NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F000935

Metagenome / Metatranscriptome Family F000935

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F000935
Family Type Metagenome / Metatranscriptome
Number of Sequences 828
Average Sequence Length 154 residues
Representative Sequence NQQMLYDLMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Number of Associated Samples 438
Number of Associated Scaffolds 828

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.26 %
% of genes near scaffold ends (potentially truncated) 72.22 %
% of genes from short scaffolds (< 2000 bps) 99.88 %
Associated GOLD sequencing projects 416
AlphaFold2 3D model prediction Yes
3D model pTM-score0.69

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.396 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(25.966 % of family members)
Environment Ontology (ENVO) Unclassified
(64.614 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(80.435 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.18%    β-sheet: 1.16%    Coil/Unstructured: 45.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.69
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 828 Family Scaffolds
PF03134TB2_DP1_HVA22 0.12



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.88 %
UnclassifiedrootN/A0.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000128|SA_S1_NOR08_45mDRAFT_c10091331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani975Open in IMG/M
3300001354|JGI20155J14468_10186409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani633Open in IMG/M
3300003294|Ga0006245J48900_106704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300003621|JGI26083J51738_10125796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300003621|JGI26083J51738_10126560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300003682|Ga0008456_1038571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Acholeplasmatales → Acholeplasmataceae → Acholeplasma793Open in IMG/M
3300003683|Ga0008459J53047_1027115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300003683|Ga0008459J53047_1034284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani623Open in IMG/M
3300004507|Ga0008280_1000909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani737Open in IMG/M
3300005043|Ga0071100_1109579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300005516|Ga0066831_10162202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300005608|Ga0066840_10090565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300005941|Ga0070743_10130786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani838Open in IMG/M
3300005941|Ga0070743_10191656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300005942|Ga0070742_10156149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani635Open in IMG/M
3300006029|Ga0075466_1136901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300006356|Ga0075487_1046040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300006356|Ga0075487_1385149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M
3300006356|Ga0075487_1425986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300006357|Ga0075502_1529116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani879Open in IMG/M
3300006357|Ga0075502_1652600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani767Open in IMG/M
3300006373|Ga0075483_1249246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300006379|Ga0075513_1146405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Acholeplasmatales → Acholeplasmataceae → Acholeplasma522Open in IMG/M
3300006382|Ga0075494_1316856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani714Open in IMG/M
3300006382|Ga0075494_1327608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300006383|Ga0075504_1384927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Acholeplasmatales → Acholeplasmataceae → Acholeplasma729Open in IMG/M
3300006392|Ga0075507_1463001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani894Open in IMG/M
3300006393|Ga0075517_1419347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300006399|Ga0075495_1031042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300006399|Ga0075495_1475519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300006399|Ga0075495_1477994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani714Open in IMG/M
3300006401|Ga0075506_1020637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300006403|Ga0075514_1529931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300006404|Ga0075515_10516842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani765Open in IMG/M
3300006404|Ga0075515_10857328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300006405|Ga0075510_10650608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Acholeplasmatales → Acholeplasmataceae → Acholeplasma759Open in IMG/M
3300006419|Ga0075496_1500735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300006424|Ga0075497_1507961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani623Open in IMG/M
3300006424|Ga0075497_1512939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300006424|Ga0075497_1513817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300006424|Ga0075497_1526071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300006602|Ga0075484_1377190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300006803|Ga0075467_10683040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300006803|Ga0075467_10736087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300006850|Ga0075491_1018087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300006850|Ga0075491_1399794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300007231|Ga0075469_10094073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani847Open in IMG/M
3300007513|Ga0105019_1162676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1147Open in IMG/M
3300007513|Ga0105019_1218631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani918Open in IMG/M
3300007557|Ga0102821_1086905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani799Open in IMG/M
3300007558|Ga0102822_1108157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300007667|Ga0102910_1048155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani974Open in IMG/M
3300007725|Ga0102951_1152807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300007992|Ga0105748_10494376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300008834|Ga0103882_10028175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani748Open in IMG/M
3300008929|Ga0103732_1022894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani904Open in IMG/M
3300008935|Ga0103738_1027973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300008952|Ga0115651_1325936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300008958|Ga0104259_1019021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300008958|Ga0104259_1034442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300008993|Ga0104258_1048716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300008993|Ga0104258_1056354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300008993|Ga0104258_1100918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300008993|Ga0104258_1110784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300008996|Ga0102831_1141346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani799Open in IMG/M
3300008996|Ga0102831_1169137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300009003|Ga0102813_1122550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani821Open in IMG/M
3300009024|Ga0102811_1360210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300009028|Ga0103708_100120228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300009059|Ga0102830_1244977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300009071|Ga0115566_10306508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani935Open in IMG/M
3300009071|Ga0115566_10332722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani889Open in IMG/M
3300009077|Ga0115552_1143916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1004Open in IMG/M
3300009077|Ga0115552_1451143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300009263|Ga0103872_1011808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani922Open in IMG/M
3300009263|Ga0103872_1028497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani731Open in IMG/M
3300009263|Ga0103872_1032887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300009263|Ga0103872_1034088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300009265|Ga0103873_1049665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani803Open in IMG/M
3300009265|Ga0103873_1062260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300009265|Ga0103873_1070562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani694Open in IMG/M
3300009423|Ga0115548_1126494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300009432|Ga0115005_10420087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1062Open in IMG/M
3300009434|Ga0115562_1112233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1061Open in IMG/M
3300009434|Ga0115562_1117945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1025Open in IMG/M
3300009436|Ga0115008_10342412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1061Open in IMG/M
3300009436|Ga0115008_10496691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani871Open in IMG/M
3300009436|Ga0115008_10774187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300009437|Ga0115556_1121754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani980Open in IMG/M
3300009441|Ga0115007_10441269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani855Open in IMG/M
3300009442|Ga0115563_1127579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1048Open in IMG/M
3300009442|Ga0115563_1173636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani847Open in IMG/M
3300009445|Ga0115553_1149513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani958Open in IMG/M
3300009445|Ga0115553_1207559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani779Open in IMG/M
3300009495|Ga0115571_1131213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1062Open in IMG/M
3300009497|Ga0115569_10182695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani980Open in IMG/M
3300009497|Ga0115569_10224748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani855Open in IMG/M
3300009498|Ga0115568_10342454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani654Open in IMG/M
3300009505|Ga0115564_10212215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1003Open in IMG/M
3300009507|Ga0115572_10249005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1016Open in IMG/M
3300009508|Ga0115567_10276460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1060Open in IMG/M
3300009508|Ga0115567_10765819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300009526|Ga0115004_10337064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani894Open in IMG/M
3300009543|Ga0115099_11014883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani738Open in IMG/M
3300009544|Ga0115006_11304518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300009544|Ga0115006_11671663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300009592|Ga0115101_1163732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300009592|Ga0115101_1217976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani937Open in IMG/M
3300009592|Ga0115101_1236006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani645Open in IMG/M
3300009592|Ga0115101_1361115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300009593|Ga0115011_10727476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300009593|Ga0115011_11432946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300009599|Ga0115103_1088989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani836Open in IMG/M
3300009599|Ga0115103_1248003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300009599|Ga0115103_1248587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300009599|Ga0115103_1265253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300009599|Ga0115103_1288385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300009599|Ga0115103_1323090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300009599|Ga0115103_1531446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300009599|Ga0115103_1568055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300009599|Ga0115103_1753889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300009606|Ga0115102_10243213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani745Open in IMG/M
3300009606|Ga0115102_10282666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300009606|Ga0115102_10381778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300009606|Ga0115102_10381947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300009606|Ga0115102_10691443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani768Open in IMG/M
3300009606|Ga0115102_10732895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300009606|Ga0115102_10792076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300009608|Ga0115100_10101568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani795Open in IMG/M
3300009608|Ga0115100_10563350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300009608|Ga0115100_10882709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani829Open in IMG/M
3300009608|Ga0115100_10883610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300009608|Ga0115100_11127860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani935Open in IMG/M
3300009608|Ga0115100_11198724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300009608|Ga0115100_11234722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300009677|Ga0115104_10037817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300009677|Ga0115104_10479622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani758Open in IMG/M
3300009677|Ga0115104_10624454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300009677|Ga0115104_10764303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300009677|Ga0115104_10944595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300009679|Ga0115105_10484359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300009679|Ga0115105_10943678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300009741|Ga0123361_1023550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani841Open in IMG/M
3300010306|Ga0129322_1008342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300010404|Ga0129323_1042561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300010981|Ga0138316_11015235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300010981|Ga0138316_11414997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani776Open in IMG/M
3300010985|Ga0138326_10148180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300010985|Ga0138326_11059964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300010985|Ga0138326_11869081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani662Open in IMG/M
3300010987|Ga0138324_10242117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani847Open in IMG/M
3300010987|Ga0138324_10673647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300010987|Ga0138324_10709386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300012408|Ga0138265_1278661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300012412|Ga0138266_1348797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300012414|Ga0138264_1085712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300012415|Ga0138263_1158650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300012415|Ga0138263_1511495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300012415|Ga0138263_1769743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300012416|Ga0138259_1711920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani731Open in IMG/M
3300012416|Ga0138259_1738867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani738Open in IMG/M
3300012417|Ga0138262_1164264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300012418|Ga0138261_1333051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300012418|Ga0138261_1590096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300012418|Ga0138261_1673670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300012472|Ga0129328_1114476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300012504|Ga0129347_1289072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani890Open in IMG/M
3300012516|Ga0129325_1033120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1678Open in IMG/M
3300012516|Ga0129325_1201810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300012516|Ga0129325_1207747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300012516|Ga0129325_1221208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300012518|Ga0129349_1064320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani855Open in IMG/M
3300012518|Ga0129349_1081436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani676Open in IMG/M
3300012520|Ga0129344_1074040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300012520|Ga0129344_1119156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300012520|Ga0129344_1219661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani738Open in IMG/M
3300012520|Ga0129344_1358286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani699Open in IMG/M
3300012522|Ga0129326_1046868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300012522|Ga0129326_1183410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300012522|Ga0129326_1405747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani857Open in IMG/M
3300012522|Ga0129326_1459907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300012523|Ga0129350_1039588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300012523|Ga0129350_1204862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani860Open in IMG/M
3300012523|Ga0129350_1402433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300012524|Ga0129331_1031346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300012525|Ga0129353_1774255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300012528|Ga0129352_10095946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300012528|Ga0129352_10640476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani855Open in IMG/M
3300012528|Ga0129352_10982753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300012767|Ga0138267_1106941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani721Open in IMG/M
3300012767|Ga0138267_1261023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300012782|Ga0138268_1127417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300012782|Ga0138268_1170669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani828Open in IMG/M
3300012935|Ga0138257_1591546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300012954|Ga0163111_10601461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1027Open in IMG/M
3300012963|Ga0129340_1181877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300012965|Ga0129346_1235696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani922Open in IMG/M
3300012966|Ga0129341_1020860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300012966|Ga0129341_1124039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300012967|Ga0129343_1241164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300012967|Ga0129343_1366532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani813Open in IMG/M
3300012967|Ga0129343_1419608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300012968|Ga0129337_1463866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
3300012969|Ga0129332_1139182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300016703|Ga0182088_1044666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300016723|Ga0182085_1237149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300016726|Ga0182045_1129266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300016727|Ga0182051_1262770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300016727|Ga0182051_1377186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300016729|Ga0182056_1357830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300016732|Ga0182057_1449552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300016734|Ga0182092_1328985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300016735|Ga0182074_1132095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300016735|Ga0182074_1251208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300016736|Ga0182049_1151525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300016736|Ga0182049_1392895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300016737|Ga0182047_1332891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300016740|Ga0182096_1259668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300016740|Ga0182096_1345312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani871Open in IMG/M
3300016741|Ga0182079_1356529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300016742|Ga0182052_1115026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300016746|Ga0182055_1068726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300016748|Ga0182043_1342966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300016749|Ga0182053_1344606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300016749|Ga0182053_1449839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani603Open in IMG/M
3300016754|Ga0182072_1251034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300016754|Ga0182072_1537018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300016762|Ga0182084_1308125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300016766|Ga0182091_1441809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300016766|Ga0182091_1557515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300016781|Ga0182063_1340205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani781Open in IMG/M
3300016882|Ga0186577_106379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani839Open in IMG/M
3300017280|Ga0186684_119172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300017745|Ga0181427_1163412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300017781|Ga0181423_1145432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani915Open in IMG/M
3300017818|Ga0181565_10355666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani974Open in IMG/M
3300017824|Ga0181552_10418746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300017949|Ga0181584_10744482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300017950|Ga0181607_10478381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani668Open in IMG/M
3300017951|Ga0181577_10735675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300017952|Ga0181583_10639223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300017958|Ga0181582_10437130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300017958|Ga0181582_10785455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300017985|Ga0181576_10837662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300017986|Ga0181569_11098733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300018048|Ga0181606_10484494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani649Open in IMG/M
3300018410|Ga0181561_10406881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300018413|Ga0181560_10363425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani668Open in IMG/M
