFHLAKRKISGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWEATTAAFGK
Ga0193044_1011869913300019010MarineDVFADVDVEVGPGLRTIQVSDVEGDFHLAKRKISGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193044_1014876713300019010MarineDAVFVPSRLSKKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSSAAFSTLVDKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0193044_1015921013300019010MarineLRMWLSRQMVPDNGIYLEDCKFVDYGYFGNLEVFSRVAFEILLENIDVCKASTEINWKLGVKNGKYGPMGEDLFAQACLDLKGVRRVEAFDITTDGACPADRPEGQKESKKWQPNCAETSTAAMHPFKKKADWVNCHAATVAAFGK
Ga0193044_1019598813300019010MarineIPNRLRSWLSRQLVPDAGIYLENCKFVDYGYFGNLEVFSKAAFVTLLANIDECKASTEMNWKVGVEDGKYGPMGEDLFAQTCLDEKGVRRVEAFDITTDGACPADRPQNQRKNKHWKPDCAKTATAAMHPFKDKDAWFQCWDATVAAFGQ
Ga0193044_1021754713300019010MarineHGKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193044_1022957113300019010MarineHFAKRKVSGSWVNTGLFSQVWKKITKHVYTDWTVKVDADAVFIPNRLRSWLGGQLVPYNGIYLENCKFVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATIDAFGD
Ga0193044_1023011713300019010MarineHGKIAEAGEYQKADWVMKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193044_1023600813300019010MarineHGKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTSAFGA
Ga0192926_1025937213300019011MarineAVFFPSRLTKKLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPDIHWKVGVQNGKYGPMGEDLFAQTCLDMLGVRRVEAFDITTDGACPAHRPVDQKTNKKWQPNCVKASTAAMHPFKKEAEWFECFEATTAAFGS
Ga0192926_1030192513300019011MarineNGIYLENCKYVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0192926_1036439913300019011MarineMGFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS
Ga0192926_1042242513300019011MarineTWDGYFGNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0193043_1017557613300019012MarineQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFVTLLANIDMCKASTEINWKVGIKNGKYGPMGEDLFAQTCLDLKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCGETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193043_1018763523300019012MarineMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEA
Ga0193043_1020154913300019012MarineWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSNKLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSSAAFSTLVDKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0193043_1025079013300019012MarinePANGIYLENCKFVDYGYFGNLEVFSQAAFKTLLANIDMCKASTEINWKVGVKNGKYGPMGEDLFAQACLDLKGVRRVEAFDITTDGACPADRPQDQQKNRLWKPDCAVTSTAAMHPFKKLDEWLQCWQATTDAFGQ
Ga0193043_1026882713300019012MarineFGNLEVFSQAAFQTLLANIDVCKASMEINWKLGVKNGKYGPMGEDLFAQACLDLKGVRRVEAFDITTDGACPADRPEDQKENKKWQPNCAETSTAAMHPFKKKDAWFKCWEDTVAAFGQ
Ga0193043_1030768213300019012MarinePANGIYLENCKFVDYGYFGNLEVFSQAAFKTLLANIDMCKASTEINWKVGVKNGKYGPMGEDLFAQACLDLKGVRRVEAFDITTDGACPADRPQDQQKNRLWKPDCAVTSTAAMHPFKNLDEWLQCWQATTDAFGQ
Ga0193043_1033830613300019012MarineKITKHVYTDWVAKVDADAVFIPSRLRSWLAGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDSCKASQEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193043_1035882313300019012MarineDWVAKVDADAVFVPSRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDSCKASQEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193569_1020659913300019017MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193569_1021436913300019017MarineMMTIAVQDTEGDFHIAKRKTSGAWINTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0193569_1023473613300019017MarineHLAKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193569_1032969013300019017MarineAWINTGMFTQIWKKAQKHQSVEWVMKVDADAVFIPNRLRPWLSGQLVPDSGIYLENCKFVEYGYFGNLEVFSKAAFLTLLASIDECKASPEINWKLGVHEGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDQKENKKWKPNCAETSTASMHPFKKKEEWFQCWEATVAAFGQ
Ga0193555_1014027013300019019MarineYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYQATTAAFGA
Ga0193555_1014484013300019019MarineYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193555_1014910213300019019MarineYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193555_1015032223300019019MarineYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAAAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193555_1015696013300019019MarineYSAVFSDVSVEVGGGMMTTVVTDEEGDWHFAKRKTSGTWINTGMFTQIWKKIAETGEYQNADWVLKLDADAIFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPSDRPKEEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193555_1015841913300019019MarineKDTGGWVNTGIFTQVWKAIASGRKASSADWVVKVDADAVFVPSRLRQKLGAQMVPPSGVYLENCKYVEYGYFGNLEVFSQAAWSTLVAKIDVCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHDATVNAFGS
Ga0193555_1017296413300019019MarineMTTVVTDVEGDWHFAKRKISGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPSDRPKEEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193538_1023828613300019020MarineNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASSEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0192982_1004815313300019021MarineHGSHELEILQYQHANNLGMFTCDQYDVFSDVHVEVGPGLSTIQVHDVEGDWHFAKRKVSGAWVNTGMFTQVWKAVAQDGKFWKAAWTAKVDADAVFVPSRLRTWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKNGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCAKASTAAMHPFKKKEEWISCHEATVDAFGK
Ga0192982_1006856313300019021MarineHGSHELEILQYQHSNNLGMFTCDQYDVFSDVHVEVGPGLSTIQVHDVEGDWHFAKRKVSGAWVNTGMFTQVWKAVAQDGKFWKAAWTAKVDADAVFVPSRLRTWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKNGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCAKASTAAMHPFKKKEEWISCHEATVDAFGK
Ga0192951_1014693213300019022MarineVYTKDTGSTKTSHELDILKHQHAQHLGIFQCDYSDVFSDVSVEVGSGYMTTVVTDVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQSADWVMKLDADAIFVPNRMRVWLKQNELVPPAGIYLENCKHVDYGYFGNLEVFSREAFSTLIKNIDTCKQTLDWKVGVKDGKYGPMGEDLFAQSCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYEATTAAFGA
Ga0193535_1013432513300019024MarineADVDVEVGSDLRTIKVDDVEGDFHWAKRKVSGSWVNTGMFTQVWKKITKHNSADWVAKVDGDAVFIPNRLRGWLQSQRVPDEGIYLENCKYVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQKCLGMLGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0192875_1014468813300019035MarineKLDADAIFVPNRMRVWLKQHALVPPAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192945_1022800613300019036MarinePPAGIYLENCKHVDYGYFGNLEVFSREAFSTLIKNIDTCKQTLDWKVGVKDGKYGPMGEDLFAQSCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYEATTAAFGA
Ga0192886_1010368813300019037MarineMGQSVEWVMKVDADAVFIPNRLRPWLSGQLVPDSGIYLENCKFVEYGYFGNLEVFSKAAFLTLLASIDECKASPEINWKLGVHEGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDQKENKKWKPNCAETATAAMHPFKKKDEWFQCWEATVNAFGQ
Ga0193123_1014360613300019039MarineTIMVTDVEGDFHFAKRKNSGAWVNTGMFKQVWKAIGSGDKYKTASWVVKVDVDAVFLPSRLTKKLESQMVPATGIYLENCKFVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0193123_1036663913300019039MarineGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFTQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCY
Ga0192857_1005152213300019040MarineVWKAIASGSKWQFVDWVVKVDADAVFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0192857_1005401913300019040MarineKISIFDCEQYDVFADVDVEVGSDLRTIKVDDAEGDFHWAKRKVSGSWVNTGMFTQVWKKITKHNSADWVAKVDGDAVFIPNRLRGWLQSQMVPDEGIYLENCKFVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQCWDATTAAFGK
Ga0192857_1006733013300019040MarineMGGLDLRTITVDDVEGDFHWAKRKVSGTWVNTGIFTQIWKKITKHNSADWVAKVDADAVFIPNRLRVWLQSQRVPEEGIYLENCKFVDYGYFGNLEVFSQAAFKTLIANIDMCKASAEINWKVGIKNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQRNNKKWKPNCAETSTAAMHPFKIKDEWFQCWEATTAAFGK