3300018415|Ga0181559_10506572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300018418|Ga0181567_10324223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1032Open in IMG/M
3300018420|Ga0181563_10490394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300018420|Ga0181563_10751867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300018565|Ga0188826_113740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300018565|Ga0188826_114841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300018599|Ga0188834_1020184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300018601|Ga0188850_1008567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani889Open in IMG/M
3300018601|Ga0188850_1013449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300018622|Ga0188862_1019421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300018628|Ga0193355_1028432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300018665|Ga0188882_1024125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300018671|Ga0193571_1013305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300018674|Ga0193166_1018522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300018684|Ga0192983_1023534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani829Open in IMG/M
3300018684|Ga0192983_1039806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300018692|Ga0192944_1022258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani897Open in IMG/M
3300018692|Ga0192944_1023284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani881Open in IMG/M
3300018692|Ga0192944_1025296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani849Open in IMG/M
3300018692|Ga0192944_1026974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300018692|Ga0192944_1034275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300018692|Ga0192944_1038363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300018692|Ga0192944_1039633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300018692|Ga0192944_1042205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani659Open in IMG/M
3300018692|Ga0192944_1044282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300018730|Ga0192967_1036648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani818Open in IMG/M
3300018730|Ga0192967_1037819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani806Open in IMG/M
3300018730|Ga0192967_1049838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300018730|Ga0192967_1062870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300018741|Ga0193534_1035484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani773Open in IMG/M
3300018742|Ga0193138_1019836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani867Open in IMG/M
3300018742|Ga0193138_1025568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani771Open in IMG/M
3300018742|Ga0193138_1030608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300018742|Ga0193138_1032450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300018745|Ga0193000_1047091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300018749|Ga0193392_1040099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300018762|Ga0192963_1050168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300018763|Ga0192827_1073318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300018765|Ga0193031_1025411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani902Open in IMG/M
3300018765|Ga0193031_1035204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani802Open in IMG/M
3300018765|Ga0193031_1041688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300018765|Ga0193031_1046203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani719Open in IMG/M
3300018765|Ga0193031_1080506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300018766|Ga0193181_1028174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani803Open in IMG/M
3300018800|Ga0193306_1031864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani824Open in IMG/M
3300018811|Ga0193183_1047979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300018812|Ga0192829_1059096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300018823|Ga0193053_1054130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300018825|Ga0193048_1042362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani689Open in IMG/M
3300018825|Ga0193048_1059805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300018831|Ga0192949_1069783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300018832|Ga0194240_1006569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani853Open in IMG/M
3300018836|Ga0192870_1045827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300018838|Ga0193302_1044349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani759Open in IMG/M
3300018842|Ga0193219_1038445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300018842|Ga0193219_1040415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300018842|Ga0193219_1077278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300018846|Ga0193253_1073031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani833Open in IMG/M
3300018846|Ga0193253_1074207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300018846|Ga0193253_1086635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300018861|Ga0193072_1057092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300018870|Ga0193533_1069125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300018871|Ga0192978_1071933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani638Open in IMG/M
3300018874|Ga0192977_1054296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300018874|Ga0192977_1073370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300018874|Ga0192977_1076203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300018874|Ga0192977_1077076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300018874|Ga0192977_1098843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300018879|Ga0193027_1076194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300018885|Ga0193311_10032910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300018899|Ga0193090_1081448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani748Open in IMG/M
3300018899|Ga0193090_1133091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300018905|Ga0193028_1084614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani624Open in IMG/M
3300018905|Ga0193028_1102786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300018913|Ga0192868_10040063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300018913|Ga0192868_10049392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300018926|Ga0192989_10107313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300018932|Ga0192820_10138462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300018955|Ga0193379_10153504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300018967|Ga0193178_10020740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani833Open in IMG/M
3300018968|Ga0192894_10216837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani636Open in IMG/M
3300018974|Ga0192873_10298935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300018977|Ga0193353_10147654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300018979|Ga0193540_10105739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani781Open in IMG/M
3300018980|Ga0192961_10094136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani904Open in IMG/M
3300018980|Ga0192961_10124217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300018980|Ga0192961_10135955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani749Open in IMG/M
3300018980|Ga0192961_10136237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani748Open in IMG/M
3300018980|Ga0192961_10137980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300018980|Ga0192961_10139286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300018980|Ga0192961_10148605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300018980|Ga0192961_10150874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300018980|Ga0192961_10157679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300018980|Ga0192961_10163872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300018980|Ga0192961_10176587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300018981|Ga0192968_10115160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300018982|Ga0192947_10142433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani800Open in IMG/M
3300018982|Ga0192947_10156977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani759Open in IMG/M
3300018982|Ga0192947_10206602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M
3300018982|Ga0192947_10296313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300018986|Ga0193554_10171452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300018989|Ga0193030_10101632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani884Open in IMG/M
3300018989|Ga0193030_10104062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani876Open in IMG/M
3300018989|Ga0193030_10109268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani860Open in IMG/M
3300018989|Ga0193030_10125456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300018989|Ga0193030_10129502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani803Open in IMG/M
3300018989|Ga0193030_10134144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani791Open in IMG/M
3300018989|Ga0193030_10145369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani764Open in IMG/M
3300018989|Ga0193030_10151126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300018989|Ga0193030_10152967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300018989|Ga0193030_10162395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300018989|Ga0193030_10166228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani719Open in IMG/M
3300018989|Ga0193030_10192142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300018989|Ga0193030_10235089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300019001|Ga0193034_10055206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani824Open in IMG/M
3300019001|Ga0193034_10066892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani771Open in IMG/M
3300019001|Ga0193034_10171111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300019009|Ga0192880_10084673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani808Open in IMG/M
3300019010|Ga0193044_10125216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani845Open in IMG/M
3300019010|Ga0193044_10175435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300019010|Ga0193044_10192165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300019017|Ga0193569_10245803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300019021|Ga0192982_10210993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300019021|Ga0192982_10214885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300019021|Ga0192982_10217872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300019022|Ga0192951_10190114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300019022|Ga0192951_10202208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani728Open in IMG/M
3300019022|Ga0192951_10251354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300019022|Ga0192951_10354034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300019025|Ga0193545_10080155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300019027|Ga0192909_10081193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300019027|Ga0192909_10120791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300019031|Ga0193516_10165535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300019031|Ga0193516_10255589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani569Open in IMG/M
3300019031|Ga0193516_10310402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300019032|Ga0192869_10223453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani808Open in IMG/M
3300019032|Ga0192869_10228393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani800Open in IMG/M
3300019032|Ga0192869_10235204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani789Open in IMG/M
3300019032|Ga0192869_10272019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300019032|Ga0192869_10318401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani679Open in IMG/M
3300019032|Ga0192869_10398080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300019032|Ga0192869_10476858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300019033|Ga0193037_10113891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani845Open in IMG/M
3300019033|Ga0193037_10171237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300019033|Ga0193037_10243353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani623Open in IMG/M
3300019036|Ga0192945_10107748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani881Open in IMG/M
3300019036|Ga0192945_10135420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani790Open in IMG/M
3300019036|Ga0192945_10138072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani782Open in IMG/M
3300019036|Ga0192945_10190374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300019048|Ga0192981_10223672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani728Open in IMG/M
3300019048|Ga0192981_10225641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300019048|Ga0192981_10229192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300019048|Ga0192981_10236567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300019048|Ga0192981_10284046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani623Open in IMG/M
3300019050|Ga0192966_10165079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani789Open in IMG/M
3300019050|Ga0192966_10199441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300019050|Ga0192966_10206382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300019051|Ga0192826_10126269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani932Open in IMG/M
3300019051|Ga0192826_10134267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani905Open in IMG/M
3300019051|Ga0192826_10162704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani823Open in IMG/M
3300019051|Ga0192826_10163035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani822Open in IMG/M
3300019051|Ga0192826_10201235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300019051|Ga0192826_10219380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300019051|Ga0192826_10236664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300019051|Ga0192826_10265411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300019051|Ga0192826_10289361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300019051|Ga0192826_10335485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300019054|Ga0192992_10173996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani684Open in IMG/M
3300019081|Ga0188838_106708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300019095|Ga0188866_1013882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani824Open in IMG/M
3300019095|Ga0188866_1014948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani798Open in IMG/M
3300019095|Ga0188866_1016987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani757Open in IMG/M
3300019095|Ga0188866_1017775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300019095|Ga0188866_1018413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani729Open in IMG/M
3300019095|Ga0188866_1018766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani723Open in IMG/M
3300019095|Ga0188866_1019735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300019095|Ga0188866_1021510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300019095|Ga0188866_1023771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M
3300019097|Ga0193153_1014381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani807Open in IMG/M
3300019097|Ga0193153_1017532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300019102|Ga0194243_1004924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300019116|Ga0193243_1031548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300019116|Ga0193243_1033252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300019117|Ga0193054_1040326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300019118|Ga0193157_1020292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300019118|Ga0193157_1027584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300019123|Ga0192980_1061258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300019123|Ga0192980_1066534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300019123|Ga0192980_1083942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300019123|Ga0192980_1085810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300019129|Ga0193436_1042142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300019131|Ga0193249_1066233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani870Open in IMG/M
3300019131|Ga0193249_1074274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani810Open in IMG/M
3300019131|Ga0193249_1097963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300019131|Ga0193249_1101394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300019131|Ga0193249_1106292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300019133|Ga0193089_1099602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300019133|Ga0193089_1099955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300019133|Ga0193089_1129643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300019149|Ga0188870_10079284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani799Open in IMG/M
3300019149|Ga0188870_10085569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani765Open in IMG/M
3300019149|Ga0188870_10092751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani730Open in IMG/M
3300019149|Ga0188870_10097341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300019149|Ga0188870_10099048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300019149|Ga0188870_10118128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300019149|Ga0188870_10127814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300019149|Ga0188870_10143962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300019153|Ga0192975_10170013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300019153|Ga0192975_10296812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300019200|Ga0180036_1025790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani775Open in IMG/M
3300019261|Ga0182097_1157218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani679Open in IMG/M
3300019262|Ga0182066_1029752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300019262|Ga0182066_1054567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani624Open in IMG/M
3300019266|Ga0182061_1669472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300019272|Ga0182059_1216038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani779Open in IMG/M
3300019272|Ga0182059_1282904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300019272|Ga0182059_1566854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300019274|Ga0182073_1050200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300019274|Ga0182073_1587496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300019276|Ga0182067_1707788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300019280|Ga0182068_1621604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300019283|Ga0182058_1379789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300019283|Ga0182058_1400642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani787Open in IMG/M
3300020013|Ga0182086_1150779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300020013|Ga0182086_1279257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani668Open in IMG/M
3300020014|Ga0182044_1163853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300020175|Ga0206124_10384336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300020182|Ga0206129_10210858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani850Open in IMG/M
3300020595|Ga0206126_10303962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani719Open in IMG/M
3300021085|Ga0206677_10237666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani759Open in IMG/M
3300021169|Ga0206687_1084003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani824Open in IMG/M
3300021169|Ga0206687_1439748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300021169|Ga0206687_1695309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300021169|Ga0206687_1945960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300021169|Ga0206687_1998461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani791Open in IMG/M
3300021325|Ga0210301_1201541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani623Open in IMG/M
3300021336|Ga0210307_1374986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani830Open in IMG/M
3300021342|Ga0206691_1101310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani835Open in IMG/M
3300021342|Ga0206691_1220404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani801Open in IMG/M
3300021342|Ga0206691_1388817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani705Open in IMG/M
3300021345|Ga0206688_10080161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300021345|Ga0206688_10139092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300021345|Ga0206688_10235961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300021348|Ga0206695_1236460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani804Open in IMG/M
3300021348|Ga0206695_1778500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300021350|Ga0206692_1211674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani791Open in IMG/M
3300021350|Ga0206692_1331967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300021353|Ga0206693_1127237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300021353|Ga0206693_1711820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300021355|Ga0206690_10065384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300021355|Ga0206690_10401997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani659Open in IMG/M
3300021359|Ga0206689_10082846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300021359|Ga0206689_10254970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani721Open in IMG/M
3300021359|Ga0206689_10281640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani719Open in IMG/M
3300021359|Ga0206689_10537962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani620Open in IMG/M
3300021359|Ga0206689_11155702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani798Open in IMG/M
3300021365|Ga0206123_10165414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1004Open in IMG/M
3300021378|Ga0213861_10231697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani986Open in IMG/M
3300021379|Ga0213864_10438672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300021389|Ga0213868_10416811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani739Open in IMG/M
3300021872|Ga0063132_103153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300021872|Ga0063132_111809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300021872|Ga0063132_115332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani812Open in IMG/M