Ga0192857_1007752413300019040MarineMFKQVWKAIGSGDKYKTASWVVKVDVDAVFLPSRLTKKLESQMVPANGYLENCKYVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0192857_1008131713300019040MarineVSDTENDFHFAKRKETGAWVNTGLFSQVWKAIASGSKWQFVDWVVKVDADAVFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0192857_1009393813300019040MarineGDKYKTASWVVKVDVDAVFLPSRLVKMLQSQMVPSSGIYLENCKYVDYGYFCNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPANRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0192857_1009790713300019040MarineMFTQVWKAIASGRKYQSADWVVKVDADAVFVPSRLSKKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSSAAFKTLTEKIDICKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWASCHDATMGAFGS
Ga0192857_1010286113300019040MarineMFTQVWKAIASGRKYQSADWVVKVDADAVFVPSRLSKKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSSAAFKTLTEKIDICKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWAGCHDATMGAFGS
Ga0192857_1011427013300019040MarineNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0192857_1012065313300019040MarineDWVAKVDADAVFIPNRLRGWLQSQRVPDEGIYLENCKYVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQCWDATTAAFGK
Ga0192857_1012864513300019040MarineNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGY
Ga0192857_1014378313300019040MarineKRKVSGAWVNTGMFTQVWKKITKHVYTDWTAKVDVDAVFIPNRLRSWLGGQLVPSHGIYLENCKYVDYGYFGNLEVFSKAAFMTLLANIDLCKASTEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFSITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWQATVDAFGGQ
Ga0192857_1015728913300019040MarineGLFSQVWKAIASGSKWQFVDWVVKVDADAVFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFG
Ga0192857_1016061013300019040MarineNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCGETSTAAMHPFKKKDEWFQCWEETVAAFGH
Ga0192857_1023064613300019040MarineQSCRMPPSSPLLCIASLLYLENCKYVKFGYFGNLEVSSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192857_1025671413300019040MarineHIAKRKTSGTWINTGMFTQIWKKITKHVYADWVAKVDADAVFVPSRLRTWLSSQLVPSNGVYLENCKYVDYGYFGNLEVFSKAAFMTLVANIDLCKASSEINWKVGVKNGKFGPMGEDLFAQTCLDLKGVRRIEAFDITTDGACPADRPQDQQKNKKWKPNCAWTSTAAMHPFKKTDEWLNCYDATIAAFPEQ
Ga0192857_1031353213300019040MarineMGGLDLRTITVDDVEGDFHWAKRKVSGTWVNTGIFTQIWKKITKHNSADWVAKVDADAVFIPNRLRVWLQSQRVPEEGIYLENCKFVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKP
Ga0192857_1031783523300019040MarineAGIYLENCKYVQYGYFGNLEVFSTAAFNTLLANMDTCKQDPKINWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRVEAFDITTDGACPADRPEDQKKNKKWKPNCAYVSTAAMHPFKKVEEWAACHAATVAAFGK
Ga0193082_1039946813300019049MarineDWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEHKNKKWKPTCAWTATSAMHPFKKLKDWAACHEATMDAFGLTLS
Ga0192966_1016085223300019050MarineVGQGLMTKTVTDVEGDWHFAKRKVSGTWVNTGMFSQIWKQISTDGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA
Ga0193356_1009206313300019053MarineQYAYSKNIHIFACDSYDVFSDVPASVGDGLVASVLTDTEADWHFAKRKSTGAWVNTGMFTSVWKAIAQGGKYQSADWVAKVDGDAVFIPNRLKRWVAGQMVPDSGIYLENCKYVQYGYFGNLEVFSKAAWQTLLTNTDMCKSELNWKVGVQNGKYGPMGEDLFAQTCLDKMGVRRVEAFDITTDGACPADRPEDEKKNKKWKPTCGSVSTAAIHPFKNTDDFINCHWATVNAFGN
Ga0193356_1010369913300019053MarineTQVWKKTYKHQYADWVAKVDADAVFIPNRLRTWLSRQLVPYNGIYLENCKFVEYGYFGNLEVFSKAAFVTLLANIDQCKASPEINWKLGVHEGKFGPMGEDLFAQTCLDTKGVRRVEAFDITTDGACPADRPQDQKENKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193356_1010947913300019053MarineFADVDVEVGPELRTIQVDDVEGDFHWAKRKVSGSWVNTGMFTQVWKKITKHVSADWVAKVDGDAVFIPNRLRSWLSGQMVPENGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQACLDLKGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKIKDEWFQCWEATVAAFGQ
Ga0193356_1012504713300019053MarineIGVFACDQAEVFSDVEADLGPGAKTIVVQDTDGDFHFAKRKISGSWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTPAMHPFKKLDEWVQCHEATVAAFGK
Ga0193356_1013390213300019053MarineTQVWKKTYKHQYADWVAKVDADAVFIPNRLRTWLSRQLVPYNGIYLENCKFVEYGYFGNLEVFSKAAFVTLLANIDECKASPEINWKVGVDDGKYGPMGEDLFAQACLDTKGVRRVEAFDITTDGACPADRPQDQKENKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193356_1014287313300019053MarineHSDVFSDVEVEVGQGLKTTMGEDTEGDFHFAKRKVSGAWVNTGMFTQVWKAVGASGKYRQADWVAKVDADAVFIPSRLVRWVQAQRVPDNGIYLENCKFVEYGYFGNLEVFSRVAFDTLLENLDACKKSPEINWKVGVKNGKYGPMGEDLFAQTCLDLHGVRRVEAFDITTDGACPADRPLDQKTNKKWKPNCAWVSTPAMHPFKKTQEWLQCHEATVAAFGA
Ga0193356_1015208713300019053MarineMFSSVWKAIEQGGKWQSADWIAKVDGDAVFIPNRLRQWVGKQLVPDNGIYLENCKFVQYGYFGNLEVFSKAAFQTLLNNIDMCKSTLNWKLGVQGGKYGPMGEDLFAQTCLDKVGIRRVNAFDITTDGACPGDRPVGEEHNKKWQPNCGEASTAAMHPFKKPEEFQACYWATVNAFGQ
Ga0193356_1017861113300019053MarineDWVVKVDADAVFIPSRLSEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLTDKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATVAAFGS
Ga0193356_1019914313300019053MarineVVHDTEGDFHFAKRKTSGAWVNTGMFTKIWKAVEASGKFRSADWVAKVDVDAVFVPTRLVRWLQGQRVPSNGVYLENCKFVQYGYFGNLEVFSKAAFSTLLANMDACKTDPQINWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDISTDGACPADRPVDQKKNKKWKPNCAYVSTPAMHPFKKLDEWVQCHEATVAAFGK
Ga0193356_1022664213300019053MarineAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFATLTEKVDDCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDKWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVSAFGS
Ga0193356_1023030813300019053MarineGGKFRSADWVAKVDADAVFVPNRLVRWLQQQRVPDNGIYLENCKFVQYGYFGNLEVFSKAAFNTLLANLDACKQDPQSNWKLGVQGGKYGPMGEDLFAQACLDVHGVRRIEAFDITTDGACPADRPMDQKENKKWKPNCAEVSTAAMHPFKKLDDWVKCHEATVATFGK
Ga0193356_1024026813300019053MarineSQLVPQAGIYLENCKYVDYGYFGNLEVFSKDAFMTLIENIDMCKASPEINWKVGIKNGKYGPMGEDLFAQACLDMKGIRRVEAFDITTDGACPADRPIEQQNNKKWKPNCAETSTAAMHPFKKKDEWFACWDATVAAFGQ
Ga0193356_1025267913300019053MarineGTWVNTGMFTQIWKKMGEMGKYQSADWVMKVDADAIFVPSRMRTWLFANRLVPPAGIYLENCKYVDYGYFGNLEVYSKAAFSTLIQNIDVCRSSINWKLGVKNGKYGPMGEDLFAQTCLDSKGIRRKEAFDITTDGACPADRPEGEKENKKWKPNCASTSTPAMHPFKKTQEWRECYQATTNAFGA
Ga0193356_1028894213300019053MarineENCPYVQYGYFGNLEVFSKVAFDTLLANVDACKQDPEINWKLGVEGGKYGPMGEDLFAQACLDRRGVRRVEAFDITTDGACPADRPAEQKENKKWKPNCAEVSTPAMHPFKKTQEWEQCHDATVNAFGK
Ga0193356_1030961013300019053MarineLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPADRPKDEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193356_1031653213300019053MarineLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAYGA
Ga0193356_1033744523300019053MarineLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTSAFGA
Ga0193356_1034411313300019053MarineLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193356_1034411813300019053MarineLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAAAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193356_1035359313300019053MarineVYLENCKYVDYGYFGNLEVFSKAAFVTLLANVDECKASPDINWKVGIKNGKFGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDQQKNKKWKPNCAWTNTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193356_1035507013300019053MarinePGLVTIKVEDEEQDFHFAKRKETGAWVNTGMFTQVWKAIASGGKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKFVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDMTTDGACPADRPVDQ
Ga0192992_1011674513300019054MarineMTNVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPAGVYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192992_1017498913300019054MarineASGKFRSADWVAKVDADAVFVPTRLVRWLQGQRVPSNGVYLENCKYVQYGYFGNLEVFSKAAFNTLLANIDSCKSDPQVNWKVGVQGGKYGPMGEDLFAQTCLDVHGVRRIEAFDITTDGACPADRPVDEKKNKKWKPNCAEVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192992_1019099513300019054MarineHGAEAGEYQKVDWVMKVDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKGEKKNKKWKPNCAYAATPAMHPFKKKTQEWIQCYEATTAAFGA