3300021872|Ga0063132_122211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300021874|Ga0063147_117485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300021876|Ga0063124_103046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani759Open in IMG/M
3300021881|Ga0063117_1011201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani813Open in IMG/M
3300021887|Ga0063105_1010076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani635Open in IMG/M
3300021889|Ga0063089_1025860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300021889|Ga0063089_1041540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani800Open in IMG/M
3300021896|Ga0063136_1028850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani835Open in IMG/M
3300021897|Ga0063873_1052486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300021902|Ga0063086_1002959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300021902|Ga0063086_1009456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300021902|Ga0063086_1036609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani679Open in IMG/M
3300021905|Ga0063088_1001435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300021908|Ga0063135_1094162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300021911|Ga0063106_1033804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300021911|Ga0063106_1056314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani624Open in IMG/M
3300021912|Ga0063133_1011937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani816Open in IMG/M
3300021912|Ga0063133_1038076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani785Open in IMG/M
3300021912|Ga0063133_1100637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300021913|Ga0063104_1016422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300021913|Ga0063104_1037810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300021913|Ga0063104_1038104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300021913|Ga0063104_1058984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300021921|Ga0063870_1016618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300021921|Ga0063870_1029521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300021921|Ga0063870_1032960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300021921|Ga0063870_1036069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani716Open in IMG/M
3300021921|Ga0063870_1143449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300021922|Ga0063869_1021684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani709Open in IMG/M
3300021924|Ga0063085_1020174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300021925|Ga0063096_1056711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300021925|Ga0063096_1065860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300021927|Ga0063103_1007968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300021927|Ga0063103_1020883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300021927|Ga0063103_1104889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300021927|Ga0063103_1133240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300021928|Ga0063134_1077363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300021930|Ga0063145_1023018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300021930|Ga0063145_1046261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300021932|Ga0063872_1025251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani643Open in IMG/M
3300021933|Ga0063756_1105543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani604Open in IMG/M
3300021934|Ga0063139_1021723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300021934|Ga0063139_1023522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani759Open in IMG/M
3300021934|Ga0063139_1075648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300021937|Ga0063754_1051972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani635Open in IMG/M
3300021939|Ga0063095_1031921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300021940|Ga0063108_1062976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300021941|Ga0063102_1016097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300021941|Ga0063102_1027660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani796Open in IMG/M
3300021941|Ga0063102_1043695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300021950|Ga0063101_1013367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani767Open in IMG/M
3300021954|Ga0063755_1015680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300021962|Ga0222713_10356411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani913Open in IMG/M
3300021962|Ga0222713_10434784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani799Open in IMG/M
3300021964|Ga0222719_10586855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300021964|Ga0222719_10606484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani636Open in IMG/M
3300022074|Ga0224906_1208545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300022374|Ga0210311_1042956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300022375|Ga0210313_1035634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300023108|Ga0255784_10496481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300023110|Ga0255743_10587552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
(restricted) 3300023276|Ga0233410_10086288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani964Open in IMG/M
3300023555|Ga0232120_105203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300023555|Ga0232120_106991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300023565|Ga0228688_120779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300023566|Ga0228679_1023515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300023566|Ga0228679_1037772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300023674|Ga0228697_124973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300023676|Ga0232114_127783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300023679|Ga0232113_1021886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300023679|Ga0232113_1039205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300023698|Ga0228682_1022458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani843Open in IMG/M
3300023698|Ga0228682_1023399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300023698|Ga0228682_1036807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300023701|Ga0228685_1043871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300023704|Ga0228684_1033594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani790Open in IMG/M
3300023704|Ga0228684_1072225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300023706|Ga0232123_1076943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani638Open in IMG/M
3300023709|Ga0232122_1138226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300024239|Ga0247724_1029354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani800Open in IMG/M
(restricted) 3300024261|Ga0233439_10227028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani838Open in IMG/M
3300024343|Ga0244777_10772120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani569Open in IMG/M
3300024346|Ga0244775_11465694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300025138|Ga0209634_1305412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300025608|Ga0209654_1074196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani974Open in IMG/M
3300025620|Ga0209405_1163966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300025626|Ga0209716_1071561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1062Open in IMG/M
3300025626|Ga0209716_1126371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300025645|Ga0208643_1167688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300025694|Ga0209406_1152027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani732Open in IMG/M
3300025694|Ga0209406_1222472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300025830|Ga0209832_1145657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300025869|Ga0209308_10310257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300025874|Ga0209533_1312329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300025880|Ga0209534_10250679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani847Open in IMG/M
3300025892|Ga0209630_10366850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani633Open in IMG/M
3300026130|Ga0209961_1068565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300026403|Ga0247557_1017289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani813Open in IMG/M
3300026418|Ga0247564_1037262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani878Open in IMG/M
3300026447|Ga0247607_1106418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300026448|Ga0247594_1039535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani804Open in IMG/M
3300026448|Ga0247594_1044845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani757Open in IMG/M
3300026448|Ga0247594_1046834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300026448|Ga0247594_1066078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300026449|Ga0247593_1061390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300026465|Ga0247588_1050691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani816Open in IMG/M
3300026466|Ga0247598_1160642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300026468|Ga0247603_1051678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani828Open in IMG/M
3300026468|Ga0247603_1078454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300026470|Ga0247599_1056300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani834Open in IMG/M
3300026495|Ga0247571_1062537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani848Open in IMG/M
3300026495|Ga0247571_1086695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani723Open in IMG/M
3300026495|Ga0247571_1093324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300026495|Ga0247571_1131438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300026495|Ga0247571_1175022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300026500|Ga0247592_1078684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani800Open in IMG/M
3300026500|Ga0247592_1106205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani676Open in IMG/M
3300026503|Ga0247605_1117247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300026503|Ga0247605_1138040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300026513|Ga0247590_1102954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani738Open in IMG/M
3300026513|Ga0247590_1123784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300027188|Ga0208921_1064317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300027197|Ga0208922_1086407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300027416|Ga0207994_1085541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani635Open in IMG/M
3300027525|Ga0208437_1150651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300027751|Ga0208304_10250208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani629Open in IMG/M
3300027810|Ga0209302_10398798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300027849|Ga0209712_10226583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1062Open in IMG/M
3300027849|Ga0209712_10461175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
(restricted) 3300027997|Ga0255057_10193914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani986Open in IMG/M
3300028102|Ga0247586_1049768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300028102|Ga0247586_1098103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300028106|Ga0247596_1061601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani840Open in IMG/M
3300028109|Ga0247582_1106663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani730Open in IMG/M
3300028137|Ga0256412_1130561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani923Open in IMG/M
3300028137|Ga0256412_1153639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani849Open in IMG/M
3300028137|Ga0256412_1161293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani828Open in IMG/M
3300028137|Ga0256412_1169416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani807Open in IMG/M
3300028137|Ga0256412_1232743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani680Open in IMG/M
3300028137|Ga0256412_1271780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani624Open in IMG/M
3300028137|Ga0256412_1304364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300028233|Ga0256417_1101583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani775Open in IMG/M
3300028233|Ga0256417_1116940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani718Open in IMG/M
3300028233|Ga0256417_1140665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani649Open in IMG/M
3300028233|Ga0256417_1195074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300028282|Ga0256413_1177797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani767Open in IMG/M
3300028282|Ga0256413_1188597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300028282|Ga0256413_1199618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani718Open in IMG/M
3300028282|Ga0256413_1205021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300028282|Ga0256413_1254908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300028282|Ga0256413_1273451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300028290|Ga0247572_1070090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani851Open in IMG/M
3300028290|Ga0247572_1073280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani833Open in IMG/M
3300028297|Ga0228617_1105612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300028334|Ga0247597_1020845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani848Open in IMG/M
3300028334|Ga0247597_1038369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300028335|Ga0247566_1035075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300028335|Ga0247566_1043394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani744Open in IMG/M
3300028575|Ga0304731_10705123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani776Open in IMG/M
3300028575|Ga0304731_10922178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300028595|Ga0272440_1121665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani894Open in IMG/M
3300028672|Ga0257128_1073683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300030653|Ga0307402_10610539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300030671|Ga0307403_10539427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300030671|Ga0307403_10575786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300030699|Ga0307398_10368253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani785Open in IMG/M
3300030699|Ga0307398_10484758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300030709|Ga0307400_10474411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani791Open in IMG/M
3300030709|Ga0307400_10793745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300030720|Ga0308139_1019068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani986Open in IMG/M
3300030721|Ga0308133_1058119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300030723|Ga0308129_1013716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani870Open in IMG/M
3300030723|Ga0308129_1021193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300030724|Ga0308138_1063288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300030725|Ga0308128_1025524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300030756|Ga0073968_11620986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300030780|Ga0073988_12096302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300030780|Ga0073988_12249520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300030788|Ga0073964_10023001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300030856|Ga0073990_10005774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300030856|Ga0073990_11908180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300030856|Ga0073990_11913431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani749Open in IMG/M
3300030856|Ga0073990_11921167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani773Open in IMG/M
3300030919|Ga0073970_11024082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300030948|Ga0073977_1648383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani676Open in IMG/M
3300031004|Ga0073984_11257731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300031032|Ga0073980_10006295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300031032|Ga0073980_10006334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300031032|Ga0073980_11365567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300031037|Ga0073979_10009197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300031038|Ga0073986_12028282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300031062|Ga0073989_13155536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300031062|Ga0073989_13404502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300031062|Ga0073989_13556889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300031120|Ga0073958_11318587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300031121|Ga0138345_10376711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300031127|Ga0073960_11126847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300031522|Ga0307388_10432284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani858Open in IMG/M
3300031522|Ga0307388_10707641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300031522|Ga0307388_11216895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300031523|Ga0307492_10273027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300031557|Ga0308148_1018354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani789Open in IMG/M
3300031569|Ga0307489_10701929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300031569|Ga0307489_11010916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300031579|Ga0308134_1071474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani791Open in IMG/M
3300031579|Ga0308134_1102079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300031579|Ga0308134_1109979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300031589|Ga0307996_1187832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300031621|Ga0302114_10142288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1061Open in IMG/M
3300031621|Ga0302114_10147773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1034Open in IMG/M
3300031621|Ga0302114_10389614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300031622|Ga0302126_10302798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300031709|Ga0307385_10298863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300031710|Ga0307386_10363122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani739Open in IMG/M
3300031710|Ga0307386_10494288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300031710|Ga0307386_10667173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300031717|Ga0307396_10343902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani714Open in IMG/M
3300031725|Ga0307381_10168465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300031725|Ga0307381_10256048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300031725|Ga0307381_10263648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300031729|Ga0307391_10364497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani796Open in IMG/M
3300031729|Ga0307391_10438941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300031729|Ga0307391_10492688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300031729|Ga0307391_10676458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300031729|Ga0307391_10691590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300031734|Ga0307397_10336859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani689Open in IMG/M
3300031734|Ga0307397_10421313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300031735|Ga0307394_10309798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
3300031735|Ga0307394_10391477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300031737|Ga0307387_10486018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300031738|Ga0307384_10581557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300031738|Ga0307384_10589468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300031739|Ga0307383_10287267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300031739|Ga0307383_10396857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300031739|Ga0307383_10631176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300031739|Ga0307383_10739563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300031742|Ga0307395_10428730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300031743|Ga0307382_10346761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300031750|Ga0307389_10526008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300032463|Ga0314684_10349621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani864Open in IMG/M
3300032463|Ga0314684_10585104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300032470|Ga0314670_10378694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300032481|Ga0314668_10341837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani774Open in IMG/M
3300032491|Ga0314675_10359297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani728Open in IMG/M
3300032491|Ga0314675_10564425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300032492|Ga0314679_10259274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani795Open in IMG/M
3300032492|Ga0314679_10344880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani679Open in IMG/M
3300032492|Ga0314679_10404736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300032517|Ga0314688_10378227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani765Open in IMG/M
3300032517|Ga0314688_10378515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani765Open in IMG/M
3300032517|Ga0314688_10406350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani738Open in IMG/M
3300032517|Ga0314688_10447611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300032518|Ga0314689_10371423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300032518|Ga0314689_10447200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300032519|Ga0314676_10466084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300032519|Ga0314676_10520689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300032519|Ga0314676_10679862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300032520|Ga0314667_10497706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300032521|Ga0314680_10554470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani725Open in IMG/M
3300032521|Ga0314680_10955473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300032540|Ga0314682_10476585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300032540|Ga0314682_10477908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300032540|Ga0314682_10571367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300032540|Ga0314682_10583845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300032615|Ga0314674_10310078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani821Open in IMG/M
3300032615|Ga0314674_10323481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani803Open in IMG/M
3300032615|Ga0314674_10488499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani636Open in IMG/M