Ga0193208_1031533913300019055MarineVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKISGTWVNTGMFTQIWKKIAEAGEYQEADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193208_1032058213300019055MarineVWKAVASSGKYHSAGWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSQAAFSTLVEKIDSCKADSQINWKVGVKNGKYGPMGEDLFAQTCLDRWGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDETVSAFGS
Ga0193208_1037787313300019055MarineWVVKVDADAVFVPNRLRPKLGAQLVPPSGIYLENCKFVEYGYFGNLEIFSKAAWDTLIVKIDDCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIGQEKNKKWKPNCAETDTPAMHPFKKVADWIQCHDATVNAFGS
Ga0193208_1041548013300019055MarineCKFVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0193208_1043734723300019055MarineHGVGEYQNADWVLKLDADAIFIANRMKVWLKHNEFVPPPGIYLENCKYVDYGYFGNLEVYSKQAFSTLLQNIDSCKRTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTSAFGA
Ga0193208_1047567013300019055MarineIASRMRVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCASVATPAMHPFKKTEEWIQCYEATTSAFGA
Ga0193208_1065898513300019055MarineWLSTQLVPETGVYLENCRFVDYGYFGNLEVFSAAAFRVLLQNIDTCKESLNWKVGIKNGKYGPMGEDLFAQACLDKVGIRRIEAFDITTDGACPADRPEAEKKNKKWKPNCAWVSTPAMHPFKKTEEWIQCYEATTKAFGA
Ga0193485_10141413300019070MarineLQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGVMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193129_101470313300019088MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQACLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWVATPAM
Ga0193129_101742913300019088MarineGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192935_100873313300019091MarineMGTDAENDFHFAKRKETGAWVNTGLFTQVWKAIASGGKYQSADWVAKVDADAVFIPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIANIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATTGAFGS
Ga0192935_100879413300019091MarineQTIKVEDADNDWHFAKRKETGAWINTGMFTQVWKAIASGGKASSADWVAKVDADAVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0192935_101010813300019091MarineTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDSCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0192935_101443213300019091MarineRLATKLQSQLVPPRGIYLENCKFVDYGYFGNLEVFSRAAFDTLIDKIDECKADSEINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPICASTATPAMHPFKKVADWIACHDATVAAFGS
Ga0192935_101803613300019091MarineLENCRYVEYGYFGNLEVFSNNAFVTLIQKIDNCKADTQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWVKCHDETTGAFGS
Ga0193040_100514623300019094MarineWTVKVDADAVFIPNRLRSWLGGQLVPYNGIYLENCKFVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATIDAFGDR
Ga0193040_100599513300019094MarineSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEVEWFECFEATTAAFGY
Ga0193040_100903213300019094MarineRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193040_100938813300019094MarineMGVEYCYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193040_100955813300019094MarineTWAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0193040_101282113300019094MarineTWAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0193102_101735813300019099MarinePSGVYLENCKYVDYGYFGNLEVFSKAAFVTLTEKIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKWGVRRVEAFDITTDGACPADRPVDQQKNKKWTPTCAATATPAMHPFKKVADWIKCHDATIAAFGS
Ga0193045_103492513300019100MarineVNTGMFKQVWKAIGSGDKYKTASWVVKVDVDAVFLPSRLTKKLESQMVPANGIYLENCKYVNYGYFGNLEVFSQAAFTTLLKNIDACNVSPKLNWKIGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0193045_104439813300019100MarineKRKVSGTWVNTGMFTQIWKKIAEGNKYQNADWVMKLDADAIFVPNRMRVWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0193045_105190113300019100MarineVYLENCKYVEYGYFGNLEVFSKAAWNTLIEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193045_105264513300019100MarineFGDVEVEVGAGLKTTMVTDVDGDFHFAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDSCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPANRPLDQKTNKKWQPNCGKASTAAMHPFKKEVEWFECFEATTAAF
Ga0193045_105399923300019100MarineLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0192946_102462023300019103MarineSTKQSHELEILQHQHQQQLGIFQCEYSDVFSDVSVQVGQGLMTKVVTDQEGDWHFAKRKVSGTWVNTGMFSQIWKQISTDGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLDWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA
Ga0192972_103911313300019108MarineGVEYGSGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVEDGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWKQCYEATTSAFGA
Ga0193541_103003113300019111MarineGLKTTMVTDVDGDFHFAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0193541_104507913300019111MarineVVKVDVDAVFLPSRLTKKLESQMVPATGIYLENCKFVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0193541_106915513300019111MarineDWVAKVDVDAVFVPTRLVRWLQGQRVPSNGVYLENCKFVQYGYFGNLEVFSKAAFSTLLANMDACKTDPQINWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRIEAFDISTDGACPADRPVDQKKNKKWKPNCAYVSTPAMHPFKKLDEWVQCHEATVAAFGK
Ga0193106_101724813300019112MarineTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193106_104336313300019112MarineNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193443_101398613300019115MarineHWAKRKVSGSWVNTGLFTQVWKKITKHVYTDWTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDMCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0193443_102919413300019115MarineIPNRLRPWLSGQLVPDTGIYLENCKFVEYGYFGNLEVFSKAAFLTLLASIDECKASPEINWKLGVHEGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDQKENKKWKPNCAETATAAMHPFKKKDEWFQCWEATVNAFGQ
Ga0192885_104657913300019119MarineDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASVATPAMHPFKKTQEWIQCYE
Ga0193256_103047013300019120MarineGSTKTSHELDILKHQHAQHLGIFQCDYSDVFSDVSVEVGSGYMTTVVTDVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQSADWVMKLDADAIFVPNRMRVWLKQNELVPPAGIYLENCKHVDYGYFGNLEVFSREAFSTLIKNIDTCKQTLDWKVGVKDGKYGPMGEDLFAQSCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYEATTAAFGA
Ga0193256_103366713300019120MarineAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTAAFGA
Ga0193256_103653513300019120MarineSCTQPQGIMDPILQDAVPVGQKMYCFALYTENTGSTKQSHELEILQHQHSQQLGIFQCDYSDVFSDVSVEVGNGQMTTVVTDVEGDWHFAKRKVSGTWVNTGIFTQIWKKIAEGGKYQSADWVLKLDADAIFVPNRMRVWLKQHALVPPAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAA
Ga0193256_105287213300019120MarineNTGMFTQIWKKIAEGVKYQNADWVMKLDADAIFVPSRMKVWLKQNELVPPAGVYLENCKYVDYGYFGNFEVYSREAFTTLIRNIDTCKQTLNWKVGVENGKWGPMGEDLFAQKCLDSVGVRRKEALDITTDGACPGDRPVAEKNNKKWKPNCASAATPAMHPFKKTDEWIKCYDATTAAFGA
Ga0193104_102171613300019125MarineHFAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSGGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEVEWFECFEATTAAFGY
Ga0193144_101244413300019126MarineGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTSAFGA
Ga0193144_101349613300019126MarineGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKLGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193144_101473613300019126MarineGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKADCAYAATPAPLQEDTGVYPVL
Ga0193144_102285713300019126MarineGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPDCAYAATPAMHPFKKTQEWIQCYEATTATFGA
Ga0193144_103077313300019126MarineVFADVDVEVGPGLRTIQVSDVEGDFHLAKRKISGTWINTGMFTQIWKKITKHVYTDWVAKVDADAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193144_103193413300019126MarineGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCASAATP
Ga0193144_104151713300019126MarineDVDAVFLPSRLTKKLESQMVPATGIYLENCKFVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0193144_107697313300019126MarineMGEQYARKISIFDCEQYDVFADVDVEVGSDLRTIKVDDVEGDFHWAKRKVSGSWVNTGMFTQVWKKITKHNSADWVAKVDGDAVFIPNRLRGWLQSQMVPNEGIYLENCKYVDYGYFGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQKCLGLLGVRRVEAFDITTDGACPADRPQDQHDNK
Ga0193249_107181313300019131MarineRQPGSVQQGRFCDTPCKYVDYGYFGNLEVFSKAAFVTLLANIDMCKASTEINWKVGIKNGKYGPMGEDLFAQTCLDLKGVRRVEAFDITTDGACPADRPEDEKKNKKWQPKCGETSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0193089_107347023300019133MarineQGLMTKVVTDQEGDWHFAKRKVSGTWVNTGMFSQIWKQISADGKYQNADWVLKVDADAIFVPNRMRAWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLNWKVGIKEGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA
Ga0193089_107936813300019133MarineVGNGQMTTVVTDVEGDWHFAKRKVSGTWVNTGIFTQIWKKIAEGGKYQSADWVLKLDADAIFVPNRMRVWLKQHALVPPAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193089_108478513300019133MarineTDVEGDWHFAKRKVSGTWVNTGIFTQIWKKIAEGGKYQSADWVLKLDADAIFVPNRMRVWLKQHALVPPAGIYLENCKNVDFGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193089_109472013300019133MarineMGTGMFTQIWKKIAEGNKYQNADWVMKLDADAIFVPNRMRVWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0193515_103472013300019134MarineYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGVMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193515_104807613300019134MarineASSADWVAKVDADAVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLVEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193515_104832913300019134MarineKVDDVEGDFHFAKRKDTGSWVNTGLFSQVWKKMYKHQSTAWVAKVDGDAVFIPNRLRSWLSRQLVPDAGIYLENCKFVDYGYFGNLEVFSKAAFVTLLANIDECKASTEMNWKVGVEDGKYGPMGEDLFAQTCLDEKGVRRVEAFDITTDGACPADRPQNQRKNKHWKPDCAKTATAAMHPFKDKDAWFQCWDATVAAFGQ
Ga0193515_104971813300019134MarineVFIPNRLRPWLSGQLVPDSGIYLENCKFVEYGYFGNLEVFSKAAFLTLLASIDECKASPEINWKLGVHEGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDQKENKKWKPNCAETATAAMHPFKKKDEWFQCWEATVNAFGQ
Ga0193515_105150313300019134MarineHFAKRKDTGSWVNTGLFSQVWKKMYKHQSTAWVAKVDGDAVFIPNRLRSWLSRQLVPDAGIYLENCKFVDYGYFGNLEVFSKAAFVTLLANIDECKASTEMNWKVGVEDGKYGPMGEDLFAQTCLDEKGVRRVEAFDITTDGACPADRPQNQRKNKHWKPDCAKTATAAMHPFKDKDAWFQCWDATVAAFGQ
Ga0193515_105184813300019134MarineMGENCKYVDYGYFGNLEVFSRQAFSTLISNIDTCKQTTNWKLGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPGDRPEAEKKNKKWKPDCASAATPAMHPFKKLGEWQACYDATQQAFGS
Ga0193112_104748813300019136MarineILQDAVEVGQKMYCFALYTENTGSTKQSHELEILQHQHSQHLGIFQCDYSDVFSDVSVEIGSGQMTTVVTDVEGDWHFAKRKVSGTWVNTGIFTQIWKKIAEGGKYQNADWVLKLDADAVFVPNRMRVWLKQHALVPPAGIYLENCKHVDYGYFGNLEVFSREAFSTLIKNIDTCKQTLNWKVGIKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPADRPKAEEKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193112_106236213300019136MarineMGKRKETGAWVNTGMFTQVWKAIASGGKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKVDSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDITTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0193112_114107713300019136MarineYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0193047_103547113300019139MarineVFADVAVEVGPGLVTTKVEDAEQDFHFAKRKETGAWVNTGMFTQVWKAIASGGKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDMTTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0192856_102012313300019143MarineDVEADLGAGAKTIVVHDSEGDFHFAKRKTTGAWVNTGMFTKIWKAIEASGKFRSADWIAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0192856_102016013300019143MarineVQYSQNIGVFACDQAEVFSDVEADLGSGAKTIVVHDTEGDFHFAKRKTSGAWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPETGIYLENCKFVKYGYFGNLEVFSKAAFNTLLANMDACKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKNVRRVEAFDITTDGACPADRPKDEKNNKKWKPNCAWVSTPAMHPFKKLDEWVQCHEATVAAFGK
Ga0192856_102752213300019143MarineLQTIKMVDTDNDFHFAKRIDTGGWVNTGLFSQVWKAIARGGKTSKADWVAKVDADAVFVPNRLRQKLQSQLVPPNGVYLENCKYVDYGYFGNLEVFSSAAFSTLVDKIDVCKADSEINWKVGVKKGKYGPMGEDLFAQVCLDKFGVRRIEAFGITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATTAAFGS
Ga0192856_103775513300019143MarineADAVFVPSRLTKKLESQLVPPSGIYLENCKFVEYDYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0192856_104355413300019143MarineMGVAKVDADAVFIPSRLRSWLAGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDSCKSSQEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0192856_104391813300019143MarineGGNLEVFSQVAFKTLIANIDMCKASAEVHWKVGIQNGKYGPMGEDLFAQRCLGMLGVRRVEAFDITTDGACPADRPQDQQNNKKWKPNCAETSTAAMHPFKKKDEWFQCWDATTAAFGK
Ga0192856_105264113300019143MarineHGKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0192856_105275013300019143MarineNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEVNWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWDATVAAFGQ
Ga0192856_105295113300019143MarineNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEVNWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0192856_105787513300019143MarineMGNDFHFAKRKGTGAWVNTGMFTQVWKAIASGGKYQSADWVVKVDADAVFVPSRLAQKLGSQLVPPSGIYLENCKYVEYGYFGNLEVFSSAAFITLIEKIDVCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDEQKNKKWTPTCAWTATPAMHPFKKVAE
Ga0192856_105939713300019143MarineNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEVNWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDEQKNKKWKPNCAWTSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0192856_106175113300019143MarineIYLENCKFVEYGYFGNLEVFSQAAWSTLVANIDVCKADSQINWKVGVQDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATSAMHPFKKVADWIQCHADTVNAFGS
Ga0192856_106976913300019143MarineYVQYGYFGNLEVFSTAAFNTLLANMDTCKQDPKINWKVGVQGGKYGPMGEDLFAQTCLDLHGVRRVEAFDITTDGSCPADRPEDQKKNKKWKPNCAYVSTAAMHPFKKVEEWAACHAATVAAFGK
Ga0192856_107136713300019143MarineIYLENCKFVEYGYFGNLEVFSQAAWSTLVANIDVCKADSQINWKVGVQDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATVGAFGS
Ga0193246_1015792513300019144MarineYSKGLSVFACDAQDVFADVDVEVGQGLRTIKVTDTENDFHFAKRKETGAWVNTGLFSQVWKAIASGSKWQSADWVIKVDADAVFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0194244_1001838413300019150MarineVGYNCFTTKPGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEAT
Ga0194244_1010600213300019150MarineGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSQEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPANRPLDQKTNKKWQPNCGEASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0192888_1012048613300019151MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192888_1012049613300019151MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKHNGLVPAPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192888_1012260913300019151MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192888_1012739613300019151MarineLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMKVWLKHNGLVPAPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPGVRPKEEKKNKKWKPNCASVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192888_1013289413300019151MarineWVMKVDADAVFIPNRLRTWLSRQLVPDNGIYLENCKFVDYGWFGNLEVFSKAAFATLLANIDECKASPEINWKLGVKEGKYGPMGEDLFAQTCLDLKGVRRVEAFDTTTDGACPADRPQDQKENKKWKPNCAETATAAMHPFKKKDEWFQCWEATVNAFGQ
Ga0192888_1013377613300019151MarineADVDVEVGPGLRTIQVDDVEGDFHLAKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDTTTDGACPADRPHDEQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGH
Ga0192888_1013705613300019151MarineQGIMDNILQDAVPVGQSMYCFSVYTQNTGSTKPSHELEILQHQYSQHLGIFQCEYSDVFSDVSVQLGDGTMTTAVTDVEGDFHFAKRKISGTWVNTGMYMQIWKKIAEGNKYQNADWVMKLDADAVFVPNRMKVWLKKNELVPPSGIYLENCKYVDYGYFGNLEVYSREAFSTLLRNIDTCKQTTNWKLGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPESEKKNKKWKPNCASAATPAMHPFKKTQEWI
Ga0192888_1014444213300019151MarineFSDISVEVGGGVMTKVVTDAEGDWHFAKRKVSGAWVNTGMFTQVWKKISEGNKYQNADWVMKLDADAIFVPSRMKVWLKENELVPRNGIYLENCKYVDFGYFGNLEVYSQVAFATLIANIDTCKQSINWKLGVKNGKYGPMGEDLFAQRCLDSVGVRRKEAFDITTDGACPADRPVEEKENKKWKPNCASTATPAMHPFKKKQDWIKCYDETTAAFGA
Ga0192888_1015973913300019151MarineYLENCKYVDYGYFGNLEVFSRQAFSTLISNIDTCKQTTNWKLGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPGDRPEAEKKNKKWKPDCASAATPAMHPFKKLGEWQACYEKTQAAFGS
Ga0192888_1017395413300019151MarineLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193564_1014423913300019152MarineDADAVFVPSRLATKLQSQLVPPGGIYLENCKYVEYGYFGNLEVFSKAAWNTLIEKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0193564_1022499113300019152MarineQNELVPPTGIYLENCKYVDYGYFGNLEVYSREAFSTLISNIETCKQTTNWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPEQEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0192975_1023813113300019153MarineYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS
Ga0180037_100105513300019214EstuarineLQHQHQQQLGIFQCEYSDVFSDVSVQVGQGLMTKVVTDQEGDWHFAKRKVSGTWVNTGMFSQIWKQISADGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIENIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKPEEWKQCYEATTAAFGA
Ga0210296_110207913300021305EstuarineVEVEVGPGLQTIKVVDAENDWHFAKRKETGAWVNTGMFTQVWKAIASGGKASSADWVVKVDADAVFVPSRLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWSTLIDKIDDCKADSQINWKVGIHDGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKDKKWKPTCAWTATAAMHPFKKVADWIECHDATMDAFGS
Ga0210309_108680513300021317EstuarineWKQISADGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIENIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA
Ga0210307_106105813300021336EstuarineGDWHFAKRKVSGTWVNTGMFSQIWKQISADGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIENIDSCKKTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTSAFGA
Ga0063140_10424713300021863MarineTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVA
Ga0063140_10459413300021863MarinePSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS
Ga0063110_10177013300021865MarineTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0063107_10120913300021869MarineVVGYNCFTTKPGQARCLKNCTPSASQSCTQPQGIMDSILQDAVPVGQKMYCFAVYTQNTGSTKQSHELDILKHQHSEHLGIFQCDYSDVFSDVSVEVGSGMMTTVVTDVEDDWHFAKRKLSGTWVNTGMFTQVWKKIAEGAKYQNADWVLKLDADAIFVPNRMKVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVYSREAFSTLIKNIDTCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEETKNKKWKPNCADAATPAMHPFKKTEEWIQCYEATTAAFGK
Ga0063113_10544913300021879MarineGMFTQIWKKAQKHQSVEWVMKVDADAVFIPNRLRPWLSGQLVPDSGIYLENCKFVEYGYFGNLEVFSKAAFLTLLASIDECKASPEINWKLGVHEGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDQKENKKWKPNCAETATAAMHPFKKKDEWFQCWEATVNAFGQ
Ga0063117_101019413300021881MarineSSADWVVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0063117_101163413300021881MarineGAWVNTGMFTQVWKAIASGGKTSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS
Ga0063115_100346813300021882MarineDFHFAKRKETGAWVNTGMFTQVWKAIASGGKHLSADWVAKVDADAVFVPSRLAKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDKIDDCKADSEINWKVGVKNGKYGAMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCASTATPAMHPFKKVADWIQCHDATMAAFGA
Ga0063114_103366013300021886MarineQTIKVVDTDNDFHFAKRKETGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSNKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFTTLVDKIDVCKADSHINWKVGVKNGKYGPMGEDLFAQACLDKFEVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0063089_104847313300021889MarineEILRYGYSNNIGMFTCDQYDVFSDAHVEVGPGLSTIQVHDVEGDWHFAKRKVSGAWVNTGMFTQVWKAVAQNGKFWKAAWTAKVDADAVFVPSRLRTWFRKQRVPDAGIYLENCKFVDYGYFGNLEVYSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHSERKNKKWKPNCAKASTAAMHPFKKLDEWISCHWATVDAFGK
Ga0063093_102453913300021891MarineGMFTQIWKKITKHAYTDWVAKVDADAVFIPNRLRSWLGEQLVPTNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPKDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0063093_104000513300021891MarineGMFSQIWKQISAEGNYQNADWVLKVDADAIFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLPWKVGIKNGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPADRPKEERKNSKWKPNCAWAATPAMHPFKKTEEWKQCYEATTSAFGA
Ga0063142_103872313300021893MarineFACEQSDVFSDVDVEVGPGLRTIKVDDVEGDFQFAKRKSTGAWINTGMFTQIWKKAQKHQSVEWVMKVDADAVFIPNRLRPWLSGQLVPDSGIYLENCKFVEYGYFGNLEVFSKAAFLTLLASIDECKASPEINWKLGVHEGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPQDQKENKKWKPNCAETATAAMHPFKKKDEWFQCWEATVNAFGQ
Ga0063142_106744713300021893MarineSGDKYKTASWVVKVDVDAVFLPSRLTKKLESQMVPATGIYLENCKFVNYGYFGNLEVFSQAAFTTLLANIDSCNVSPKLNWKVGVQNGKFGPMGEDLFAQTCLDELGVRRVEAFDITTDGACPANRPVDQKTNKKWKPDCAYVSTAAMHPFKKEAEWIKCFEATTAAFGS
Ga0063142_111823113300021893MarineTGMFTQVWKAVEASGKYRQADWVAKVDADAVFIPSRLARWVQAQRVPDSGIYLENCKFVEYGYFGNLEVFSRAAFDTLLANMDTCKSSPQINWKVGVKNGKYGPMGEDLFAQTCLDIHGVRRVEAFDITTDGACPADRPVDQKKNKKWKPNCAWVSTPAMHPFKKTEEWLQCHEATVAAFGA
Ga0063136_109157513300021896MarineAIASGGKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDMTTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0063097_100058913300021898MarineHQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKDTGSSKPSHELDILKHQHSQHLGIFQCEYSDVFSDVSVEVGSGTMTQVITDVEGDWHFAKRKLSGTWVNTGMFSQVWKKIAEGAKYQNADWVLKVDADAIFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVFSREAFSTLINNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEQKNKKWKPNCAQAATPAMHPFKKTEEWIQCYEATTAAFGA
Ga0063144_109913813300021899MarineQSHELEILQHQYSQHLGIFQCEQFDVFADVSVEVGSGYTTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQSADWVMKLDADAIFVPSRMKVWLKQNELVPPAGVYLENCKYVDYGYFGNFEVYSREAFTTLIRNIDTCKQTLNWKVGIENGKWGPMGEDLFAQTCLDSVGVRRKEALDITTDGACPGDRPIDEKNNKKW
Ga0063088_106720613300021905MarineREHLGIFQCDYSDVFSDVSVEVGPGTMTQVVTDVEGDWHFAKRKLSGTWVNTGMFSQIWKKISDAQRYQSADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEQKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTAA
Ga0063087_113307113300021906MarineKKISDAQRYQSADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEQKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTAAFG
Ga0063100_107973613300021910MarineQNTGSTKQSHELDILKHQHSEHLGIFQCDYSDVFSDVSVEVGSGMMTTVVTDVEDDWHFAKRKLSGTWVNTGMFTQVWKKIAEGAKYQNADWVLKLDADAIFVPNRMKVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVYSREAFSTLIKNIDTCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEETKNKKWKPNCADAATPAMHPFKKTEEWIQCYEATTAAFGK
Ga0063106_102810513300021911MarinePPAGIYLENCKYVDYGYFGNLEVYSREAFSTLIKNIDTCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEMKNKKWKPNCADAATPAMHPFKKTEEWIQCYEATTAAFGK
Ga0063133_103089413300021912MarineVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0063096_105532613300021925MarineKVSGAWVNTGMFTQVWKAVAQNGKFWKAAWTAKVDADAVFVPSRLRTWFRKQRVPDAGIYLENCKFVDYGYFGNLEVYSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHSERKNKKWKPNCAKASTAAMHPFKKLDEWISCHWATVDAFGK
Ga0063096_106147813300021925MarineGSTKQSHELEILQHQKQQQLGIFQCDYSDVFSDVSVEVGQGMMTKAVTDSEGDWHFAKRKVSGTWVNTGMFSQVWKQISAEGNYQNADWVLKVDADAIFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLNWKVGVKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPNCAWAATPAMHPFKKTEEWKQCYEATTAAFGA
Ga0063103_102851913300021927MarineGTMTQVITDVEGDWHFAKRKLSGTWVNTGMFSQVWKKIAEGAKYQNADWVLKVDADAIFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVFSREAFSTLINNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEE
Ga0063145_102344013300021930MarineDPILQDAQPVGQSMYCFSVYTKDTGSTKQSHELEILQHQKQQQLGIFQCEYSDVFSDVSVEVGQGMMTKVVTDVEGDWHFAKRKVTGTWVNTGMFSQIWKQISADGKYQNADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKSTLNWRTGVKDGKYGPMGEDLFAQKCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWQPNCASATTPAMHPFKKTEEWKQCYEATTSAFGA
Ga0063108_104421213300021940MarineAKRKVSGAWVNTGMFTQVWKAVAQNGKFWKAAWTAKVDADAVFVPSRLRTWFRKQRVPDAGIYLENCKFVDYGYFGNLEVYSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHAERKNKKWKPNCAKASTAAMHPFKKLDEWISCHWATVDAFGK
Ga0063102_100020613300021941MarineKLSGTWVNTGMFSQVWKKIAEGAKYQNADWVLKVDADAIFVPNRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVFSREAFSTLINNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEEKNKKWKPNCAQAATPAMHPFKKTEEWIQCYEATTAAFGA
Ga0063102_101886513300021941MarineMYCFSVYTQDTGSTKQSHELEILQHQHSQHLGIFQCDFSDVFSDVSVEVGSGMMTTVVTDVEGDWHFAKRKLSGTWVNTGMFTQIWKKISDDKRYQNADWVLKLDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVEYGYFGNLEVYSRQAFATLINNIDSCKRDLNWKVGVKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKTNNKWKPNCAGAATPAMHPFKKTEEWKQCYEATTASFGA
Ga0063102_105368513300021941MarinePPAGIYLENCKYVEYGYFGNLEVYSRQAFATLINNIDSCKRDLNWKVGVKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAGAATPAMHPFKKTEEWKQCYDATTASFGA
Ga0063101_100252113300021950MarineDAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSQQAFTTLIANIDSCKRDLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEEKNKKWKPNCAQAATPAMHPFKKTEEWIQCYEATTAAFGA
Ga0063101_107720413300021950MarineVSVEVGSGMMTTAVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQNTDWVMKLDADAIFIPSRMKAWLKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTTINWKLGVQNGKWGPMGEDLFAQACLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWXPXCGSTATPAMHPFKKT
Ga0210310_101897813300022369EstuarineLSKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWSTLIDKIDDCKADSQINWKVGIHDGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKDKKWKPTCAWTATAAMHPFKKVADWIECHDATMDAFGS
Ga0304731_1030819013300028575MarineKRKTSGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0304731_1105457823300028575MarineWVVKVDADAVFVPSRLSNKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFTTLVDKIDVCKADSHINWKVGVKNGKYGPMGEDLFAQACLDKFEVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0304731_1119355313300028575MarineSSSADWVVKVDADAVFVPSRLSNKLQSQLVPPSGIYLENCKYVEYGYFGNLEVFSRAAFDTLTEKIDDCKADSKINWKVGVKNGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGAFGS
Ga0304731_1163576623300028575MarineIAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVTAFGK
Ga0073969_1001823913300030749MarineKRSEDCFATGCCDVVGYNCFTTKPGKAQCLKNCTPSATQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDIT
Ga0073967_1000259713300030750MarineKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKTSTAAMHPFKKEAEWFECFEATTAAFGY
Ga0073967_1000793213300030750MarineWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASVATPAMHPFKKTQEWIQCYEATTSAFGA
Ga0073967_1000957913300030750MarineYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQACLDSVGIRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAWVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0073967_1000963213300030750MarineVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0073965_1000014113300030787MarineYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSQTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKKNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFTTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPGVRPKAEKKNKKWKPNCASVATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0073965_1173241513300030787MarineVEGDFHWAKRKVSGSWVNTGLFTQVWKKITKHVYTDWTAKVDIDAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDMCKASTEINWKVGVKNGKFGPMGEDLFAQSCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKKTEEWFQCWQATVDAFGGQ
Ga0073964_1000088313300030788MarineEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0073947_181461113300030801MarineTGIYLENCKYVKYGYFGNLEVFSKTAFNTLLANMDACKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKNVRRVEAFDITTDGACPADRPKDQKNNKKWKPNCAWVSTPAMHPFKKLDEWVQCHEATVAAFGK
Ga0073947_188986013300030801MarineYLENCKYVEYGYFGNLEVFSQAAWSTLVAKIDVCKVDSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMHPFKKVADWIQCHDATVNAFGS
Ga0073981_1170831913300030857MarineKETGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0073963_1142829213300030859MarineSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKTSTAAMHPFKKEAEWFECFEATTAAFGY
Ga0151494_111033113300030871MarineKISGSWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATVAAFGK
Ga0151494_122028113300030871MarineVEGDFHLAKRKISGTWVNTGMFTQIWKKITKHVYTDWVAKVDADAVFIPDRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDMCKASPEINWKVGIKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADRPHDQQKNKKWKPN
Ga0151494_124754713300030871MarineQVGDGLMTIPVDDVEGDFHFAKRKVSGSWVNTGLFSQVWKKITKHVYTDWTLKVDADAVFIPNRLRSWLGGQLVPYNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKASTEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRVEAFDITTDGACPADR
Ga0151494_128649913300030871MarineQGLRTIKVTDTENDFHFAKRKETGAWVNTGLFSQVWKAIASGSKWQSVDWVVKVDADAVFVPSRLTKNLESQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0073985_1103066613300030918MarineAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDACNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFKCFEATTAAFGY
Ga0073970_1119140913300030919MarineISIFACDQTDVFSDVAVEVGPGFHTIVVRDVDNDWHFAKRKTSGTWINTGMFTQVWKAIARGSKYESANWVAKVDADAVFVPGRLRRWLAKQLVPDDGIYLENCRFVDYGYFGNLEVYSEAAFRTLLENIDMCKASLNWKTGIKNGKYGPMGEDLFAQTCLDKVGVRRIEAFDITTDGACPADRPYDQKENKKWKPNCADVSTPAMHPFKKTHEWVDCHWATISKFGK
Ga0073951_1114416413300030921MarineDVEVEVGPGLKTIMVKDVDSDFHFAKRKSTGAWVNTGMFTQVWKAIASGGKTSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS
Ga0138348_122521413300030924MarineSVYTKETGSSKPSHELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGVMTTVVTDVEGDWHFAKRKTSGTWINTGMFTQIWKKIAEAGEYQNADWVMKLDADAIFIANRMRVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFK
Ga0138348_161040713300030924MarineQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKK
Ga0073937_1000228423300030951MarineVWLKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0073937_1001826313300030951MarineGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAA
Ga0073937_1002520013300030951MarineQMVPSSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDSCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0073937_1194596313300030951MarineWVNTGMFTQVWKAIASGGKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDMTTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWI
Ga0073937_1202471113300030951MarineISIFACEQSDVFSDVEVEVGPGLSTIKVDDVEGDFHFAKRKDTGSWVNTGLFAQVWKKMYKHQSAAWVAKVDGDAVFIPNRLRSWLSRQLVPDAGIYLENCKFVDYGYFGNLEVFSKAAFVTLLANIDECKASTEMNWKVGVEDGKYGPMGEDLFAQTCLDEKGVRRVEAFDITTDGACPADRPQNQRKNKHWKPDCAKTATAAMHPFKDKDAWFQCWDATVAAFGQ