3300032615|Ga0314674_10541965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300032615|Ga0314674_10543908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300032616|Ga0314671_10279968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani905Open in IMG/M
3300032616|Ga0314671_10346136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani811Open in IMG/M
3300032616|Ga0314671_10629306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300032616|Ga0314671_10763318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300032651|Ga0314685_10258187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani956Open in IMG/M
3300032651|Ga0314685_10382500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani780Open in IMG/M
3300032651|Ga0314685_10712992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300032666|Ga0314678_10448047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300032707|Ga0314687_10388410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani771Open in IMG/M
3300032707|Ga0314687_10466171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300032707|Ga0314687_10564495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300032708|Ga0314669_10089236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1361Open in IMG/M
3300032708|Ga0314669_10393601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani757Open in IMG/M
3300032708|Ga0314669_10825261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300032709|Ga0314672_1199203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300032709|Ga0314672_1232592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300032711|Ga0314681_10358031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300032711|Ga0314681_10560133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300032714|Ga0314686_10475932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300032714|Ga0314686_10566646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300032723|Ga0314703_10362215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300032724|Ga0314695_1131801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani929Open in IMG/M
3300032724|Ga0314695_1229432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300032725|Ga0314702_1227168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani712Open in IMG/M
3300032728|Ga0314696_10572274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300032732|Ga0314711_10359869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300032732|Ga0314711_10418070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300032743|Ga0314707_10359399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300032745|Ga0314704_10360396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani805Open in IMG/M
3300032745|Ga0314704_10426882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300032745|Ga0314704_10508457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300032746|Ga0314701_10246641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani806Open in IMG/M
3300032746|Ga0314701_10288346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani744Open in IMG/M
3300032747|Ga0314712_10285939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300032748|Ga0314713_10278407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300032748|Ga0314713_10371446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300032749|Ga0314691_10211626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani810Open in IMG/M
3300032750|Ga0314708_10279055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani820Open in IMG/M
3300032750|Ga0314708_10537337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300032751|Ga0314694_10234257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani781Open in IMG/M
3300032751|Ga0314694_10361170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300032754|Ga0314692_10448221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300032754|Ga0314692_10562580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300032755|Ga0314709_10428205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300032755|Ga0314709_10618026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani654Open in IMG/M
3300033572|Ga0307390_10634902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani668Open in IMG/M
3300033572|Ga0307390_10681359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine25.97%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.20%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater9.06%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.45%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.21%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.73%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.50%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.26%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.02%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.17%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.05%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.97%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.85%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.60%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.48%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.48%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.48%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.36%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.36%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.36%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.24%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.24%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.24%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.24%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.24%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.12%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.12%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.12%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.12%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.12%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.12%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.12%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.12%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.12%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.12%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300003294Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C27A4_35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300003682Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004507Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005608Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84AEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006373Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006602Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006850Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010306Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016729Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016735Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016736Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016762Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016882Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)Host-AssociatedOpen in IMG/M
3300017280Metatranscriptome of coastal eukaryotic communities from Ligurian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 638 ?mol photons light - Strombidium inclinatum S3 (MMETSP0208)Host-AssociatedOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018565Metatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dTEnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018601Metatranscriptome of marine microbial communities from Baltic Sea - GS679_3p0_dTEnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018665Metatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2EnvironmentalOpen in IMG/M
3300018671Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018749Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789662-ERR1719448)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019081Metatranscriptome of marine microbial communities from Baltic Sea - GS676_3p0_dTEnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021876Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-18 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021897Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021933Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Euk - ARK-7-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021937Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022374Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022375Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023108Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaGEnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300023555Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 89R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023565Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023676Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023701Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023706Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023709Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024239Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-EEnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025874Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026418Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 12R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027197Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes)EnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028297Seawater microbial communities from Monterey Bay, California, United States - 18DEnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030919Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031120Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031127Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR08_45mDRAFT_1009133123300000128MarineMKFATALLFAGAVTASVSENQERLYEIMNLQISTPTDCPPPLEISEEELTFQLGQFSRNFEQTAWNNAMEIAAGLAKSGKSPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFVDPGVEGDWQ*
JGI20155J14468_1018640913300001354Pelagic MarineALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0006245J48900_10670413300003294SeawaterMKFIAIAALLGATASAHESNQAKLYDLMQLQVSGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFVQVAKKVR*
JGI26083J51738_1012579613300003621MarineMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELXDKSFSFPKVRNYDYAVENMXELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLN
JGI26083J51738_1012656013300003621MarineSTSSTGGKAAAAAVAAPACPEPLEISEEELHYQLGEFSRNFDIANWNNAMEIKKKLNESGVYPKIAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNTNIDNAYHLQKFIEVAKKVRENLNAKYDIGFIDPGVEGDWQ*
Ga0008456_103857113300003682SeawaterMKFTIVALLGLAATTSSTRHNQAMLYNLMQLESQDCPPPLAMTEDELHYQLGEFSRNFDSKNWENAMKIRASLAESGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0008459J53047_102711513300003683SeawaterNTVDPAACPDPLEISEEELQFQLGMFSRSFEMASWNNAMEIASGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0008459J53047_103428413300003683SeawaterMKFAALALIGAVSASNISHNQERLYEIMALQTGSTFEYSKKVDANGCPIPLEITEDELQYQLGEFSRNFNMDNWDNAMKVKGGLAKLGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW*
Ga0008280_100090913300004507MarineFPLKMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0071100_110957913300005043Marine Subseafloor AquiferALLLVGAISSTEAIVSENQEKLYNLMQLQGADCPEPLEISEDELHYQLGEFSRNFQMEHWNNAMKINAGLGKTGHNPRFAVTTKELYDKSFSFPKVRNYNYAVENMNELEHYEDNLNNNISNSQHLKKFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0066831_1016220213300005516MarineMQLNAETCPPPLEISEDNMHYQLGEFSRNFQMENWKNAMTIKGKLGGQGKSPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNNNLDNKLALDRFVATAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0066840_1009056513300005608MarinePQNPKTPSDCYIIIFVKMKFAFALVAMASAISNQERLFQLMQLENCPPPLEISEDNLHYQLGEFSRNFNIKNWENAQHIKGELAKGGVNVKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAAEDNLNQNLSNQLALKRFIDTAKRVRANLNDKYDIGFIDPGVEGDWQ*
Ga0070743_1013078613300005941EstuarineMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0070743_1019165613300005941EstuarineMMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNDKYDIGFIDPGVDGDW*
Ga0070742_1015614913300005942EstuarineIIYFPLKMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075466_113690113300006029AqueousMKFTIAALLAATASAHITHNQAQLYDLMALQTSAADCPEPLDISEDELHYQLGEFSRNFNMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFPKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0075487_104604013300006356AqueousMKFAIVALLGLVSVEAKHSRHHNQAMLYNLMQIDAQADPACPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRGELADKGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075487_138514913300006356AqueousMKFATALLIVGAASASVSVNQEKLYEIMNLQMGTDPACPPPLEISEEELSYQLGQFSRNFEMSAWNNAMEVAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFVDPGVEGDW*
Ga0075487_142598613300006356AqueousKFAALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075502_152911613300006357AqueousKFASVIAALMATAMAVQDNQDKLYILMQLNNCPPPLEISEDNLNYQLGEFSRNFQMVNWDNANHIAGELRKGGATPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEAAEDNLNQNLSNGLALKRFVEVAKRVRANLNDKYDIGFVDPGVDGDWQ*
Ga0075502_165260023300006357AqueousMKFAALILCGAIASTAAMGVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMENWNNAMHIKGKLNKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNQLALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0075483_124924613300006373AqueousALMATAMAVQDNQDKLYILMQLNNCPPPLEISEDNLNYQLGEFSRNFQMVNWDNANHIAGELRKGGATPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEAAEDNLNQNLSNGLALKRFVEVAKRVRANLNDKYDIGFVDPGVDGDWQ*
Ga0075513_114640513300006379AqueousKFAALILCGAIASTAAMGVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMENWNNAMHIKGKLNKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELQHYEDNLNANLSNQLALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0075494_131685613300006382AqueousMKFAVLALIGAVSAAPVSHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNSQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGV*
Ga0075494_132760813300006382AqueousLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEIASGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075504_138492713300006383AqueousKFAALILCGAIASTAAMGVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMENWNNAMHIKGKLNKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNQLALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0075507_146300113300006392AqueousFASVIAALMATAMAVQDNQDKLYILMQLNNCPPPLEISEDNLNYQLGEFSRNFQMVNWDNANHIAGELRKGGATPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEAAEDNLNQNLSNGLALKRFVEVAKRVRANLNDKYDIGFVDPGVDGDWQ*
Ga0075517_141934713300006393AqueousMKFTIAALVFIGAMTSVEAVEMHTNVSNQSKLYSLMQLNDCPEPLEISEEELHHQLGLFSRHLEKQYWDNAMTIKSELAKTGVFPKIAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNIENSLHLSKFIEVAKKVRDNLNAKYDIGFIDPGVDGDWQ*
Ga0075495_103104213300006399AqueousYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075495_147551913300006399AqueousMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075495_147799413300006399AqueousMKFAVLALIGAVSAAPVSHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNSQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075506_102063713300006401AqueousMKFATALLFAGAVTATVSENQEKLYEIMNLQMADPACPPPLEISEEELAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075514_152993113300006403AqueousHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNAQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075515_1051684223300006404AqueousGAIASTAAMGVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMENWNNAMHIKGKLNKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNQLALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0075515_1085732813300006404AqueousMKFAALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKIKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075510_1065060813300006405AqueousAALILCGAIASTAAMGVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMENWNNAMHIKGKLNKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNQLALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0075496_150073513300006419AqueousFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075497_150796113300006424AqueousKFAVLALIGAVSAAPVSHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNSQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075497_151293913300006424AqueousKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075497_151381713300006424AqueousKFTIAALLAATASAHITHNQAQLYDLMALQTSAADCPEPLDISEDELHYQLGEFSRNFNMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFPKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0075497_152607113300006424AqueousYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0075484_137719013300006602AqueousFASVIAALMATAMAVQDNQDKLYILMQLNNCPPPLEISEDNLNYQLGEFSRNFQAVNWDNANHIAGELRKGGANPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEAAEDNLNQNLSNGLALKRFVEVAKRVRANLNDKYDIGFVDPGVDGDWQ*
Ga0075467_1068304013300006803AqueousNQAQLYDLMALQTSAADCPEPLDISEDELHYQLGEFSRNFNMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFSKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0075467_1073608713300006803AqueousMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEIAAGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFV
Ga0075491_101808713300006850AqueousIMKFTIAALLAATASAHITHNQAQLYDLMALQTSAADCPEPLDISEDELHYQLGEFSRNFNMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFPKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0075491_139979413300006850AqueousMDPAVACPEPLDIDEDELHYQLGEFSRNFAMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALTRFLEVAKKVRANLNAKYDIGFIDPGVDGDW*
Ga0075469_1009407313300007231AqueousMNCIYLNGVFIINCKVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0105019_116267613300007513MarineMQKGEDCPPPLELTQEELNYQLGEFSRNFKMENWDNAIKIKKSLEEKGKKPQFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNSMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0105019_121863113300007513MarineMKFIVAAALFAATTSARESNQAKLYDLMQLQISGADCPEPLEISEEELHYQLGEFSRNFGMENWDNAMKIAAGLSKEGKTPKYAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNGYALQKFIAVAKKVR*
Ga0102821_108690513300007557EstuarineMMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNAKYDIGFIDPGVDGDW*
Ga0102822_110815713300007558EstuarineMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTKKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNAKYDIGFIDPGVDGDW*
Ga0102910_104815513300007667EstuarineMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0102951_115280713300007725WaterPQNPKTPLKDNILLIIIIIIPLNMKFTTLLLIAGASAYNLGQHNQQKLYALMQTGAPECPEPLEISEEELNYQLGEFSRHFDMKFWDNAMKIKDELSKKGINPRFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNISNSLALKRFIEVAKKVRKNLNDKYDIGFIDPGVEGDWQ*
Ga0105748_1049437613300007992Estuary WaterTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0103882_1002817513300008834Surface Ocean WaterKFTTALLCAGAVSATVSVNQEKLYELMNLQVENCPPPLEISEEELQYQLGQFSRNFEMSAWNNAMEIAAGLAKEGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0103732_102289413300008929Ice Edge, Mcmurdo Sound, AntarcticaMKFAIAALLFAGVSKAIINVSTNQEQLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ*
Ga0103738_102797313300008935Ice Edge, Mcmurdo Sound, AntarcticaQEQLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ*
Ga0115651_132593613300008952MarineMQLEAETGYHSRDGEISNPACPPPIPVTEDELHYQLGEFSRNFDMKNWGNAMYVKGELGKSGKNPKFAVTTKELYDKSFSFPKVRNYDYAVAQMNELEHYEDNLNANLSNNLALTRFIDVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0104259_101902113300008958Ocean WaterMQLQSSECPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSKGQHWKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ*
Ga0104259_103444213300008958Ocean WaterMQTHASECPEPLEISEEEMTFQLGEFSRHFDQKFWDNAMKIKDELSKKGINPKFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSLALSRFVEVAKKVRKNLNAKYDIGFIDPGVEGDW*
Ga0104258_104871613300008993Ocean WaterMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ*
Ga0104258_105635413300008993Ocean WaterIAALLGATTSAQMSNQDKLFDLMALQISGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAGKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0104258_110091813300008993Ocean WaterENVKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0104258_111078413300008993Ocean WaterMQTGVESGKKDCPPPLAMTEDNLHYQLGEFSRNFEMKHWNAAMKIKDTLEAQGKKPKFAVTTKELYDHSFSFPKVRNYDYAADQMNHLEGAEDNLNSNLSNANALAKFVATAKQVRTNLNDKYDVGFMDPGVENDNE*
Ga0102831_114134613300008996EstuarineMMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNDK*
Ga0102831_116913713300008996EstuarineMKFATALLFAGAVTATVSENQEKLYEIMNLQMADPACPPPLEITEEELAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0102813_112255013300009003EstuarineMKFASIALVAVAAATQKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGDSGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0102811_136021013300009024EstuarineMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYD
Ga0103708_10012022813300009028Ocean WaterMKFAALALLGAVSASNISHNQEKLYEIMALQTAQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKGKLAKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0102830_124497713300009059EstuarineMMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNAKYDIGFIDP
Ga0115566_1030650813300009071Pelagic MarineMKFAIAALLFAGVSQAIINVSDNQERLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ*
Ga0115566_1033272213300009071Pelagic MarineISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115552_114391613300009077Pelagic MarineMKFATLALLGAVSASNISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115552_145114313300009077Pelagic MarineMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEIAAGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVE
Ga0103872_101180813300009263Surface Ocean WaterMKFTALLACVACTQAMAVSDNQEKLYELMQLNTADCPAPLKIEEDEMHYQLGEFSRNFQMENWNNAMYIKKKLNKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFIKVAKQVRANLNDKYDIGFIDPGVEGDWQ*
Ga0103872_102849713300009263Surface Ocean WaterGNFDESLQGQFIIYFPLKMKFTLALLGAAAASSRHNQVMLYNLMQLEAQGAPACPPPLEISEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEQGKNVKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0103872_103288713300009263Surface Ocean WaterLFAGVASAGISENQEKMFEIMNLQTNTVDPAACPDPLEISEEELQFQLGMFSRTFEMTNWNNAMEIASGLAKQGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0103872_103408813300009263Surface Ocean WaterKMKFTTALLCAGAVSATVSVNQEKLYELMNLQVENCPPPLEISEEELQYQLGQFSRNFEMSAWNNAMEIAAGLAKEGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0103873_104966513300009265Surface Ocean WaterMKFATALLFAGVASAGISENQEKMFEIMNLQTNTVDPAACPDPLEISEEELQFQLGMFSRTFEMTNWNNAMEIASGLAKQGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0103873_106226013300009265Surface Ocean WaterMKFTTALLCAGAVSATVSVNQEKLYELMNLQVENCPPPLEISEEELQYQLGQFSRNFEMSAWNNAMEIAAGLAKEGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0103873_107056213300009265Surface Ocean WaterMTFTVLLACVAATSAFGVSDNQEKLYELMQLNSGECPKPLEITEDEMHYQLGEFSRNFDMKNWDNAMEIKGKLAEQGKNVKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115548_112649413300009423Pelagic MarineMKFASIALIGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115005_1042008723300009432MarineMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAAGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSSLAKAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW*
Ga0115562_111223323300009434Pelagic MarineMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115562_111794513300009434Pelagic MarineMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115008_1034241223300009436MarineMNLQTEGPSYGYVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW*