Ga0073941_1000379413300030953MarineVDDVEGDFHWAKRKVSGTWVNTGMFTQVWKKITKHAYTDWTAKVDVDAVFIPNRLRSWLGGQMVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLLANIDLCKSSTEINWKVGIKNGKYGPMGEDLFAQSCLDMKGVRRAEAFDITTDGACPADRPHDQQKNKKWKPNCAETSTAAMHPFKK
Ga0073941_1000757913300030953MarineWHFAKRKETGAWVNTGMFTQVWKAIASGGKSSSADWVVKVDADAVFVPSRLSKKLQTQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS
Ga0073941_1000771413300030953MarineMKLDADAIFIANRMRVWLKHNELVPPAGIYLENCKYVDFGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGVKDGKYGPMGEDLFAQSCLDSVGIRRKEAFDITTDGACPANRPKAEKKNKKWKPNCAYAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0073941_1001244813300030953MarineAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0073941_1211249413300030953MarineDVEADLGAGAKTIVVHDSEGDFHFAKRKTSGAWVNTGMFTKIWKAIEASGKFRSADWIAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDTCKADPQINWKVGVEGGKYGPMGEDLFAQACLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAW
Ga0073941_1218071413300030953MarineWVNTGMFTQVWKAIASGGKHLSADWVAKVDADAVFVPSRLSKMLQSQLVPPSGIYLENCKYVDYGYFGNLEVFSRAAFTTLIDNIDECKADSQINWKVGIKNGKYGAMGEDLFAQACLDKVGVRRVEAFDITTDGACPADRPVDQQKNKKWTPSCASTATPAMHPFKKVADWIQCHDATVAAFGS
Ga0073941_1218707913300030953MarineFVPSRLTKKLESQLVPPSGIYLENCKYVEYGYFGNLEVFSHAAFVTLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0073942_1179661113300030954MarineVKVDADAVFVPNRLRAKLGAQMVPPTGVYLENCKYVKYGYFGNLEVFSQAAWSTLVANIDVCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIGQEKNKKWKPNCAETDTPAMHPFKKVADWIQCHDATVNAFGS
Ga0073942_1189681613300030954MarinePPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0073943_1163076513300030955MarineFAKRKETGAWVNTGMFTQVWKAIASGGKASSADWVVKVDADAVFVPSRLRNKLGAQLVPPSGIYLENCKYVEYGYFGNLEVFSQAAWSTLVDKIDDCKADSQINWKVGVHDGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWKPTCAWTATPAMH
Ga0073980_1130228313300031032MarineAIASGSKWQSADWVVKVDADAVFVPSRLTQKLEGQLVPPSGIYLENCKYVEYGYFGNLEVFSNAAFATLIEKIDDCKADMQINWKVGVKNGKYGPMGEDLFAQACLDKFGVRRVEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTGSFGS
Ga0073979_1002928013300031037MarineMVTDVDGDFHFAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSSGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDSCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSLGVRRVEAFDITTDGACPANRPLDQKTNKKWQPNCGKASTAAMHPFKKEAEWFECFEATTAAFGY
Ga0073979_1229355213300031037MarineNCKYVEYGYFGNLEVFSKAAFSTLIDKIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATTAAFGS
Ga0073979_1238866413300031037MarineIGVFACDQAEVFSDVEADLGPGAKTIVVQDTDGDFHFAKRKISGSWVNTGMFTKIWKAIEASGKFRSADWVAKVDADAVFVPSRLVRWLQGQRVPDNGIYLENCKYVKYGYFGNLEVFSKAAFNTLLANIDSCKADPQINWKVGVEGGKYGPMGEDLFAQTCLDQKGVRRVEAFDITTDGACPADRPKEEKNNKKWKPNCAWVSTAAMHPFKKLDEWVQCHEATV
Ga0073979_1246217513300031037MarineAVFIPNRLRSWLGGQLVPSNGIYLENCKYVDYGYFGNLEVFSKAAFTTLVANIDLCKASPEINWKVGVKNGKYGPMGEDLFAQTCLDMKGVRRIEAFDITTDGACPADRPQDEQKNKKWKPNCEWTSTAAMHPFKKKDEWFQCWEATVAAFGQ
Ga0073961_1001546213300031063MarineDVFGDVEVEVGAGLKTTMVTDVDGDFHFAKRKNSGTWVNTGIFKQVWKAIGTGDKYKTASWVVKVDVDAVFLPSRLAKMLQSQMVPSNGIYLENCKYVDYGYFGNLEVFSQAAFATLLQNIDTCNVSPEINWKVGVKNGKYGPMGEDLFAQTCLDSVGVRRVEAFDITTDGACPAHRPLDQKTNKKWQPDCSKASTAAMHPFKKEAEWFKCFEATTAAFGY
Ga0073961_1001926513300031063MarineEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCASAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0073961_1185487913300031063MarineGMFTQVWKAIARGSKYESANWVAKVDADAVFVPGRLRRWLAKQLVPDDGIYLENCRFVDYGYFGNLEVYSEAAFRTLLENIDMCKASLNWKTGIKNGKYGPMGEDLFAQTCLDKVGVRRIEAFDITTDGACPADRPYDQKENKKWKPNCADVSTPAMHPFKKTHEWVDCHWATISKFGK
Ga0138347_1099977513300031113MarineTGMFSQVWKAIASGGKTSSADWVVKVDADAVFIPSRLTEKLASQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGVKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS
Ga0073958_1142589013300031120MarinePSGIYLENCKYVEYGYFGNLEVFSKAAWDKLIEKIDECKADSQINWKVGVHQGKYGPMGEDLFAQACLDKFDVRRVEAFDITTDGACPADRPIDEQKNKKWKPTCAWTATSAMHPFKKVKDWAACHDATMDAFGLTLS
Ga0073962_1001380013300031126MarineELEILQHQKSQNLGIFQCDYSAVFSDVSVEVGGGMMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEAGEYQNADWVLKLDADAIFIANRMKVWLKHNELVPPPGIYLENCKYVDYGYFGNLEVYSTQAFSTLVQNIDSCKQTLNWKVGIKDGKYGPMGEDLFAQTCLDSVGIRRKEAFDITTDGACPGDRPKEEKKNKKWKPNCA
Ga0307388_1057069413300031522MarineTIMVQDVDNDWHFAKRKTSGSWINTGMFTQVWKAIAHGSKYESANWVAKVDADAVFLPGRLRRWLAKQMVPDEGIYLENCRFVDYGYFGNLEVYSEAAFRTLLESVEMCKKSLDWKTGIKNGKYGPMGEDLFAQSCLDKVGVRRIEAFDITTDGACPADRPHGQKENKKWKPNCAEVSTPAMHPFKKTHEWVDCHWATINRFGK
Ga0307392_104606713300031550MarineFVPSRLRTWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKNGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCAKASTAAMHPFKKKEEWISCHWATVDAFGK
Ga0307385_1039023813300031709MarineCKFVDYGYFGNLEVFSRVAFEILLENIDLCKASTEINWKLGVKNGKYGPMGEDLFAQACLDLKGVRRVEAFDITTDGACPADRPKEQKKSKTWQPNCAETSTAAMHPFKKLPDWIKCHAATVAAFGK
Ga0307396_1030373913300031717MarineTGAWVNTGMFSQVWKAIASGGKSSSADWIAKVDADAVFVPSRLSKKLQAQLVPPSGIYLENCKYVEYGYFGNLEVFSKAAFSTLIDNIDDCKADSQINWKVGIKNGKYGPMGEDLFAQACLDKVGVRRIEAFDITTDGACPADRPIDQQKNKKWTPTCAWTATPAMHPFKKVADWIKCHDATMAAFGS
Ga0307396_1051805813300031717MarineYDVFSDVHVEVGPGLSTIQVHDVEGDWHFAKRKVSGAWVNTGMFTQVWKAVAQHGKFWKAAWTAKVDADAVFVPSRLRTWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKNGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPNC
Ga0307387_1042189513300031737MarineDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMKVWLKENELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDMCKTTINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCGSTATPAMHPFKKTQEWVQCYEATTAAFGA
Ga0307384_1048250513300031738MarineFHFAKRKETGAWVNTGLFSQVWKKMYKHRSADWVAKVDGDAVFIPNRLRTWLSRQLVPDNGVYLENCKFVDYGYFGNLEVFSKAAFVTLLANIDECKASPEINWMVGIEDGKYGPVGEDLFAQTCLDMKGVRRIEAFDTVTDGACPADRPQDQRKNKHWQPNCAETSTASMHPFKDKDKWLQCWEATVAAFGQ
Ga0307383_1027316013300031739MarineAKVDADAVFVPSRLRTWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKSGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPNCAKAPTAAFHPFKVLGEWISCHSATVAAFGK
Ga0307383_1028492613300031739MarineVEVEVGQGLKTTMVEDTEGDFHFAKRKVSGAWVNTGMFTQVWKAVQASGKYRQADWVAKVDADAVFIPSRLVRWVQAQRVPDNGLYLENCKFVEYGYFGNLEVFSRVAFDTLLENLDACKKSPEINWKVGVKSGKYGPMGEDLFAQTCLDLHGVRRVEAFDITTDGACPADRPLDQKTNKKWKPNCAWVSTPAMHPFKKTQEWLQCHEATVAAFGA
Ga0307395_1038792813300031742MarineGMFTQIWKKIAEGNKYQNADWVMKLDADAIFVPNRMRIWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEERKNKKWKPECGSAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0307389_1071603013300031750MarineDYSDVFSDVSVQVGTGLMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEGNKYQNADWVMKLDADAIFVPNRMRIWLKQNELVPPAGLYLENCRYVDYGYFGNLEVYSREAFTTLIKNIDTCKTSLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWKQCYEAT
Ga0307389_1099550613300031750MarineQVWKAVAQDGKFWKAAWTAKVDADAVFVPSRLRTWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKNGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCAKASTAAMHPFKKKEEWISCHEATVDAFGK
Ga0307389_1117594513300031750MarineQVWKAVAQDGKFWKAAWTAKVDADAVFVPSRLRTWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKNGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCAKASTAAMHPFKKKEEWISCHEATV
Ga0307404_1024821713300031752MarineNCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKNGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCAKASTAAMHPFKKKEEWISCHEATVDAFGK
Ga0314688_1043170713300032517SeawaterEGDWHFAKRKVSGAWVNTGMFTQVWKAVAQNGKFWKAAWTAKVDADAVFVPSRLRTWFRKQRVPDAGIYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHSERKNKKWKPNCAKASTAAMHPFKKLDEWIGCHSATVDAFGK
Ga0314689_1021112513300032518SeawaterTTKPSHELEILRYGYSNNIGMFTCDQYDVFSDAHVEVGPGLSTIQVHDVEGDWHFAKRKVSGAWVNTGMFTQVWKAVAQNGKFWKAAWTAKVDADAVFVPSRLRTWFRTQRVPDAGIYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWTVGVKGGIYGPMGEDLFAQQCLDKLGVRRAVAFDITTDGACPADRPHAERENKKWKPNCAKASTAAMHPFKKLDEWISCHSATVDAFGK
Ga0314689_1024219413300032518SeawaterKNCTPSAHQSCTQPQGIMDPILQDAVPVGQKMYCFSVYTKDTGSTKQSHELDILQHQHREHLGIFQCDYSDVFSDVSVEVGPGTMTQVVTDVEGDWHFAKRKLSGTWVNTGMFSQIWKKISDAQRYQSADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEQKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0314689_1042237923300032518SeawaterYQNADWVLKLDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTKAFSTLIENIDTCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAGAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0314676_1041964813300032519SeawaterVFVPSRLRAWFRKQRVPDAGIYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHAERENKKWKPNCAKASTAAMHPFKKLDEWISCHSATVDAFGK
Ga0314667_1045739613300032520SeawaterTKQSHELEILQHQYSQTLGIFQCEQFDVFADVSVEVGSGYMTTVVTDVEGDWHFAKRKVSGTWVNTGMFTQIWKKIAEGMKYQSADWVMKLDADAIFVPSRMKVWLKQNELVPPAGVYLENCKYVDYGYFGNFEVYSREAFATLLKNIDQCKQTLNWKVGVENGKWGPMGEDLFAQTCLDSVGVRRKEALDITTDGACPGDRPTDQKKNKKWKPDCGTVATPAMHPFKKTEEWIQC
Ga0314680_1030755413300032521SeawaterVGQKMYCFSVYTKDTGSTKQSHELEILQHQHKEHLGIFQCDISDVFSDVSVEVGPGMMTTVVTDVESDWHFAKRKLSGTWVNTGMFTQIWKKISDDGRYQNADWVLKLDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTKAFSTLIENIDTCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAGAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0314677_1059402913300032522SeawaterNRMRVWLKTNELVPPAGIYLENCKNVDYGYFGNLEVFSREAFSTLIKNIDTCKQSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRREAFDITTDGACPADRPKDEQKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0314671_1027940213300032616SeawaterQNGKFWKAAWTAKVDADAVFVPSRLRTWFRKQRVPDAGIYLENCKFVDYGYFGNLEVYSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHSERNNKKWKPNCAKASTAAMHPFKKLDEWISCHWATVDAFGK
Ga0314673_1014807333300032650SeawaterRLRTWFRKQRVPDAGIYLENCKFVDYGYFGNLEVYSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHSERKNKKWKPNCAKASTAAMHPFKKLDEWISCHSATVDAFGK
Ga0314673_1019538413300032650SeawaterCTQPQGIMDPILQDAVPVGQKMYCFSVYTKDTGSTKQSHELDILQHQHREHLGIFQCDYSDVFSDVSVEVGPGTMTQVVTDVEGDWHFAKRKLSGTWVNTGMFSQIWKKISDAQRYQSADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEQKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0314673_1024573013300032650SeawaterCTQPQGIMDPILQDAVPVGQKMYCFSVYTKDTGSTKQSHELEILQHQHKEHLGIFQCDISDVFSDVSVEVGPGMMTTVVTDVESDWHFAKRKLSGTWVNTGMFTQIWKKISDDGRYQNADWVLKLDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTKAFSTLIENIDTCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAGAATPAMHPFKKTEEWIQCYQATTSAFGA
Ga0314673_1046624313300032650SeawaterGIFQCEETDVFSDVSVEVGSGMMTIAVTDVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQNTDWVMKLDADAIFIPSRMKAWFKQNELVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTTINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEALDITTDGACPGDRPTDQTNNKKWKPDCGTAATPAMHPFKKTEEWIQ
Ga0314685_1027941523300032651SeawaterGLSTIQVHDVEGDWHFAKRKVSGAWVNTGMFTQVWKAVAQNGKFWKAAWTAKVDADAVFVPSRLRAWFRKQRVPDAGIYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHAERENKKWKPNCAKASTAAMHPFKKLDEWISCHSATVDAFGK
Ga0314669_1020948013300032708SeawaterCTQPQGIMDPILQDAVPVGQKMYCFSVYTKDTGSTKQSHELEILQHQHKEHLGIFQCDISDVFSDVSVEVGPGMMTTVVTDVESDWHFAKRKLSGTWVNTGMFTQIWKKISDDGRYQNADWVLKLDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTKAFSTLIENIDTCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAGAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0314669_1070094113300032708SeawaterENCKNVDYGYFGNLEVFSREAFSTLIKNIDTCKQSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRREAFDITTDGACPADRPKDEQKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0314690_1041388313300032713SeawaterKYQNADWVLKLDADAIFVPNRMRVWLKTNELVPPAGIYLENCKNVDYGYFGNLEVFSREAFSTLIKNIDTCKQSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRREAFDITTDGACPADRPKDEQKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0314686_1020435113300032714SeawaterKVSGAWVNTGMFTQVWKAVAQNGKFWKAAWTAKVDADAVFVPSRLRVWFRKQRVPDAGIYLENCKFVDYGYFGNLEVYSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHAERENKKWKPNCAKASTAAMHPFKKLDEWISCHSATVDAFGK
Ga0314695_126647713300032724SeawaterKVSGAWVNTGMFTQVWKAVAQNGKFWKAAWTAKVDADAVFVPSRLRTWFRKQRVPDAGIYLENCKFVDYGYFGNLEVYSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEACDITTDGACPADRPHSERNNKKWKPNCAKASTAAMHPFKKLDEWISCHWATVDAFGK
Ga0314699_1040988813300032730SeawaterKLDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTKAFSTLIENIDTCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAGAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0314710_1011945313300032742SeawaterHVEVGPGLSTIQVHDVEGDWHFAKRKVSGAWVNTGMFTQVWKAVAQNGKFWKAAWTAKVDADAVFVPSRLRAWFRKQRVPDAGIYLENCKFVDYGYFGNLEVYSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHAERENKKWKPNCAKASTAAMHPFKKLDEWISCHSATVDAFGK
Ga0314701_1024967923300032746SeawaterAVAQNGKFWKAAWTAKVDADAVFVPSRLRTWFRKQRVPDAGIYLENCKFVDYGYFGNLEVYSQAAFGALLFNIDMCKATLNWKVGVKGGIYGPMGEDLFAQQCLDKLGVRRAEAFDITTDGACPADRPHAERKNKKWKPNCAKASTAAMHPFKKLDEWISCHWATVDAFGK
Ga0314712_1042459913300032747SeawaterWKKISDAQRYQSADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEQKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0314713_1017895913300032748SeawaterMYCFSVYTKDTGSTKQSHELDILQHQHREHLGIFQCDYSDVFSDVSVEVGPGTMTQVVTDVEGDWHFAKRKLSGTWVNTGMFSQIWKKISDAQRYQSADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVFSRQAFSTLIDNIDSCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEQKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0314713_1033347313300032748SeawaterGIFQCDISDVFSDVSVEVGPGMMTTVVTDVESDWHFAKRKLSGTWVNTGMFTQIWKKISDDGRYQNADWVLKLDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGYFGNLEVYSTKAFSTLIENIDTCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEKKNKKWKPNCAGAATPAMHPFKKTEEW
Ga0314713_1037300813300032748SeawaterRVWLKTNELVPPAGIYLENCKNVDYGYFGNLEVFSREAFSTLIKNIDTCKQSLNWKVGVKNGKYGPMGEDLFAQSCLDSVGVRRREAFDITTDGACPADRPKDEQKNKKWKPNCAWAATPAMHPFKKTQEWIQCYEATTAAFGA
Ga0314694_1030911513300032751SeawaterWHFAKRKLSGTWVNTGMFSQIWKKISDAQRYQSADWVLKVDADAIFVPNRMRVWFKQNELVPPAGIYLENCKYVDYGFFGNLEVFSRQAFSTLIDNIDSCKTNLNWKVGIKDGKYGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKEEQKNKKWKPNCAWAATPAMHPFKKTEEWIQCYQATTAAFGA
Ga0307390_1026980513300033572MarineTTKPGQARCMKNCTPSTFQSCTQPQPIMDPILQDAVPVGQKMYCFSVYTKNTGSTKQSHELEILQHQYLQQLGIFQCEESDVFSDVSVEVGGGMMTTVVTPVEDDWHFAKRKVSGTWVNTGMFTQIWKKIAEGAKYQTTDWVMKLDADAIFIPSRMRVWLKQNKLVPPAGVYLENCKYVDYGYFGNLEVYSREAFTTLIRNIDTCKTSINWKLGVQNGKWGPMGEDLFAQTCLDSVGVRRKEAFDITTDGACPADRPKQEEKNKKWKPNCASTATPAMHPFKKTQEWVQCYEATTAAFGA
Ga0307390_1027493723300033572MarineLRTWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKSGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCAKASTAAMHPFKKKEEWISCHEATVDAFGK
Ga0307390_1058042413300033572MarineLRTWVLKQRVPDAGVYLENCKFVDYGYFGNLEVFSQAAFGALLFNIDMCKATLNWKVGIKNGKYGPMGEDLFAQKCLGKLGVRRVEAFDITTDGACPADRPHAERKNKKWKPDCAKASTAAMHPFKKKEEWISCHSATVDAFGK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.