Ga0115008_1049669113300009436MarineMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115008_1077418713300009436MarineMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115556_112175413300009437Pelagic MarineMKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115007_1044126913300009441MarineMKFASIALVAVAAATTKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115563_112757913300009442Pelagic MarineMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115563_117363613300009442Pelagic MarineMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115553_114951313300009445Pelagic MarineMKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115553_120755923300009445Pelagic MarineSTEPCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115571_113121323300009495Pelagic MarineMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGYVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW*
Ga0115569_1018269513300009497Pelagic MarineMKFATLALLGAVSATSDNQQMLYDIMALQMSQVDANGCPIPLAITEDELAFQLGEFSRNFNMDNWDNAMKVKEGLGGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115569_1022474813300009497Pelagic MarinePKPQNPKIMNSIYLNGVLIINCKVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115568_1034245413300009498Pelagic MarineMKFASIIALAATAQAVSSNQDKLFVLMQLNECPPPLEISEDNLHYQLGEFSRNFQMVNWDNAMHISGELRNGGASPKVAVTTKELYDKSFSFPKVRNYDYAVQNMNELEGAEDNLNTNLSNGLALKRFIAVAKKVRANLNDKYDIGFVDPGVDGDWQ*
Ga0115564_1021221513300009505Pelagic MarineMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115572_1024900513300009507Pelagic MarineMKFAILALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW*
Ga0115567_1027646013300009508Pelagic MarineMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115567_1076581913300009508Pelagic MarineMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEG
Ga0115004_1033706413300009526MarineMKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFVDPGVEGTGNEHDGVPEWEHHGVLDLSKKL*
Ga0115099_1101488313300009543MarineFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLAGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115006_1130451813300009544MarineMNLQTEGPTFGYVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW*
Ga0115006_1167166313300009544MarineMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGDSGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115101_116373213300009592MarineSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115101_121797613300009592MarineMKFASIIALAASAQAVSSNQDKLFVLMQLNECPPPLEISEDNLHYQLGEFSRNFQMVNWDNAMHISGELRKGGASPKVAVTTKELYDKSFSFPKVRNYDYAVQNMNELEGAEDNLNTNLSNGLALKRFIAVAKKVRANLNDKYDIGFVDPGVDGDWQ*
Ga0115101_123600613300009592MarineMKFTIAIIALVGAMTSTTEASAINSINQARLYNLMQLQECPEPLEVSEEELHHQLGLFSRHLETQYWDNAMKIQAGLAKTGVFPKIAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNIGNSHHLQKFIEVAKKVRENLNAKYDVGFIDPGVEGDWQ*
Ga0115101_136111513300009592MarineMKFTIAALVFIGAMTSVEAVEMHSNVSNQSKLYTLMQLNECPEPLEVSEEELHHQLGLFSRHLEAQYWDNAMSIKDGLAKSGVYPKIAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNIENKHHLSKFIDVAKRVRSNLNAKYDIGFIDPGVDGDWQ*
Ga0115011_1072747613300009593MarineMKFATIALVASVAAIGTAKHNQVMLYNLMQLEEQGAPANCPPPLEISEDELAYQLGEFSRNFDMKNWDNAMEIKGKLQGSGANPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115011_1143294623300009593MarineMKFVALALLGAVSANYSNQDKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKAGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLN*
Ga0115103_108898913300009599MarineKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLAGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115103_124800313300009599MarineMKFTILALFGLTAASTHRHHNQAMLYNLMQLEEQDCPPPLAMTEDELHYQLGEFSRNFDNKNWDNAMKIREDLAKSGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115103_124858713300009599MarineFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEAQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115103_126525313300009599MarinePLAMTEDELHYQLGEFSRNFQMVHWENAMKIRGSLLASGQKPKVAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNISNKLALTRFVEVAKKVRANLNDKYDIGFIDPGTEGDW*
Ga0115103_128838513300009599MarineIPLNMKFTTAIFLAGAVASVDAYNLANNNQQRLYALMQTHSSECPEPLEISEEELTYQLGQFSRHFDMKFWDNAMKINGELGKQGKSPKFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNSLALSRFIEVAKKVRKNLNAKYDIGFIDPGVEGDWQ*
Ga0115103_132309013300009599MarineMKFTIAALVFIGAMTSVEAVEMHTNVTNQSKLYSLMQLNECPEPLEISEEELHHQLGLFSRHLEAQYWDNAMTIKDGLSKTGVYPKIAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNIENKHHLSKFIEVAKRVRGNLNAKYDIGFIDPGVDGDWQ*
Ga0115103_153144613300009599MarineMKFTIAAVLALGASAHVNHNQQKLYDFMALQTGDCPEPLDMTDDELHYQLGEFSRNFNLENWNNAMKIKGELEKSGKSPKIAVTTKELYDHSFSFPKVRNYEFAVKNMNDLESAEDNLNNNISNAYALKRFVEIAKKVRTNLNDKYDIGFIDPGVEGDWQ*
Ga0115103_156805513300009599MarineMKFIAIAALLGATTSAQMSNQDKLFDLMALQISGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAGKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSYALQKFVQVAKKVR*
Ga0115103_175388913300009599MarineMMLQEPVPGYPNGVPAGCPPPLEISEDNLHYQLVEFSRNFQMENWVNAMHIRDQLAAQGVSPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFVDTAKKVRENLNAKYDIGFIDPGVDGDWQ*
Ga0115102_1024321313300009606MarineMKFTIAALVFIGAMTSTEATSVQNINQARLYNLIQLQECPEPLEISEEELQHQLGLFSRHLEQQYWDNAMTIKTELAKTGVFPKIAVTTKELYDKSFSFPKVRNYEYAVQQMNELEHYEDNLNTNISNSHHLSKFIEVAKKVRENLNAKYDIGFIDPGVEGDWQ*
Ga0115102_1028266613300009606MarineKFIAIAALLGATTSAQMSNQDKLFDLMALQISGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAGKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSYALQKFVQVAKKVR*
Ga0115102_1038177813300009606MarineVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEAQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115102_1038194713300009606MarineMKFAALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115102_1069144313300009606MarineLAGLKKEGKSPKFAVLALIGAVSAAPVSHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNAQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115102_1073289513300009606MarineMKFAIVALLGLASVEAKHNQAMLYNLMQLDAQADPACPPPLAITEDELHYQLGEFSRNFDIKNWENAMTIRSGLAGSGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNQLALTRFVEVAKKVRANLNDKYDIGFIDPGV*
Ga0115102_1079207613300009606MarineIIPLNMKFTTAIFLAGAVASVDAYNLANNNQQRLYALMQTHSSECPEPLEISEEELTYQLGQFSRHFDMKFWDNAMKINGELGKQGKSPKFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNSLALSRFIEVAKKVRKNLNAKYDIGFIDPGVEGDWQ*
Ga0115100_1010156813300009608MarineKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115100_1056335013300009608MarineKFTTAIFLAGAVASVDAYNLANNNQQRLYALMQTHSSECPEPLEISEEELTYQLGQFSRHFDMKFWDNAMKINGELGKQGKSPKFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNSLALSRFIEVAKKVRKNLNAKYDIGFIDPGVEGDWQ*
Ga0115100_1088270913300009608MarineLLACVAATSAFGVTDNQEKLYSLMQLNSGAENCPPPLELTEDEMHYQLGEFSRNFQMENWNNAMLIKKKLKKKGIFPKFAITTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNENLSNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ*
Ga0115100_1088361023300009608MarineLNMKFTAILAAVAVSSVAADNQEYLFELMQLQDPNCPPPLAMTEDELHYQLGEFSRNFQMVHWENAMKIRGSLLASGQKPKVAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNISNKLALTRFVEVAKKVRANLNDKYDIGFIDPGTEGDW*
Ga0115100_1112786013300009608MarineKFASIIALAASAQAVSSNQDKLFVLMQLNECPPPLEISEDNLHYQLGEFSRNFQMVNWDNAMHISGELRKGGASPKVAVTTKELYDKSFSFPKVRNYDYAVQNMNELEGAEDNLNTNLSNGLALKRFIAVAKKVRANLNDKYDIGFVDPGVDGDWQ*
Ga0115100_1119872413300009608MarineMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLAGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115100_1123472213300009608MarineMMLQEPVPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQMENWVNAMHIRDQLATQGVSPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFVDTAKKVRENLNAKYDIGFIDPGVDGDWQ*
Ga0115104_1003781713300009677MarineMKFAALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115104_1047962213300009677MarineEIMALQTEQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKKGLAKVGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115104_1062445413300009677MarineIIYFPLKMKFASIALAGVVAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELHYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115104_1076430313300009677MarineQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0115104_1094459523300009677MarineKFTALLFCGAIASTQAMGLKDNQEKLYELMQLNVESADCPKPLEISEDELNYQLGEFSRNFQMENWKNANHIKGKLNDKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFISVAKKVRSNLNDKYDIGFIDPGVEGDWQ*
Ga0115105_1048435913300009679MarineMKKFAIVMMAGSASAVQFSDNQSKLYELMQLNEAACPPPLEITEDNMHYQLGEFSRNFQMENWNNAMEIKDKLGKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNLSNSLALDRFIKVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0115105_1094367813300009679MarineLMQLQTENCPPPLEISEDSMNYQLGEFSRNFQMENWDNAMTIKKKLKKPVKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVNVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0123361_102355013300009741MarineMKFTALLACVACTQAMAVSDNQEKLYELMQLNTADCPAPLKIEEDEMHYQLGEFSRNFQMENWNNAMYIKKKLNKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVKVAKQVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129322_100834213300010306AqueousEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNSQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129323_104256113300010404AqueousFAVLALIGAVSAAPVSHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNSQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0138316_1101523513300010981MarineMQLNTQTCPEPLEITEDNMHYQLGEFSRNFQMDNWNNAMTIKGKLNKGGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNQNLSNGLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0138316_1141499713300010981MarineKFTALLFCGVIASSQATGFSDNQEKLYDLMQLNECPKPLEISEEELHYQLGEFSRNFQMENWKNAMHIKDKLGKQGKFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ*
Ga0138326_1014818013300010985MarineMKFTALLFCGAIASTNAFESISTNQEKLYELMQLNSEAGECPKPLEVTEDEMHYQLGEFSRNFQMESWNNAMYIKKKLNKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFINVAKKVRSNLNDKYDIGFIDPGVEGDWQ*
Ga0138326_1105996413300010985MarineFVFAVAAVLATTEAMLSSNQSKLYMLMQLQNCPPPLEISEDNLQYQLGEFSRNFQMVNWDNANEIAGKLRAGGAKPKFAVTTADLYNKSFSFPKVRNYDYAVQNMDELIAANDNLNANLSNGLALKKFLEVAKRVRSNLNDKYDIGFTDPGVDGDW*
Ga0138326_1186908113300010985MarineKFIAIAALLGATTSAHESNQAKLYDIMALQMTGADCPEPLEISEEELHYQLGEFSRNFNMENWNNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFVQVAKKVR*
Ga0138324_1024211713300010987MarinePQAALPRTAVGAVCLLSVHHGSKHAGAVAAVLATTEAMLSSNQSKLYMLMQLQNCPPPLEISEDNLHYQLGEFSRNFQMVNWDNANEIAGKLRAGGAKPKFAVTTADLYNKSFSFPKVRNYDYAVQNMDELIAANDNLNANLSNGLALKKFLEVAKRVRSNLNDKYDIGFTDPGVDGDW*
Ga0138324_1067364713300010987MarinePACPPPLAITEDELHYQLGEFSRNFDMKNWDNAMEIKGKLGEQGQTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0138324_1070938613300010987MarineMQKEEDCPPPLELTQEELNYQLGEFSRNFKMENWDNAVKIKKALEEKGKKPSFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNIMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0138265_127866113300012408Polar MarineMKFASIALLGVAAATGKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0138266_134879713300012412Polar MarineYFPLKMKFASIALLGVAAATGKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0138264_108571213300012414Polar MarineIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGEW*
Ga0138263_115865013300012415Polar MarineFCAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGEW*
Ga0138263_151149513300012415Polar MarineFAGVSKAIINVSTNQEQLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGFEGEWQ*
Ga0138263_176974313300012415Polar MarineHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0138259_171192013300012416Polar MarineMKFAILALIGAASAAPISHNQEMIYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGEW*
Ga0138259_173886713300012416Polar MarineKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGEW*
Ga0138262_116426423300012417Polar MarineMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAIEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGEL*
Ga0138261_133305113300012418Polar MarineMKFAIAALLFAGVSKAIINVSTNQEQLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKYVEIAKKVRANLNDKYDIGFIDPGVEGEWQ*
Ga0138261_159009613300012418Polar MarineIYFPLKMKFASIALLGVAAATGKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0138261_167367013300012418Polar MarineKFAILALIGAASAAPISHNQEMIYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGEW*
Ga0129328_111447613300012472AqueousASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129347_128907213300012504AqueousAVSDNQERLFLLMQMQNCPPPLEISEENLHYQLGEFSRNFQMVNWDNAMEIAKKLREGGANPKIAVTTKELYDKSFSFPKVRNYDYAVENMNELESAEDNLNTNLSNGLALKRFLEVAKRVRANLNDKYDIGFVDPGVDGDWQ*
Ga0129325_103312013300012516AqueousMTEDNLHYQLGEFSRNFEMKHWNAAMKIKDTLEAQGKKPKFAVTTKELYDKSFSFPKVRNYDYAVDQMNHLEGAEDNLNTNLDNANALAKFVATAKQVRTNLNDKYDVGFMDPGVENDNE
Ga0129325_120181013300012516AqueousMQTHASECPEPLEISEEEMTFQLGEFSRHFDQKFWDNAMKIKDELSKKGINPKFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSLALSRFIEVAKKVRKNLNAKYDIGFIDPGVEGDW*
Ga0129325_120774713300012516AqueousIYFPLKMKFATALLFAGAVTATVSENQEKLYEIMNLQMADPACPPPLEISEEELAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129325_122120813300012516AqueousKFATLLLVAATASALKLSAEPAKNCPEPLEISEDELHYQLGEFSRSFEMKNWDNAMKIKDELSKKGTNPRFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANIGNSLALSRFIAIAKKVRSNLNDKYDIGFIDPGVEGDW*
Ga0129349_106432013300012518AqueousKFTALLACVACTQAMAVSDNQEKLYELMQLNTADCPAPLKIEEDEMHYQLGEFSRNFQMENWNNAMYIKKKLNKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVKVAKQVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129349_108143613300012518AqueousMKFAALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKIKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129344_107404013300012520AqueousMKFATALLVGAASAYTTLNQEMLYEFINLQDEELAPAAPTAGCPPPLEISEEELSYQLGQFSRNFEMTNWNNAMHIAAELAAQGKQPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129344_111915613300012520AqueousFATALLFAGAATATVSENQEKLYEIMNLQMTTPDACPPPLEISEEELAYQLGNFSRNFEMTSWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129344_121966113300012520AqueousKFAALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKIKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129344_135828613300012520AqueousKFTTALLFAGAVSASYSDNQEKLYEIMNLQMADPACPPPLEISEDELSFQLGSFSRNFEMTHWNNAMEIAAGLSKKGVKPKIVVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNPSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGTEGDW*
Ga0129326_104686813300012522AqueousMATPTDCPDPLEISEEELQFQLGMFSRSFEMTSWNNAMEIASGLAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129326_118341013300012522AqueousMKFATLLLVAATASALKLSAEPAKNCPEPLEISEDELHYQLGEFSRSFEMKNWDNAMKIKDELSKKGTNPRFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANIGNSLALSRFIAIAKKVRSNLNDKYDIGFIDPGVEGDW*
Ga0129326_140574713300012522AqueousAGLKKEGKSPKFAVLALIGAVSAAPVSHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNSQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129326_145990713300012522AqueousFPLKMKFATALLFAGAVTATVSENQEKLYEIMNLQMADPACPPPLEISEEELAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNNLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129350_103958813300012523AqueousFLEEIMMLQEPVPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQMENWVNAMHIRDQLAAQGVSPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLSNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ*
Ga0129350_120486213300012523AqueousCPRGYHPGRLRQPGETLLAHADAELPSSSRISEENLHYQLGEFSRNFQMVNWDNAMEIAKKLREGGANPKIAVTTKELYDKSFSFPKVRNYDYAVENMNELESAEDNLNTNLSNGLALKRFLEVAKRVRANLNDKYDIGFVDPGVDGDWH*
Ga0129350_140243313300012523AqueousMQLNTDECPKPLKIEEDELHFQLGEFSRNFQMENWKNAMYIKEKLEKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFIQVAKKVRANLNDKYDIGFVDPGVEGDWQ*
Ga0129331_103134613300012524AqueousLLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129353_177425513300012525AqueousMKFTALLLCGAIASTTAMDVSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129352_1009594613300012528AqueousAIASTAAMGVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMENWNNAMHIKGKLNKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNQLALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129352_1064047613300012528AqueousNMKFTALLACVACTQAMAVSDNQEKLYELMQLNTADCPAPLKIEEDEMHYQLGEFSRNFQMENWNNAMYIKKKLNKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVKVAKQVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129352_1098275313300012528AqueousLLLCGAIASTTAMDVSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0138267_110694113300012767Polar MarineMLFDIMALQTSQVDANGCPIPLAITEDELAFQLGEFSRNFNMDNWDNAMKVQSGLAGGGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDVGFIDPGVEGDW*
Ga0138267_126102313300012767Polar MarineFPLKMKFASIALLGVAAATGKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0138268_112741713300012782Polar MarineHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0138268_117066913300012782Polar MarineMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGEW*
Ga0138257_159154613300012935Polar MarineCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLTGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAIEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGEW*
Ga0163111_1060146113300012954Surface SeawaterMKFATLALIGAASAVQVSDNQQMLYDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129340_118187713300012963AqueousTTALLFAGAVSASYSDNQEKLYEIMNLQMADPACPPPLEISEDELSFQLGSFSRNFEMTHWNNAMEIAAGLSKKGVKPKIVVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNPSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGTEGDW*
Ga0129346_123569613300012965AqueousFTSVIAALVATTQAVSDNQERLFLLMQMQNCPPPLEISEENLHYQLGEFSRNFQMVNWDNAMEIAKKLREGGANPKIAVTTKELYDKSFSFPKVRNYDYAVENMNELESAEDNLNTNLSNGLALKRFLEVAKRVRANLNDKYDIGFVDPGVDGDWQ*
Ga0129341_102086013300012966AqueousPLKMKFATALLFAGAATATVSENQEKLYEIMNLQMTTPDACPPPLEISEEELAYQLGNFSRNFEMTSWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129341_112403913300012966AqueousKFATALLVGAASAYTTLNQEMLYEFINLQDEELAPAAPVAGCPPPLEISEEELSYQLGQFSRNFEMTNWNNAMHIAAELAAQGKQPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129343_124116413300012967AqueousIFFPLKMKFATALLFAGAATATVSENQEKLYEIMNLQMTTPDACPPPLEISEEELAYQLGNFSRNFEMTSWNNAMEIAAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129343_136653213300012967AqueousMKFTTALLFAGAVSASYSDNQEKLYEIMNLQMADPACPPPLEISEDELSFQLGSFSRNFEMTHWNNAMEIAAGLSKKGVKPKIVVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNPSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGTEGDW*
Ga0129343_141960813300012967AqueousMKFATALLVGAASAYTTLNQEMLYEFINLQDEELAPAAPVAGCPPPLEISEEELSYQLGQFSRNFEMTNWNNAMHIAAELAAQGKQPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ*
Ga0129337_146386613300012968AqueousALLFAGAASANISHNQEKLYEIMNLQTTDCPPPLEISEEELAYQLGQFSRNFEMVNWNNAMQIAGELAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNGLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0129332_113918213300012969AqueousAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW*
Ga0182088_104466623300016703Salt MarshPPLEISEDELAYQLGEFSRNFDLHNWDNAMEIKSKLQEKGVNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182085_123714913300016723Salt MarshPLKMKFATALLIVGAASASVSVNQEKLYEIMNLQMGTDPACPPPLEISEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182045_112926613300016726Salt MarshLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182051_126277013300016727Salt MarshMQTHASECPEPLEISEEEMTFQLGEFSRHFDQKFWDNAMKIKDELSKKGINPKFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLYNNLSNSLALSRFIEVAKKVRKNLNAKYDIGFIDPGVEGDW
Ga0182051_137718613300016727Salt MarshTILMAGVLASVEAYRLSEHNQQKLYTLMQTGAAECPEPLEISEEELNYQLGEFSRHFDMKYWDNAMKIQEELGKQGKNPKFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNSLALTRFIEVAKKVRKNLNDKYDIGFIDPGVEGDW
Ga0182056_135783013300016729Salt MarshKFTALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182057_144955213300016732Salt MarshALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182092_132898513300016734Salt MarshFPLKMKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEVAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFVDPGVEGDW
Ga0182074_113209513300016735Salt MarshVFLALAGVASATVSENQMKLFAAMQKEECPEPLEISEEELQYQLGEFSRNFKEENWKNAMEIKKELNEKGIFPRYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNNNISNKYHLDKFLEVAKKVRKNLNDKYDIGFIDPGVEGDWQ
Ga0182074_125120813300016735Salt MarshSASYSDNQEKLYEIMNLQMADPACPPPLEISEDELSFQLGSFSRNFEMTHWNNAMEIAAGLSKKGVKPKIVVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNPSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGTEGDW
Ga0182049_115152523300016736Salt MarshEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182049_139289513300016736Salt MarshFPLKMKFATALLFAGAVTATVSENQEKLYEIMNLQMADPACPPPLEISEEELAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182047_133289113300016737Salt MarshFTIAALLAATASAHITHNQAQLYDLMALQTSAADCPEPLDISEDELHYQLGEFSRNFNMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFPKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0182096_125966813300016740Salt MarshALVFIGAMTSVEAHNSINQARLYNLIQLNECPEPLEISEEELHHQLGLFSRHLEQQYWDNAMKIKTELAKTGVFPKIAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNIGNSKHLSKFIEVAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0182096_134531213300016740Salt MarshMKFASVIAALMATAMAVQDNQDKLYILMQLNNCPPPLEISDDNLHYQLGEFSRNFQMVNWDNAMHIAGELRKGGANPKVAVTTKELYDKSFSFPKVRNYDYAVQNMNELEAAEDNLNTNLSNGLALKRFVAVAKKVRANLNDKYDIGFVDPGVDGDWQ
Ga0182079_135652913300016741Salt MarshKFGVFLALAGVASATVSENQMKLFAAMQKEECPEPLEISEEELQYQLGEFSRNFKEENWKNAMEIKKELNEKGIFPRYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNNNISNKYHLDKILEVAKKVRKNLNDKYDIGFIDPGVEGDWQ
Ga0182052_111502613300016742Salt MarshILMAGVLASVEAYRLSEHNQQKLYTLMQTGAAECPEPLEISEEELNYQLGEFSRHFDMKYWDNAMKIQEELGKQGKNPKFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNSLALTRFIEVAKKVRKNLNDKYDIGFIDPGVEGDW
Ga0182055_106872613300016746Salt MarshIVALLGLASVEAKHSKHHNQAMLYNLMQIDAQSDPACPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRAELADKGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182043_134296613300016748Salt MarshKFTIAALLAATASAHITHNQAQLYDLMALQTSAADCPEPLDISEDELHYQLGEFSRNFNMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFPKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGV
Ga0182053_134460613300016749Salt MarshGVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMENWNNAMHIKGKLNKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNQLALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0182053_144983923300016749Salt MarshMQTGVESGKKDCPPPLAMTEDNLHYQLGEFSRNFEMKHWNAAMKIKDTLEAQGKKPKFAVTTKELYDKSFSFPKVRNYDYAVDQMNHLEGAEDNLNTNLDNANALAKFVATAKQVRTNLNDKYDVGFMDPGVEND
Ga0182072_125103413300016754Salt MarshKFATALLVGAASAYTTLNQEMLYEFINLQDEELAPAAPTAGCPPPLEISEEELSYQLGQFSRNFEMTNWNNAMHIAAELAAQGKQPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0182072_153701813300016754Salt MarshFGVFLALAGVASATVSENQMKLFAAMQKEECPEPLEISEEELQYQLGEFSRNFKEENWKNAMEIKKELNEKGIFPRYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNNNISNKYHLDKFLEVAKKVRKNLNDKYDIGFIDPGVEGDWQ
Ga0182084_130812513300016762Salt MarshFAVIAALVASTQAVKDNQDKLYVLMQLNNCPPPLEISEDNLNYQLGEFSRNFQMVNWDNAMEIAKKLREAGGKPKVAVTTKELYDKSFSFPKVRNYDYAVENMNELEAAEDNLNQNLSNGLALKRFIEVAKRVRANLNDKYDIGFVDPGVDGDWQ
Ga0182091_144180913300016766Salt MarshKLYEIMNLQMGTDPACPPPLEISEEELSYQLGQFSRNFEMSAWNNAMEVAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFVDPGVEGDW
Ga0182091_155751513300016766Salt MarshLKMKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182063_134020513300016781Salt MarshMKCAIVALLGLASVEAKHSKHHNQAMLYNLMQIDAQSDPACPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRAELADKGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0186577_10637913300016882Host-AssociatedMKYTVAMCLLGAVASTQIDSTNQEKLFNLMQLQDGPCPEPLEITEDELHYQLGEFSRTFEMQYWDNAMKIKKELGEKGLNPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNGNIGNNYHLQKFLEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0186684_11917213300017280Host-AssociatedMKYTALFVLGALATSQALVSDNQDKLYNLMQLQTSECPEPLEITEDELHYQLGEFSRNFQMEHWNNAMKIKDELEKKGAHTRFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNISNNLHLKKFIEIAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0181427_116341213300017745SeawaterAMDISDNQEKLYELMQLNTAECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVGKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0181423_114543213300017781SeawaterASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLAGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0181565_1035566623300017818Salt MarshMKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0181552_1041874613300017824Salt MarshMKFTIAALLAATASAHITHNQAQLYDLMALQTSVADCPEPLDISEDELHYQLGEFSRNFNMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFPKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0181584_1074448213300017949Salt MarshMKFTSVIAALVATTQAVADNQDKLFVLMQMQECPPPLEISEDNLHYQLGEFSRNFQMVNWDNAMEIAKKLREGGANPKIAVTTKELYDKSFSFPKVRNYDYAVENMNELEAAEDNLNQNLSNGLALKRFIEVAKRVRANLNDKYDIGFVDPGVD
Ga0181607_1047838113300017950Salt MarshMIFATALLCAGAVSASVSDNQEMPFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0181577_1073567513300017951Salt MarshMKFTSTILMAGVLASVEAYRLSEHNQQKLYTLMQTGAAECPEPLEISEEELNYQLGEFSRHFDMKYWDNAMKIKEELGKQGKNPKFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNSLALTRFIEVAKKVRKNLNDKYDIGFIDPGVEGDW
Ga0181583_1063922313300017952Salt MarshMKFGVFLALAGVASATVSENQMKLFAAMQKEECPEPLEISEEELQYQLGEFSRNFKEENWKNAMEIKKELNEKGIFPRYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNNNISNKYHLDKFLEVAKKVRKNLNDKYDIGFIDPGVEGDWQ
Ga0181582_1043713013300017958Salt MarshMKFTTALLFAGAVSASYSDNQEKLYEIMNLQMADPACPPPLEISEDELSFQLGSFSRNFEMTHWNNAMEIAAGLSKKGVKPKIVVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNPSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGTEGDW
Ga0181582_1078545513300017958Salt MarshLAGVASATVSENQMKLFAAMQKEECPEPLEISEEELQYQLGEFSRNFKEENWKNAMEIKKELNEKGIFPRYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNNNISNKYHLDKFLEVAKKVRKNLNDKYDIGFIDPGVEGDWQ
Ga0181576_1083766213300017985Salt MarshMKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDK
Ga0181569_1109873313300017986Salt MarshMKFTALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKL
Ga0181606_1048449413300018048Salt MarshMKFTSTILMAGVLASVEAYRLSEHNQQKLYTLMQTGAAECPEPLEISEEELNYQLGEFSRHFDMKYWDNAMKIQEELGKQGKNPKFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNSLALTRFIEVAKKVRKNLNDKYDIGFIDPGVEGDW
Ga0181561_1040688113300018410Salt MarshMKFTIAALLAATASAHITHNQAQLYDLMALQTSAADCPEPLDISEDELHYQLGEFSRNFNMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFPKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0181560_1036342513300018413Salt MarshMKFATLLLVAATASALKLSAEPAKNCPEPLEISEDQLHYQLGEFSRSFEMKNWDNAMKIKDELSKKGTNPRFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANIGNSLALSRFIAIAKKVRSNLNDKYDIGFIDPGVEGDW
Ga0181559_1050657223300018415Salt MarshMQTHASECPEPLEISEEEMTFQLGEFSRHFDQKFWDNAMKIKDELSKKGINPKFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSLALSRFIEVAKKVRKNLNAKYDIGFIDPGVEGDW
Ga0181567_1032422313300018418Salt MarshMKFAALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0181563_1049039413300018420Salt MarshMKFATLLLVAATASALKLSAEPAKNCPEPLEISEDELHYQLGEFSRSFEMKNWDNAMKIKDELSKKGTNPRFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANIGNSLALSRFIAIAKKVRSNLNDKYDIGFIDPGVEGDW
Ga0181563_1075186713300018420Salt MarshMHTGVESGKKVFPPPLAMSEDNLHYQLGEFSRNFEMKHWNAAMKIKDTLEAQGKKPKFAVTTKELYDKSFSFPKVRNYDYAVDQMNHLEGAEDNLNTNLDNANALAKFVATAKQVRTNLNDKYDVGFMDPGVENDNE
Ga0188826_11374013300018565Freshwater LakeKFVTALLCAGAVTASVSVNQEMLYEIMNLQTSMADPACPPPLEISEEELSFQLGSFSRNFDMTNWNNAMEVAAGLAKSGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALVRFIEVAKKVRANLNDKYDIGFIDPGVEGDF
Ga0188826_11484113300018565Freshwater LakeMMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALTRFLEVAKKVRANLNDKYDIGFIDPGVDGDW
Ga0188834_102018413300018599Freshwater LakeIYFPLKMKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGTEGDW
Ga0188850_100856713300018601Freshwater LakeKFASVIAALVASTQAVSDNQDKLFILMQLNNCPPPLEISDDNLHYQLGEFSRNFQMVNWDNAMHIAGELRKGGANPKIAVTTKELYDKSFSFPKVRNYDYAVQNMNELEAAEDNLNTNLSNGLALKRFVAVAKKVRANLNDKYDIGFVDPGVDGDWQ
Ga0188850_101344913300018601Freshwater LakeYFPLKMKFATALLFAGAVTATVSENQEKLYEIMNLQMADPACPPPLEISEEELAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188862_101942113300018622Freshwater LakeYFPLKMKFASIALLGVAAATSKHNQIMLYNLMQLEDKGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193355_102843213300018628MarineCPPPLDISEDNLHYQLGEFSRNFKMENWNNAMEIAGKLKGDGVQVKLAVTTKELYDKSFSFPKVRNYDYAVENMNELEAAEDNLNKNISNGLQLKRFIEVAKKVRANLNAKYDIGFIDPGVDGDW
Ga0188882_102412513300018665Freshwater LakeCPPPLEISEEELSYQLGQFSRNFEMSAWNNAMEVAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFVDPGVEGDW
Ga0193571_101330513300018671MarineALIGAASAVQVSDNQQMLYDIMALQTSQVDANGCPIPLEISEDELQYQLGEFSRNFNMDNWDNAMKVKAGLAAGGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193166_101852213300018674MarineQVMLYNLMQLEEQGAPACPPPLAITEDELHYQLGEFSRNFDLKNWDNAMEIKGKLAEAGQTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192983_102353413300018684MarineMKFAIAALLFAGVSKAIINVSTNQEQLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQXADSRVLNTGSTNQFIDHNSMNLHXFYI
Ga0192983_103980613300018684MarineANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0192944_102225813300018692MarineMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192944_102328413300018692MarineMKFTALLFCGVISSSNAMGFSENQEKLYDLMQLNSAECPKPLEISEDEMHYQLGEFSRNFQMENWTNAMHIKGKLGKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALERFVSVGKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0192944_102529613300018692MarineMKFAIAALLFAGVSQAIINVSDNQERLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0192944_102697413300018692MarineMKFTIVALLGLAATTGTSKHNQAMLYNLMQLEEMDCPPPLAMTEDELHYQLGEFSRNFDSKNWENAMKIRSSLAESGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192944_103427513300018692MarineMQIQANGGVEAKTEAKVEVPDKGCKPPLDISEDSLHYQLGEFSRNFAMENWNNAMKINGELKKSGKSPKIAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNKDLSNALALERFVTVAKKIRANLNDKYDIGFIDPGVESDWQ
Ga0192944_103836313300018692MarineMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELHYQLGEFSRNFDQKNWDNAMQIKTGLAGQGATPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192944_103963313300018692MarineMKFAALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192944_104220513300018692MarineVDANGCPVPLAMTDDELAYQLGEFSRNFNMDNWDNAMKVKSGLAAGGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192944_104428213300018692MarineVDANGCPVPLAMTDDELAYQLGEFSRNFNMDNWDNAMKVKSGLAAGGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192967_103664813300018730MarineMKFATLALIGAASAVQVSDNQQMLYDLMAIQTSQVDAAGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0192967_103781913300018730MarineIINVSTNQEQLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQXADSRVLNTGSTNQFIDHNSMNLHXFYI
Ga0192967_104983813300018730MarineHGEVNIIYFPLKMKFASIALVAVAAATTKHNQIMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMQIKGDLAKSGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192967_106287013300018730MarineHGEVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLAGAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193534_103548413300018741MarineMKFTALLLCGAIASSNAMDISDNQEKLYELMQLNTAECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVGKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193138_101983613300018742MarineMKFATLLFCGAIASTNAMAFSENQEKLYELMQLNSAECPKPLEISEDEMNYQLGEFSRNFQMENWTNAMHIKGKLNAKGVNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVSVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193138_102556813300018742MarineMKFTALLFCGVIASSSAMGFSENQEKLYELMQLNVENCPKPLEISEDELAYQLGEFSRNFQMENWDNAMHIKGKLNTKGAFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALDRFITVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193138_103060813300018742MarineMALQTEQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKKGLAKVGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193138_103245013300018742MarineKFATLALIGAASAVQVSDNQQMLYDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAAGGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193000_104709113300018745MarineSASNISRNQEMLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKAGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193392_104009913300018749MarineVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192963_105016813300018762MarineMKFAILALIGAASAVQVSDNQQMLYDLMAIQTSQVDAAGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0192827_107331813300018763MarineISDNQQMLYDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAAAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193031_102541113300018765MarineMQLNTQTCPEPLEITEDNMHYQLGEFSRNFQMDNWNNAMTIKGKLNKGGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNQNLSNGLALTRFVEVAKKCRANLNDKYDIGFIDPGVEGDWQ
Ga0193031_103520413300018765MarineMKFSALALLGAVSASNISNNQQKLYDIMALQTMQVDANGCPIPLDITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193031_104168813300018765MarinePKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGKLAGKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193031_104620313300018765MarineDCPKPLEISEDELNYQLGEFSRNFQMENWKNANHIKGKLNDKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFISVAKKVRSNLNDKYDIGFIDPGVEGDWQ
Ga0193031_108050613300018765MarineMKFTTLLFCGVIASTQAMAVSDNQNKLYELMQLNSESGECPKPLEIKEEELHYQLGEFSRNFQMESWNNAMYIKKKLNKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVKVAKQVRANLNDKYDIGFIDPGVEGDWQ
Ga0193181_102817413300018766MarineMKFAALLFIGAIASTTAMDVSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193306_103186413300018800MarineMKFTALLLCGAIASTSAMGLSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNANLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193183_104797913300018811MarineVSDNQERLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192829_105909613300018812MarineFAALLFIGAIASTTAMDVSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193053_105413013300018823MarineKFATLALLGAVSASNISNNQQKLYEIMALQTEQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKGKLAKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193048_104236213300018825MarineKFATLALIGAASAVQVSDNQQMLYDLMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKSGLAGTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193048_105980513300018825MarineITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192949_106978313300018831MarineFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0194240_100656913300018832MarineMQLQAEECPEPLDMTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFIEVAKKVRANLNDKYDIGFIDPGVEGDWQXAIRXVLNTGSA
Ga0192870_104582713300018836MarineFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193302_104434913300018838MarineKFTALLLCGAIATTTAMDVSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193219_103844513300018842MarineAALALLGAVSASNISSNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKAGLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193219_104041513300018842MarineMKFATLALIGAASAVQISDNQQMLYDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAAAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193219_107727813300018842MarineLNMKFTTAIFLAGAVASVDAYNLANNNQQRLYALMQTHSAECPEPLEISEEEMNYQLGEFSRHFDMKFWDNAMKIKEELGKQGKNPRFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNSLALSRFIEVAKKVRKNLNAKYDIGFIDPGVEGDWQ
Ga0193253_107303113300018846MarineMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLAGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193253_107420713300018846MarineMKFAALLFCGAICSTTAMDVSDNQEKLFELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193253_108663513300018846MarineMMLQEPVPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQMENWVNAMHIRDQLAAQGVSPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFVDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0193072_105709213300018861MarineKFTALLLCGAIASSNAMDISDNQEKLYELMQLNTAECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVGKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193533_106912513300018870MarineFTALLLCGAIASSNAMDISDNQEKLYELMQLNTAECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVGKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192978_107193313300018871MarineFPLKMKFASIALLGVAAATTKHNQVMLYNLMQLEEGGAPACPPPLAITEDELNYQLGEFSRNFDMKNWENAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192977_105429613300018874MarineKFAIAALLFAGVSKAIINVSTNQEQLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQXADSRVLNTGSTNQFIDHNSMNLHXFYI
Ga0192977_107337013300018874MarineMLFDIMALQTSQVDANGCPIPLAITEDELAFQLGEFSRNFNMDNWDNAMKVQSGLAGGGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDVGFIDPGVEGDW
Ga0192977_107620313300018874MarineKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0192977_107707623300018874MarineLALIGAASAVQVSDNQQMLYDLMAIQTSQVDAAGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGSGKVPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0192977_109884323300018874MarineKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLAGAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193027_107619413300018879MarineAECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVGKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193311_1003291013300018885MarineAIASTQAMGVSDNQDKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKGKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193090_108144813300018899MarineMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0193090_113309113300018899MarineSIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLAGAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193028_108461413300018905MarineKFSALALLGAVSASNISNNQQKLYDIMALQTMQVDANGCPIPLDITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193028_110278613300018905MarineGAICSTTAMDVSDNQEKLFELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMENWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192868_1004006313300018913MarineALLGATTSAHESNQAKLYDIMALQMTGADCPEPLEISEEELHYQLGEFSRNFNMENWNNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFISVAKKVR
Ga0192868_1004939213300018913MarineYDIMALQMTGADCPEPLEISEEELHYQLGEFSRNFNMENWNNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFISVAKKVR
Ga0192989_1010731313300018926MarineKFIAIAALLGATASAHESNQAKLYDLMQLQVSGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFVQVAKKVR
Ga0192820_1013846213300018932MarinePLAITEDELHYQLGEFSRNFDMKNWDNAMEIKGKLAEQGITPKFAVTTKELYDHSFSFPKVRNYDYAVQQMSELEHYEDNLNANLSKFALTRFIEVAKKVRANLNDKYDIGFIDPGVEGD
Ga0193379_1015350413300018955MarineALALLGAVSASNISHNQQKLYEIMALQTEQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEIKGKLAKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193178_1002074013300018967MarineMKFTALLLCGAIASTTAMDVSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192894_1021683713300018968MarineEITNPACPEPLELTEDELHYQLGEFSRNFDLKNWGNAMHIKGELGKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192873_1029893513300018974MarineNQQMLYDLMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193353_1014765423300018977MarineMKFTALLFCGVIATSEAMSLSDNQEKLYELMQLNTESGECPKPLKIEEDEMHYQLGEFSRNFNMESWNNAMYIKKKLNKKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVKVAKQVRANLNDKYDIGFIDPGVEGDWQ
Ga0193540_1010573913300018979MarineTTAMDVSDNQEKLFELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVGKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192961_1009413613300018980MarineMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192961_1012421713300018980MarineMKFAALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192961_1013595513300018980MarineMKFIAIAALLGATTSAQMSNQDKLFDLMALQISGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAGKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSYALQKFVQVAKKVR
Ga0192961_1013623713300018980MarineMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELHYQLGEFSRNFDQKNWDNAMQIKTGLAGQGATPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192961_1013798013300018980MarineHGEVNIIYFPLKMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAETGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192961_1013928613300018980MarineMKFIAIAALLGATTSAHATSNQAKLYDLMQLQIQGADCPEPLEISEEELHYQLGEFSRNFNMEHWSNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSYALQKFVQVAKKVR
Ga0192961_1014860513300018980MarineTWDIFFPLKMKFATALLFAGAVTASVSENQERLYEIMNLQIADPTCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEVAAGLAKSGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFVDPGVEGDW
Ga0192961_1015087413300018980MarineHGEVNIIYFPLKMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFAQVNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192961_1015767913300018980MarineQKLYDLMALQTMQVDANGCPIPLDITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192961_1016387223300018980MarineTMLYNLMQLEEKDCPPPLAMTEDELHYQLGEFSRNFDMKNWENAMKIRGNLAESGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192961_1017658713300018980MarineTWELQNGVEGVDCPPPLEITEEEMNYQMGEFSRNFKMENWDNAVKIKNALAEKGKKVKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNNTNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192968_1011516013300018981MarineVQVSDNQQMLYDLMAIQTSQVDAAGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0192947_1014243313300018982MarineTWGIAMKFVFMLGAVAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0192947_1015697713300018982MarineLAIATSTNTCPDPLEISEDSLHYQLGEFSRNFAQVNWDNAMEIKKQLNKQGVNPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNLSNNPALERFVAVAKRVRANLNDKYDIGFIDPGVEGDW
Ga0192947_1020660213300018982MarineAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELHYQLGEFSRNFDQKNWDNAMQIKTGLAGQGATPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192947_1029631313300018982MarinePPLEISEDNMHYQLGEFSRKFLMANWNNAMKIKAELDKDGKQHKFAVTTKELYDKSFSFPKVRYYDYAVEQMTELEHFEDNLNNNQSNELALVRFIKVAKKVRANLNKKYDIGFVDPGVEGDW
Ga0193554_1017145213300018986MarineMKFTALLLCGAIATTTAMDVSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVGKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193030_1010163223300018989MarineMKFVSLLFCGALASANAMEFSEMTNQDKLYDLMQLQNCPKPLEISEDELNYQLGEFSRNFQMENWNNANHILKKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNGLALERFISVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193030_1010406213300018989MarineMKFTALLFCGAIASTQAMGLKDNQEKLYELMQLNAESADCPKPLEISEDELNYQLGEFSRNFQMENWKNANHIKGKLNDKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFISVAKKVRSNLNDKYDIGFIDPGVEGDWQ
Ga0193030_1010926813300018989MarineMKFTALLFCGVIASTQAMGVSDNQDKLYELMQLNTEAGECPKPLEIKEEELHYQLGEFSRNFQMENWNNAMYIKKKLAKKGISPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNNNLSNGLALDRFIKVAKQVRANLNDKYDIGFIDPGVEGDWQ
Ga0193030_1012545613300018989MarineAMAVSDNQNKLYELMQLNSESGECPKPLEIKEEELHYQLGEFSRNFQMESWNNAMYIKKKLNKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFVKVAKQVRANLNDKYDIGFIDPGVEGDWQ
Ga0193030_1012950213300018989MarineMKFSALALLGAVSASNISNNQQKLYDIMALQTMQVDANGCPIPLDITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLGKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193030_1013414413300018989MarineMKFAALALLGAVSASNISHNQERLYEIMALQTQQVDANGCPIPLEISEDELQYQLGEFSRNFNMDKWDNAMKVKAGLAKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193030_1014536913300018989MarineLNECPKPLEITEDELAYQLGEFSRNFQMENWTNAMHIKGKLAGKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193030_1015112613300018989MarineECPKPLKIEEEELHFQLGEFSRNFQMENWKNAMYIKDKLNKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVTVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193030_1015296713300018989MarineMKFIAIAALLGATTSAQMSNQDKLFDLMALQISGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFVQVAKKVR
Ga0193030_1016239513300018989MarineNQEKLYDLMQLNSGECPKPLEITEEEMHYQLGEFSRNFQMENWNNAQYIKKKLAKKGIFPKYAITTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0193030_1016622813300018989MarineSIYSNQEKLYEIMALQTESQQVDANGCPIPLEITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLGKVGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193030_1019214213300018989MarineCPPPLEISEDNLHYQLGEFSRNFQMENWVNAMHIRDQLAAQGVSPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFVDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0193030_1023508923300018989MarineMKYIALLFCGVIASSQAMGFSDNQEKLYDLMQLNECPKPLEISEEELHYQLGEFSRNFQMENWKNAMHIKDKLNKKGVNPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193034_1005520613300019001MarineLATTEATLSSNQSKLYMLMQLQNCPPPLEISEDNLHYQLGEFSRNFQMVNWDNAMEIAGKLRAGGGAPKVAVTTFDLYNKSFSFPKVRNYDYAVTQMNELEAANDNLNTNLSNGLALKKFLEVAKRVRANLNDKYDIGFVDPGVDGDW
Ga0193034_1006689213300019001MarineYNLMQLESETEYRSRDGEISSPSCPPPIEISEDELHYQLGEFSRNFDMKNWNNAMHVKGELAKQGKNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193034_1017111113300019001MarineAIQNCPEPLEISEDNLHYQLGEFSRNFQMENWNNAMEIKDKLGKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNLSNTLALDRFVKVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192880_1008467313300019009MarineMKFAALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLAKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193044_1012521613300019010MarineQNCPPPLEISEDNLAYQLGEFSRNFQMVNWDNANEIAGKLRAGGGKPKFAVTTSDLYNKSFSFPKVRNYDYAVTNMDELIAANDNLNANLSNGLALKKFLEVAKRVRSNLNDKYDIGFTDPGVDGDWQ
Ga0193044_1017543513300019010MarineQMLYDLMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKSGLAGTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193044_1019216513300019010MarineANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLAKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193569_1024580313300019017MarineMKFTALLFIGAIASTSAMDTSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMENWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192982_1021099313300019021MarineMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192982_1021488513300019021MarineMGNQVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192982_1021787213300019021MarineQQMLYDLMAIQTSQVDAAGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGSGKVPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0192951_1019011413300019022MarineAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192951_1020220813300019022MarineIINVSDNQERLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0192951_1025135413300019022MarineMKFATLALIGAASAVQVSDNQQMLYDIMALQTSQVDANGCPVPLAMTDDELAYQLGEFSRNFNMDNWDNAMKVKSGLAAGGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192951_1035403413300019022MarineMGPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAGSGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193545_1008015513300019025MarineCGAIATTSAMDVSDNQEKLYELMQLNTAECPKPLEITEDEMHYQLGEFSRNFQMESWSNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192909_1008119313300019027MarineMKLASILLLGSVSAFYEFPQNNQEQLYNLMELNSEKEDCPPPLEMTQEELNYQLGEFSRNFRMENWDNAVKIKNAIEKKGKKAKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNNMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGYWQ
Ga0192909_1012079113300019027MarineQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWSNAMHIKEKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193516_1016553513300019031MarineMKFIAIAALLGATTSAHESNQAKLYDIMALQMTGADCPEPLEISEEELHYQLGEFSRNFNMENWNNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFISVAKKVR
Ga0193516_1025558913300019031MarineMLYNLMQLEEQGAPANCPPPLEISEDELAYQLGEFSRNFDMKNWDNAMEIKGKLQGSGANPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193516_1031040213300019031MarineSAFAVSDNQHRLYELMQLNECPPPLEITEDNMHYQLGEFSRNFQMDNWNNAMTIKGKLNKAGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELDHYEDNLNQNLSNGLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192869_1022345313300019032MarineLYEIMALQTQQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKKGLGKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192869_1022839313300019032MarineMKFVALALLGAVSASSIYSNQEKLYEIMALQTESQQVDANGCPIPLEISEDEMQYQLGEFSRNFNMDNWDNAMKVKAGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192869_1023520413300019032MarineMKFATLALIGAASAVQVSDNQQMLYDLMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLPNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGYW
Ga0192869_1027201913300019032MarineMKFIAIAALLGATTSAHESNQAKLYDIMALQMTGADCPEPLEISEEELHYELGEFSRNFNMQNWNNAQKIADGLAKAGKAPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFISVAKKVR
Ga0192869_1031840113300019032MarineMKFTALLFCGAIASTQAMGFAENQEKLYELMQLNAENCPKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGKLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRSNLNDKYDIGFVDPGVEGDWQ
Ga0192869_1039808013300019032MarineMKFTALLFCGVIASTQAMGVSDNQNKLYELMQLNSDSGNCPAPLEVSEDEMHYQLGEFSRNFQMESWNNALYIKKKLAKKGVFPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFIKVAKQVRANLNDKYDIGFIDPGVEGDWQ
Ga0192869_1047685813300019032MarineTSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAGAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193037_1011389113300019033MarineMKFTSAIALLGAVTATSRHNQVMLYNLMQLESETGYMSRDGEITNPACPEPLEITEDELHYQLGEFSRNFDLKNWGNAMHIKGELAKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193037_1017123713300019033MarineMKFTSVLVLAGVAASSRHNQVMLYNLMQLEAETEYRSRDGEINKPECPEPIAITEDELHYQLGEFSRNFDMKNWNNAMHVKGELAKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIDVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193037_1024335323300019033MarineMKFTALLFCGAIATTQAFSDISNQEKLYDLMQLNECPKPLEIKEEELHYQLGEFSRNFQMENWKNAMYIKDKLNKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0192945_1010774813300019036MarineMKFAFLLVAGASAILSDNQEKLFLAIATSTNTCPDPLEISEDSLHYQLGEFSRNFAQVNWDNAMEIKKQLNKQGVNPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNLSNNLALERFVAVAKRVRANLNDKYDIGFIDPGVEGDW
Ga0192945_1013542013300019036MarineTQAISDNQGKLYELMQLNSESGECPKPLEIKEEELHYQLGEFSRNFQMENWNNAMYIKKKLAKKGINPKFAVTTKELYDKSFSFPKVRNYDYAMQQMNELEHYEDNLNTNLSNGLALERFVKVAKQVRANLNDKYDIGFIDPGVEGDWQ
Ga0192945_1013807213300019036MarineMKFAALALLGAVSASNISHSQQKLYDLMALQTMQVDANGCPIPLDITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192945_1019037413300019036MarineNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0192981_1022367213300019048MarineMKFASIALLGVAAATSKHNQVMLYNLMQLESEGAPACPPPLAITEDELNYQLGEFSRNFDNKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192981_1022564113300019048MarineMGNCKVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLESEGAPACPPPLAITEDELNYQLGEFSRNFDNKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192981_1022919213300019048MarineHGEVNIIYFPLKMKFASIALVAVAAATTKHNQIMLYNLMQLEEQGAPACPPPLAVTEDELNYQLGEFSRNFDMKNWDNAMQIKGDLAKSGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192981_1023656713300019048MarineNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0192981_1028404613300019048MarineNLMQVEEMDCPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRGDLAGSGQNPKFAVTTKELYDKSFSFPKVRNYDYAVSQMNELEHYEDNLNANLSNTLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192966_1016507913300019050MarineMKFATLALIGAASAVQVSDNQQMLYDLMAIQTSQVDAAGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNLSNNLALERFVAVAKRVRANLNDKYDIGFIDPGVEGGW
Ga0192966_1019944113300019050MarineLKMKFASIALVAVAAATQKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMQIKGDLAKAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192966_1020638213300019050MarineMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLAGAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192826_1012626913300019051MarineMKFGLAIAALAASTEAMLSSNQSKLYMLMQLQNCPPPLEISEDNLAYQLGEFSRNFQMVNWDNANEIAGKLRDAGAKPKFAVTTKDLYDKSFSFPKVRNYDYAVANMNELEAAQDNLNANLSNGLALKKFLEVAKRVRANLNDKYDIGFVDPGVDGDW
Ga0192826_1013426713300019051MarineMKFTALLFCGAIASAQAMGLKDNQEKLYELMQLNVEAADCPKPLEISEDELNYQLGEFSRNFQMENWKNANHIKKKLNEKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNGLALDRFV
Ga0192826_1016270413300019051MarineMKFTALLFCGAIASSQAMGISDNQEKLYELMQLNAEECPKPLEISEDELNYQLGEFSRNFQMENWKNAQHIKKELNEKGVYPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNGLALDRFINVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192826_1016303513300019051MarineFCGVIASSQAMGFSDNQEKLYELMQLNSAECPKPLEITEEEMQYQLGEFSRNFQMENWKNAMHIKDKLNKKGVFPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNSLALERFISVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192826_1020123513300019051MarineNCPKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGKLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNSLALERFISVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0192826_1021938013300019051MarineQQMLYDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAAAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192826_1023666413300019051MarineENQEKLYDLMQLNECPKPLKIEEEELHFQLGEFSRNFQMENWKNAMYIKDKLNKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVTVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0192826_1026541113300019051MarineSNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKIKAGLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRF
Ga0192826_1028936113300019051MarineMQLQVSGADCPEPLEISEEELHYQLGEFSRNFNMENWNNAQKIAEGLSKQGKNPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFIQVAKKVR
Ga0192826_1033548523300019051MarineVSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192992_1017399613300019054MarineMSRDGEITNPACPEPLELTEDELHYQLGEFSRNFDLKNWGNAMHIKTELGKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188838_10670813300019081Freshwater LakeMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKIKSALAKTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0188866_101388213300019095Freshwater LakeMKFAIAALLFAGVSQAIINVSDNQERLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQXAFGXVLNTGSTMIVTQXNCIDFTYNII
Ga0188866_101494813300019095Freshwater LakeMKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0188866_101698713300019095Freshwater LakeMMLQEPVPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQMENWVNAMHIKDQLSSQGVSPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0188866_101777513300019095Freshwater LakeMKFAALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188866_101841313300019095Freshwater LakeMKFAVLALIGAVSAAPVSHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNAQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188866_101876613300019095Freshwater LakeNMKFATLALIGAASAVQVSDNQQMLYDIMALQTSQVDANGCPIPLAITDDELAYQLGEFSRNFNMDNWDNAMKVKAGLAAGGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188866_101973523300019095Freshwater LakeMTEDELHYQLGEFSRNFQMVHWDNAMKIRGSLLAQGQKAKVAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNISNKLALTRFIEVAKKVRANLNDKYDIGFIDPGTEGDW
Ga0188866_102151013300019095Freshwater LakeFPLKMKFTTALLFAGAVTASVSENQERLYEIMNLQTADCPPPLEISEEELQYQLGQFSRNFEMTNWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188866_102377113300019095Freshwater LakeMKFASVLASVAMVNGLTRHISNQDLLQEIMMLQQDCPEPLEISEDNLHYQLGEFSRNFEMENWDNAMHIKNELAEAGTSVKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNNNLSNQLALKRFVDTAKQVRANLNDKYDIGFIDPGVDGDWQ
Ga0193153_101438113300019097MarineMKFAALALLGAVSASNISHNQERLYEIMALQTQQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKAGLGKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193153_101753213300019097MarineMGKVNIIYFPLKMKFASIALAGVVAATSKHNQVMLYNLMQLEEKGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0194243_100492413300019102MarineMALQTMQVDANGCPIPLDITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193243_103154813300019116MarineLQSEAQDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKTGVNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193243_103325213300019116MarineDQQKLYDIMALQTMQVDANGCPIPLDITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193054_104032613300019117MarineMKFVSLLFCGALASANAMGFSEMTNQDKLYDLMQLQNCPKPLEISEDELNYQLGEFSRNFQMENWNNANHILKKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNANLSNSLALERFISVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0193157_102029213300019118MarineEKLENLMQLNECPKPLEISEEELHYQLGEFSRNFQMENWSNAMHIKGKLAKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0193157_102758413300019118MarineQTCPEPLEITEDNMHYQLGEFSRNFQMDNWNNAMTVKGKLNKGGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNQNLSNGLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192980_106125813300019123MarineMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0192980_106653413300019123MarineATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192980_108394213300019123MarineQGAPACPPPLAVTEDELNYQLGEFSRNFDMKNWDNAMQIKGDLAKSGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0192980_108581013300019123MarineMGNCKVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLESEGAPACPPPLAITEDELNYQLGEFSRNFDNKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193436_104214213300019129MarineQQKLYDIMALQTMQVDANGCPIPLEISEDELQYQLGEFSRNFNMDNWDNAMKVKAGLAKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193249_106623313300019131MarineAMLSSNQSKLYMLMQLQNCPPPLEISEDNLAYQLGEFSRNFQMVNWDNANEIAGKLRAGGGKPKFAVTTSDLYNKSFSFPKVRNYDYAVTNMDELIAANDNLNANLSNGLALKKFLEVAKRVRSNLNDKYDIGFTDPGVDGDWQ
Ga0193249_107427413300019131MarineMKFAIAALLFAGVSQAIINVSDNQERLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0193249_109796313300019131MarineATLALIGAASAVQVSDNQQMLYDLMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKSGLAGTGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193249_110139413300019131MarineMSQVDANGCPIPLAITEDELAFQLGEFSRNFNMDNWDNAMKVKEGLSGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0193249_110629213300019131MarineHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0193089_109960213300019133MarineSDNQERLFGLMQLQSSECPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0193089_109995513300019133MarineMGIFFPLKMKFATALLFAGAVTASVSENQERLYEIMNLQMADCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEVAAGLAKSGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFVDPGVEGDW
Ga0193089_112964313300019133MarineAWVPQHAHHHLPSQDELNYQLGEFSRNFAQVNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188870_1007928413300019149Freshwater LakeKFTSIIALFAGASASSNQEFLYSLMQLDAEACPPPLEITEDNLHYQLGEFSRNFKMDNWDNAQHILSELSKGGSNPKFAVTTKELYDKSFSFPKVRNYDFAVQNMNDLEAAEDNLNTNLSNGLALQRFLKTAKKVRANLNDKYDIGFIDPGVDGDWQ
Ga0188870_1008556913300019149Freshwater LakeMMLQEPVPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0188870_1009275113300019149Freshwater LakeKFAAMFGATAAITHEITNQEMLYEINFLMNCPEPLEISEDNLHYQLGEFSRNFEMENWDNAMHIKSELADQGSNPKYAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNNNLSNQLALKRFVDTAKAVRENLNAKYDIGFIDPGVDGDWQ
Ga0188870_1009734113300019149Freshwater LakeFELMQLNIAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0188870_1009904813300019149Freshwater LakeMKFAVLALIGAVSAAPVSHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNAQKILAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188870_1011812823300019149Freshwater LakeSVAADNQEYLFELMQLQDPNCPPPLAMTEDELSYQLGEFSRNFQMVHWENAMKIRGSLLAQGQKPKVAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNISNKLALTRFIEVAKKVRANLNDKYDIGFIDPGTEGDW
Ga0188870_1012781413300019149Freshwater LakePLAITDDELAYQLGEFSRNFNMDNWDNAMKVKAGLAAGGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0188870_1014396213300019149Freshwater LakeMQMQKEEDCPPPLELTQEELNFQLGEFSRNFKMENWDNAVKIKKAIEEKGKKPNFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNIMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0192975_1017001313300019153MarineNMKFAIAALLFAGVSKAIINVSTNQEQLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQXADSXVLNTGSTNQFIDHNSMNLHXFYI
Ga0192975_1029681213300019153MarinePACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0180036_102579013300019200EstuarineMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182097_115721813300019261Salt MarshFPLKMKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182066_102975223300019262Salt MarshVALLGLASVEAKHSKHHNQAMLYNLMQIDAQADPACPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRAELADKGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182066_105456713300019262Salt MarshFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182061_166947213300019266Salt MarshEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182059_121603813300019272Salt MarshKFAIVALLGLASVEAKHSKHHNQAMLYNLMQIDAQADPACPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRAELADKGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182059_128290413300019272Salt MarshKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182059_156685413300019272Salt MarshMKFTALALLGAVSASHISSNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKIKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182073_105020013300019274Salt MarshKFGVFLALAGVASATVSENQMKLFAAMQKEECPEPLEISEEELQYQLGEFSRNFKEENWKNAMEIKKELNEKGIFPRYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNNNISNKYHLDKFLEVAKKVRKNLNDKYDIGFIDPGVEGDWQ
Ga0182073_158749613300019274Salt MarshKFTTALLFAGAVSASYSDNQEKLYEIMNLQMADPACPPPLEISEDELSFQLGSFSRNFEMTHWNNAMEIAAGLSKKGVKPKIVVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNPSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGTEGDW
Ga0182067_170778813300019276Salt MarshKFTSTILMAGVLASVEAYRLSEHNQQKLYTLMQTGAAECPEPLEISEEELNYQLGEFSRHFDMKYWDNAMKIQEELGKQGKNPKFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNSLALTRFIEVAKKVRKNLNDKYDIGFIDPGVEGDW
Ga0182068_162160413300019280Salt MarshATALLVGAASAYTTLNQEMLYEFINLQDEELAPAAPTAGCPPPLEISEEELSYQLGQFSRNFEMTHWNNAMEIAAGLSKKGVKPKIVVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNPSNKLALTRFIEVSKKVRANLNDKYDIGFIDPGTEGDW
Ga0182058_137978913300019283Salt MarshMKFTALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182058_140064213300019283Salt MarshMKFAIVALLGLASVEAKHSKHHNQAMLYNLMQIDAQSDPACPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRAELADKGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182086_115077913300020013Salt MarshAYRLSEHNQQKLYTLMQTGAAECPEPLEISEEELNYQLGEFSRHFDMKYWDNAMKIKEELGKQGKNPKFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNSLALTRFIEVAKKVRKNLNDKYDIGFIDPGVEGDW
Ga0182086_127925713300020013Salt MarshPLKMKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0182044_116385313300020014Salt MarshMKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206124_1038433613300020175SeawaterLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0206129_1021085813300020182SeawaterMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206126_1030396213300020595SeawaterMKFAVLALIGAVSAAPVSHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNSQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206677_1023766613300021085SeawaterMKFAIVALLGLASVEAKHNQAMLYNLMQLDAQADPACPPPLAITEDELHYQLGEFSRNFDIKNWENAMTIRSGLAGSGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206687_108400313300021169SeawaterMKFTIAALVFIGAMTSVEAIDTHATVSNQSKLYSLMQLNECPEPLEVTEEELHHQLGLFSRHLEKQYWENAMTIKTGLAKAGVFPKIAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNIENSHHFAQFLEVAKRVRSNLNAKYDIGFCDPGVEGDWQ
Ga0206687_143974813300021169SeawaterFPLKMKFASIALIGSVAAIGTAKHNQVMLFNLMQLEEQGGPACPPPLEISEDELAYQLGEFSRNFDMHNWDNAMEIKGKLQGNGANPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206687_169530913300021169SeawaterQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMQIKGDLAKAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206687_194596013300021169SeawaterMKFAIVALLGLASVEARHNQAMLYNLMQLETQADPACPPPLAITEDELHYQLGEFSRNFDIKNWENAMTIRSGLAGSGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206687_199846113300021169SeawaterMKFAALLFCGAICSTTAMDYSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0210301_120154113300021325EstuarineFPLKMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0210307_137498613300021336EstuarineMKFATALLFAGAVTATVSENQEKLYEIMNLQMADPACPPPLEISEEELAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206691_110131013300021342SeawaterMKFTILALLGAASARHNQVMLYNLMQLEAEESYHSRDGEISNPACPPPIDITEDELHYQLGEFSRNFDMKNWQNAMHVKGELAKSGKNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNTLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206691_112638013300021342SeawaterMKFFALVMMAGAASAITDNQNKLYELMQLNSAECPEPLEITEDNMHYQLGEYSRNFQQVNWDNAMKIKGKLNKAGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLGNSLAL
Ga0206691_122040413300021342SeawaterMKFTLLALLGAVSASTSRHNQVMLYNLMQLEAETGYESRDGPINKAECPPPIEETEDEMHYQLGEFSRNFDMKNWNNAMYIKGKLNGGGKNPKFAVTTKELYDKSFSFPKVRNYDYAVAQMNELEHYEDNLNSNLSNSLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206691_138881713300021342SeawaterMKFIVAAALFAATTSARESNQAKLYDLMQLQISGADCPEPLEISEEELHYQLGEFSRNFNMENWDNAMKINAGLSKEGKSPKFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNGYALQKFVAIAKKVR
Ga0206688_1008016113300021345SeawaterMKFIAIAALLGATTSAQMSNQDKLFDLMALQISGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAGKIADGLAKAGISPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSYALQKFVQVAKKVR
Ga0206688_1013909213300021345SeawaterMLYNLMQLESETSYRSRDGEITSPSCPPPIELTEDELHYQLGEFSRNFDMKNWNNAMHIKGELAKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206688_1023596113300021345SeawaterKFIAVAALLAATTSAHESNQAKLYDLMQLQITGADCPEPLEISEEELHYELGEFSRNFNMENWANAMKIKDGLEKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNQYALQKFVQVAKKVR
Ga0206695_123646013300021348SeawaterKFTIVAALLGAATATSRHNQVMLYNLMQLESETEYRSRDGEISSPSCPAPIEISEDELHYQLGEFSRNFDMKNWNNAMHVKGELGKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206695_177850013300021348SeawaterMKFASIALVAAAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMQIKGDLAKAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206692_121167413300021350SeawaterKFAALLFCGAICSTTAMDYSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0206692_133196713300021350SeawaterSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLAGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206693_112723713300021353SeawaterDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0206693_171182013300021353SeawaterMKFAIVALLGLASVEARHNQAMLYNLMQLETQADPACPPPLAITEDELHYQLGEFSRNFDIKNWENAMTIRSGLAGSGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206690_1006538413300021355SeawaterKFIAVAALLAATTSAQETNQVKLYELMQLQVSGADCPEPLEISEEELHYELGEFSRNFNMENWNNAMKISDGLAKAGKTPRFAVTTKELYDHSFSFPKVTNYDYAVENMNELEHYEDNLNKPFRTLMLCRSLSLSPRKSDRI
Ga0206690_1040199713300021355SeawaterAIMLFASAEAMISNQEKLYELIELQGCPEPLEMDEDNLHYQLGEFSRNFQMENWNNAMEIKKELGKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNSNLSNSLALDRFIKVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0206689_1008284613300021359SeawaterKFIAVAALLAATTSAHESNQVKLYELMQLQISGADCPEPLEISEEELHYELGEFSRNFNMENWNNAMKISDGLAKAGKTPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFISVAKKVR
Ga0206689_1025497013300021359SeawaterMKFTSVVALLGAVEATSRHNQVMLYNLMQLESTSGYMSRDGEITNPACPEPLEVSEDELHYQLGEFSRNFDMKNWGNAMYIKGELGKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVAQMNELEHYEDNLNSNLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206689_1028164013300021359SeawaterFIVAAALFAATTSARESNQAKLYDLMQLQISGADCPEPLEISEEELHYQLGEFSRNFGMENWDNAMKISAGLSKEGKSPKYAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNGYALQKFIAVAKKVR
Ga0206689_1053796213300021359SeawaterASIALIGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0206689_1115570213300021359SeawaterMQLNVEGCPPPLEITEDNMHYQLGEFSRNFNMENWTNAMTIKGKLNKAGVFPKYSVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNNNLGNSLALNRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0206123_1016541423300021365SeawaterMKFAIVALLGLVSVEAKHSRHHNQAMLYNLMQIDAQADPACPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRGELADKGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0213861_1023169713300021378SeawaterMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMTAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0213864_1043867213300021379SeawaterPLQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKIKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0213868_1041681113300021389SeawaterLKMKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063132_10315313300021872MarineFPLKMKFASIALIGAAAATSKHNQVMLYNLMQLEEKGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063132_11180913300021872MarineAILALVAAVSAKYSNQQKIYTLMQLNSADPACPPPLDISEDNLHYQLGEFSRNFKMENWNNAMEIAGKLKGDGQQVKLAVTTKELYDKSFSFPKVRNYDYAVENMNELEAAEDNLNKNISNGLQLKRFIEVAKKVRANLNAKYDIGFIDPGVDGDW
Ga0063132_11533213300021872MarineMKFAALLFCGAICSTTAMDVSDNQEKLFELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMENWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0063132_12221113300021872MarineFPLKMKFASIALIGAAAASKQHNQVMLYNLMQLEEQGAPACPPPLTISEDELNYQLGEFSRNFDQKNWDNAMEIKDKLAGQGINPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063147_11748513300021874MarineAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKADGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063124_10304613300021876MarineMKFTIVALLGAVSATSRHNQVMLYNLMQLEAETGLEYASRDGEINKAECPPPLDITEDEMHYQLGEFSRNFDMKNWNNAMHIKGELGKGGKNPKFAVTTKELYDKSFSFPKVRNYDYAVAQMNELEHYEDNLNANLSNNLALTRFIDTAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063117_101120113300021881MarineMKFTALLFCGVIASSQATGFSDNQEKLYDLMQLNECPKPLEISEEELHYQLGEFSRNFQMENWKNAMHIKDKLGKQGKFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0063105_101007613300021887MarineFPLKMKFTSIALLGVAAATSKHNQVMLYNLMQLDVEDPVACPPPLTISEDELNYQLGEFSRNFDQKNWDNAMEIKGGLAGSGANPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063089_102586013300021889MarineLKMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063089_104154013300021889MarineKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0063136_102885013300021896MarineMKFTALLFCGVIASSQAMGFSDNQEKLYELMQLNTAECPKPLEITEEELSYQLGEFSRNFQMENWKNAMHIKDKLNKKGVNPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0063873_105248613300021897MarineKFAIAALLFAGVSQAIINVSDNQERLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGSSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0063086_100295913300021902MarineKFILALLGSAAAMQMHSTNTNQEKLFILMQMQKGEDCPPPLELTQEELNFQLGEFSRNFKMESWDNAIKIKKSLEEKGGKKPQFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNIMNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0063086_100945613300021902MarineMKFATLALIGAASAVQVSDNQQMLYDIMALQMSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063086_103660913300021902MarineKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063088_100143513300021905MarineFPLKMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063135_109416213300021908MarineVIASSQAMGFSDNQEKLYELMQLNTAECPKPLEITEEELSYQLGEFSRNFQMENWKNAMHIKDKLNKKGVNPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0063106_103380413300021911MarineMKFASIALVAVAAATTKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGDSGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063106_105631413300021911MarineKMKFTSIALLGVAAATSKHNQVMLYNLMQLDVEDPVACPPPLTISEDELNYQLGEFSRNFDQKNWDNAMEIKGGLAGSGANPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063133_101193713300021912MarineMKFTALLFCGAIASTQAMGLKDNQEKLYELMQLNAESADCPKPLEISEDELNYQLGEFSRNFQMENWKNANHIKKKLNDKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALDRFV
Ga0063133_103807613300021912MarineMKFTALLFCGVIASSQAMGFSENQEKLYELMQLNSAECPKPLEITEEELHYQLGEFSRNFQMENWKNAMHIKDKLNKKGVFPKYAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0063133_110063713300021912MarineKFAALALLGVVSAYHTSNQDKLYEIMALQVESQQVDANGCPIPLEITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLGKVGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063104_101642213300021913MarineFPLKMKFTSIALLGVAAATSKHNQVMLYIPIMQLDVEDPVACPPPLTISEDELNYQLGEFSRNFDQKNWDNAMEIKGGLAGSGANPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063104_103781013300021913MarineLKMKFASITLLGVAAATSKHNQVMLYNLMQLEAETTPACPPPLAITEDELNYQLGEFSRNFDNKNWDNAMEIKGKLAETGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063104_103810413300021913MarineKFATLALLGAVSATGDNQQMLYDIMALQMSQVDANGCPIPLAITEDELAFQLGEFSRNFNMDNWDNAMKVKEGLAAGGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDVGFIDPGVEGDW
Ga0063104_105898413300021913MarineQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGDSGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063870_101661813300021921MarineMKFATLALLGAVSATSDNQQMLYDIMALQMSQVDANGCPIPLAITEDELAFQLGEFSRNFNMDNWDNAMKVKEGLGGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063870_102952113300021921MarineKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063870_103296013300021921MarineAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063870_103606913300021921MarineGAASATQISHNQERLYELMNLQTEGPTFGYVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0063870_114344913300021921MarineFVFMLGAVAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQMENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFVDTAKKVRENLNAKYDIGFIDPGVDGDW
Ga0063869_102168413300021922MarineMKFATLALIGAASAVQVSDNQQMLYDIIALQMSQVDANGCPIPLAVTEDELAYQLGEFSRNFNMDNWDNAMKVKSGLAGSGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063085_102017413300021924MarineKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGYVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0063096_105671113300021925MarineKFAALALIGAVSASNISHNQERLYEIMALQTGSTFEYSKKVDANGCPIPLEITEDELQYQLGEFSRNFNMDNWDNAMKVKGGLAKVGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0063096_106586013300021925MarineFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKTGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063103_100796813300021927MarineIYFPLKMKFTSIALLGVAAATSKHNQVMLYNLMQLDVEDPVACPPPLTISEDELNYQLGEFSRNFDQKNWDNAMEIKGGLAGSGANPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063103_102088313300021927MarineFPLKMKFASIALVAVAAATTKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGDSGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063103_110488913300021927MarineKFAIAALLFAGVSQAIINVSDNQERLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0063103_113324013300021927MarineLIGMVAATSITRHNQVMLFNLMQLEEQDCPPPLAMTEDELHYQLGEFSRNFDMKNWENAMKIRGDLAGNGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNNLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0063134_107736313300021928MarineCPIPLEISEDELQYQLGEFSRNFNMDKWDNAMKVKAGLAKAGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063145_102301813300021930MarineMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063145_104626113300021930MarineVALALLGAVSASYSNQDKLYEIMALQTQQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKKGLAKVGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063872_102525113300021932MarineASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063756_110554313300021933MarineKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063139_102172313300021934MarineYELMQLNAENCPKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGKLAGKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0063139_102352213300021934MarineMKFAALLFCGAICSTTAMDVSDNQEKLFELMQLNIAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0063139_107564813300021934MarineLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063754_105197213300021937MarineLFAGVSQAIINVSDNQERLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0063095_103192113300021939MarineKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063108_106297613300021940MarineFAIAALLFAGVSQAIINVSDNQERLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0063102_101609713300021941MarineLKMKFTSIALLGVAAATSKHNQVMLYNLMQLDVEDPVACPPPLTISEDELNYQLGEFSRNFDQKNWDNAMEIKGGLAGSGANPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0063102_102766013300021941MarineMKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0063102_104369513300021941MarineKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSSLAKAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0063101_101336713300021950MarineFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0063755_101568013300021954MarinePPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0222713_1035641113300021962Estuarine WaterPKPQNPFNLNKIQNNIIYIPLKMKFATALLFAGAASANISHNQEKLYEIMNLQTTDCPPPLEISEEELAYQLGQFSRNFEMVNWNNAMQIAGELAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNGLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGD
Ga0222713_1043478413300021962Estuarine WaterMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNAKYDIGFIDPGVDGDW
Ga0222719_1058685523300021964Estuarine WaterPQNPKTPLKDNILLIIIIIIPLNMKFTTLLLIAGASAYNLGQHNQQKLYALMQTGAPECPEPLEISEEELNYQLGEFSRHFDMKFWDNAMKIKDELSKKGINPRFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNISNSLALTRFIEVAKKVRKNLNDKYDIGFIDPGVEGDWQ
Ga0222719_1060648413300021964Estuarine WaterMALQTSDAGCPEPLDMTEDELHYQLGEFSRNFNMENWTNAMKIKDELAKKGKDVKIAVTTKELYDHSFSFPKVRNYDYAVQNMNELEHYEDNLNNNISNNYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0224906_120854513300022074SeawaterALLLFGAIASTNAMGVSDNQEKLYELMQLNTQECPKPLEISEDELNYQLGEFSRNFQMESWNNAMHIKGKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0210311_104295613300022374EstuarineEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0210313_103563413300022375EstuarineFPLKMKFATALLFAGAVTATVSENQEKLYEIMNLQMADPACPPPLEITEEELAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0255784_1049648113300023108Salt MarshMKFAALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLN
Ga0255743_1058755213300023110Salt MarshMKFTALALLGAVSASHISSNQEKLYEIMALQTETQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKDKLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLA
(restricted) Ga0233410_1008628823300023276SeawaterMKFTIAALVFIGAMTSVEAIDTHANLSNQSKLYSLMQLNECPEPLEISEEELHHQLGLFSRHLEQQYWENAMTIKTGLAKAGVFPKIAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNIENSHHLAKFVEVAKRVRENLNAKYDIGFVDPGVDGDWQ
Ga0232120_10520313300023555SeawaterLKMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0232120_10699113300023555SeawaterCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLAGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0228688_12077913300023565SeawaterCPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0228679_102351513300023566SeawaterSIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0228679_103777213300023566SeawaterGFSDNQDKLYELMQLNSENCPKPLEISEDELAYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0228697_12497313300023674SeawaterEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0232114_12778313300023676SeawaterICSTTAMDYSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMENWTNAMHIKGGLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0232113_102188613300023679SeawaterFPLKMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0232113_103920513300023679SeawaterICSTTAMDYSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFNMENWKNAMKIKEELEKSGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0228682_102245813300023698SeawaterMKFAALLFCGAIASSNAMGFSDNQDKLYELMQLNSENCPKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGGLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0228682_102339913300023698SeawaterMQLNTAECPKPLKIEEDELHFQLGEFSRNFQMENWKNAMYIKEKLEKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFIQVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0228682_103680713300023698SeawaterPLKMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0228685_104387113300023701SeawaterYFPLKMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0228684_103359413300023704SeawaterSMKFAALLFCGAICSTTAMDYSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0228684_107222513300023704SeawaterMKFATFALIGAVAATSNNQQKLYDIMALQMSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLSKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0232123_107694313300023706Salt MarshFPLKMKFATALLCAGAVSASVSDNQEMLFEIMNLQTSTEPCPPPLEITEEELSYQLGQFSRNFEMSAWNNAMEIAAGLAKAGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0232122_113822613300023709Salt MarshKFTIAALLAATASAHITHNQAQLYDLMALQTSAADCPEPLDISEDELHYQLGEFSRNFNMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFPKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247724_102935413300024239Deep Subsurface SedimentMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNDKYDIGFIDPGVDGDW
(restricted) Ga0233439_1022702813300024261SeawaterLEESGAPAACPPPLDISEGELDYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAVKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0244777_1077212013300024343EstuarineMMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNDKYDIGFIDPGVDGDW
Ga0244775_1146569413300024346EstuarineGAVTATVSENQEKLYEIMNLQMADPACPPPLEITEEELAFQLGSFSRNFEMTNWNNAMEIAAGLAKQGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209634_130541213300025138MarineMKFAIVALLGLASVEAKHNQAMLYNLMQLDAQADPACPPPLAITEDELHYQLGEFSRNFDIKNWENAMTIRSGLAGSGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQINELEHYEDNLNANLSNKLALTRFVE
Ga0209654_107419613300025608MarineMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209405_116396623300025620Pelagic MarineMKFAVLALIGAVSAAPVSHNQEMLYDLMALQTEQVDANGCPIPLAITEDELQFQLGEFSRNFNQDNWDNSQKVLAGLKKEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANL
Ga0209716_107156123300025626Pelagic MarineMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0209716_112637113300025626Pelagic MarineAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0208643_116768813300025645AqueousATASAHITHNQAQLYDLMALQTSAADCPEPLDISEDELHYQLGEFSRNFNMQNWNDAMKISSELEKQGKKVKIAVTTKELYDHSFSFPKVRNYEFAVKNMNELEHYEDNLNNNISNAYALQKFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0209406_115202713300025694Pelagic MarineEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0209406_122247213300025694Pelagic MarineMKFASIIALAATAQAVSSNQDKLFVLMQLNECPPPLEISEDNLHYQLGEFSRNFQMVNWDNAMHISGELRNGGASPKVAVTTKELYDKSFSFPKVRNYDYAVQNMNELEGAEDNLNTNLSNGLALKRFIAVAKKVRANLNDKYDIG
Ga0209832_114565713300025830Pelagic MarineMKFAALALLGAVSASNISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209308_1031025723300025869Pelagic MarineMQTHASECPEPLEISEEEMTFQLGEFSRHFDQKFWDNAMKIKDELSKKGINPKFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSLALSRFVEVAKKVRKNLNAKYDIGFIDPGVEGDW
Ga0209533_131232913300025874Pelagic MarineAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209534_1025067913300025880Pelagic MarinePKPQNPKIMNSIYLNGVLIINCKVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEKGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAETGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209630_1036685013300025892Pelagic MarineITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAETGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209961_106856523300026130WaterPQNPKTPLKDNILLIIIIIIPLNMKFTTLLLIAGASAYNLGQHNQQKLYALMQTGAPECPEPLEISEEELNYQLGEFSRHFDMKFWDNAMKIKDELSKKGINPRFAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNNNISNSLALKRFIEVAKKVRKNLNDKYDIGFIDPGVEGDWQ
Ga0247557_101728913300026403SeawaterAALLFCGAICSTTAMDYSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247564_103726213300026418SeawaterMQLNTAECPKPLKIEEDELHFQLGEFSRNFQMENWKNAMYIKEKLEKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFIQVAKKVRSNLNDKYDIGFVDPGVEGDWQ
Ga0247607_110641813300026447SeawaterLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGD
Ga0247594_103953513300026448SeawaterGFSDNQDKLYELMQLNSENCPKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGGLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0247594_104484513300026448SeawaterMKFAALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247594_104683413300026448SeawaterKFATLALIGAASAVQVSDNQQMLYDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAAGGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLQQTCPH
Ga0247594_106607813300026448SeawaterIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247593_106139013300026449SeawaterDYSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247588_105069113300026465SeawaterMKKFAIVMMAGAAQAFESHNQERLYELMQLNTATATCPEPLEITEDNMHYQLGEFSRNFQMDSWNNAMTVKGKLNKGGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNQNLSNGLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247598_116064213300026466SeawaterAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247603_105167813300026468SeawaterLLFCGAIASSNAMGFSDNQDKLYELMQLNSENCPKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGGLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0247603_107845413300026468SeawaterMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247599_105630013300026470SeawaterLLFCGAICSTTAMDYSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247571_106253713300026495SeawaterSMKFAALLFCGAIASSNAMGFSDNQDKLYELMQLNSENCPKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGGLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0247571_108669513300026495SeawaterMKFATLALIGAASAVQVSDNQQMLYDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAAAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247571_109332413300026495SeawaterSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247571_113143813300026495SeawaterMQLQNGAEGVDCPPPLEITEEEMNYQMGEFSRNFKMENWDNAVKIKNALAEKGKKVKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNNTNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247571_117502213300026495SeawaterKFATALLCAGAVSATVSVNQEKLYELMNLQVENCPPPLEITEEELQYQLGQFSRNFEMAAWNNAMEIAAGLAKEGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247592_107868413300026500SeawaterICSTTAMDYSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNEIEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247592_110620513300026500SeawaterFPLKMKFATAILCAGAVSATVSVNQEKLYELMNLQVENCPPPLEITEEELQYQLGQFSRNFEMAAWNNAMEIAAGLAKEGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247605_111724713300026503SeawaterLLCAGAVSATVSVNQEKLYELMNLQVENCPPPLEITEEELQYQLGQFSRNFEMAAWNNAMEIAAGLAKEGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247605_113804023300026503SeawaterLEDATAPACPPPLEISEDELAYQLGEFSRNFDMHNWDNAMEIKGKLQGNGANPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALVRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247590_110295413300026513SeawaterKFAALLFCGAIASSNAMGFSDNQDKLYELMQLNSENCPKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGGLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0247590_112378423300026513SeawaterLEDATAPACPPPLEISEDELAYQLGEFSRNFDMHNWDNAMEIKGKLQGNGANPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0208921_106431713300027188EstuarineMMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNDKYDIGFIDPGV
Ga0208922_108640713300027197EstuarineMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNDKYD
Ga0207994_108554113300027416EstuarineIIYFPLKMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0208437_115065113300027525EstuarineMKFATALLCAGAVSASVSENQEMLFEIMNLQTSTEPCPPPLEISEEELSFQLGQFSRNFEMSAWNNAMEIAAGLAKSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNL
Ga0208304_1025020813300027751EstuarineMMNLQTMDCPEPLDIDEDELHYQLGEFSRNFNMENWNNAIKIRDELAKQGKPVKIAVTTKELYDHSFSFPKVRNYDYAVEQMNELEHYEDNLNQNIDNSLALARFVEVAKKVRANLNAKYDIGFIDPGVDGDW
Ga0209302_1039879813300027810MarineMKFASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGESGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0209712_1022658313300027849MarineMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAAGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSSLAKAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0209712_1046117523300027849MarinePKTPKPRKSEFHLINEVSKLNYKVNIIYFPLKMKFTSIALLGVAAATSKHNQVMLYNLMQLDVEDPVACPPPLTISEDELNYQLGEFSRNFDQKNWDNAMEIKGGLAGSGANPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNNLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
(restricted) Ga0255057_1019391413300027997SeawaterMKFATALLVAGAVNASVSVNQERLYELMNLQVTNIDPACPPPLEISEEELSFQLGNFSRNFEMTAWNNAMEVAAGLSKEGKAPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALTRFVEVAKKVRANLNDKYDIGFVDPGVEGDW
Ga0247586_104976813300028102SeawaterAFEISDNQEKLYELMQLNTAECPKPLKIEEDELHFQLGEFSRNFQMENWKNAMYIKEKLEKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFIQVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0247586_109810313300028102SeawaterPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYGHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247596_106160113300028106SeawaterLVLGTASANTTLNNQQKLFALMQLQNGAEGVDCPPPLEITEEEMNYQMGEFSRNFKMENWDNAVKIKNALAEKGKKVKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNNTNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247582_110666313300028109SeawaterMQLNTAECPKPLKIEEDELHFQLGEFSRNFQMENWTNAMHIKGGLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0256412_113056113300028137SeawaterKFATLLFCGAIASTNAMAFSENQEKLYELMQLNSAECPKPLEISEDEMNYQLGEFSRNFQMENWTNAMHIKGKLNGKGINPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVSVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0256412_115363913300028137SeawaterIMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0256412_116129313300028137SeawaterLIMKFTVLLACVAATSAFGVTDNQEKLYSLMQLNSGAENCPPPLELTEDEMHYQLGEFSRNFQMENWNNAMLIKKKLAKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVRQMNELEHYEDNLNSNLSNGLALERFVKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0256412_116941613300028137SeawaterMKFAIAALLFAGVSQAIINVSDNQERLFGLMQLQAEECPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0256412_123274313300028137SeawaterKFTSALLFAGVASAHISENQEKLFEIMNLQIQDAPAACPPPLEITEEELQFQLGMFSRTFEMVNWNNAMEIAGGLAKGGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEIAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0256412_127178023300028137SeawaterDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLSKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0256412_130436413300028137SeawaterLGGLRVFKQTISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQMENWVNAMHIRDQLAAQGVSPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0256417_110158313300028233SeawaterMKFTALLLCGAIASTNAMSLSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWSNAMHIKEKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFVDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0256417_111694013300028233SeawaterKFATLALIGAASAVQVSDNQQMLYDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0256417_114066513300028233SeawaterPACPPPLAITEDELHYQLGEFSRNFDIKNWENAMTIRSGLAGSGQTPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0256417_119507423300028233SeawaterIEDATAPACPPPLEISEDELAYQLGEFSRNFDMHNWDNAMEIKGKLQGNGANPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNHLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0256413_117779713300028282SeawaterTALLLCGAIASTNAMSLSDNQEKLYELMQLNTAECPKPLEISEDEMHYQLGEFSRNFQMESWSNAMHIKEKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNAIALKRFVDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0256413_118859713300028282SeawaterMKFATLALIGAASAVQVSDNQQMLYDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLSKAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0256413_119961813300028282SeawaterSLMQLNSGAENCPPPLERTEDEMHYQLGEFSRNFQMENWKNAMYIKEKLEKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFIQVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0256413_120502113300028282SeawaterKFAALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0256413_125490813300028282SeawaterHISENQEKLFEIMNLQIQDAPAACPPPLEITEEELQFQLGMFSRTFEMVNWNNAMEIAGGLAKGGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLSNKLALKRFIEIAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0256413_127345113300028282SeawaterLMQLQVSGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFVQVAKKVR
Ga0247572_107009013300028290SeawaterYSGGRLRGAKKASLIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLAGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247572_107328013300028290SeawaterLLFCGAIASSSAMGFSDNQDKLYELMQLNSENCPKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGGLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0228617_110561213300028297SeawaterQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247597_102084513300028334SeawaterFAALLFCGAIASSNAMGFSDNQDKLYELMQLNSENCPKPLEISEDELAYQLGEFSRNFQMENWTNAMHIKGGLAKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNSLALERFINVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0247597_103836913300028334SeawaterSIALAGVVAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELHYQLGEFSRNFDMKNWDNAMEIKGKLASAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0247566_103507513300028335SeawaterKKFAIVMMAGAAQAFESHNQERLYELMQLNTATATCPEPLEITEDNMHYQLGEFSRNFQMDSWNNAMTVKGKLNKGGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNQNLSNGLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0247566_104339413300028335SeawaterKFSMLAVLVLGTASANTTLNNQQKLFALMQLQNGAEGVDCPPPLEITEEEMNYQMGEFSRNFKMENWDNAVKIKNALAEKGKKVKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNSNNTNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0304731_1070512313300028575MarineKFTALLFCGVIASSQATGFSDNQEKLYDLMQLNECPKPLEISEEELHYQLGEFSRNFQMENWKNAMHIKDKLGKQGKFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0304731_1092217813300028575MarineMQLNTQTCPEPLEITEDNMHYQLGEFSRNFQMDNWNNAMTIKGKLNKGGVFPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNQNLSNGLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0272440_112166513300028595Marine SedimentMQLQTSECPEPLEISEDELHYQLGEFSRNFQMEHWNNAMKIKEELGKTGVHPRFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANISNGQHLKKFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0257128_107368313300028672MarineSDCPEPLENTEDELHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0307402_1061053913300030653MarineFPLKMKFASIALLGVAAATGKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307403_1053942713300030671MarineGATTSAQMSNQDKLFDLMALQISGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAGKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSYALQKFVQVAKKVR
Ga0307403_1057578613300030671MarineSIALVAVAAATTKHNQIMLYNLMQLEEQGAPACPPPLAVTEDELNYQLGEFSRNFDMKNWDNAMQIKGDLAKSGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307398_1036825313300030699MarineMQIQANGGVETKTEAKVEVPDKGCKPPLDISEDSLHYQLGEFSRNFAMENWNNAMKISGALGGKYKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFVTVAKKIRANLNDKYDIGFVDPGVESDWQ
Ga0307398_1048475813300030699MarineFPLKMKFASIALLGVVAATTKHNQVMLYNLMQLEEGGAPACPPPLAITEDELNYQLGEFSRNFDMKNWENAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307400_1047441113300030709MarineMQIQANGGIETKTEAKVEVPDKGCKPPLDISEDSLHYQLGEFSRNFAMENWNNAMKISGALGGKYKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNNNLSNALALERFVTVAKKIRANLNDKYDIGFVDPGVESDWQ
Ga0307400_1079374513300030709MarineMKFTILALFGLTAATTHHFNQAMLYNLMQLEEQDCPPPLAMTEDELHYQLGEFSRNFDNKNWDNAMTIRGDLAKGGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0308139_101906813300030720MarineMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0308133_105811913300030721MarineEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGDSGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0308129_101371613300030723MarineKFAALALIGAVSASNISHNQERLYEIMALQTGSTFEYSKKVDANGCPIPLEITEDELQYQLGEFSRNFNMDNWDNAMKVKGGLSKVGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0308129_102119313300030723MarineKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0308138_106328813300030724MarinePLKMKFASIALVAVAAATTKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGDSGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0308128_102552413300030725MarineAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073968_1162098613300030756MarineFAFALVAMASAISNQERLFQLMQLENCPPPLEISEDNLHYQLGEFSRNFNIKNWENAQHIKGELAKGGVNVKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAAEDNLNQNLSNQLALKRFIDTAKRVRANLNDKYDIGFIDPGVEGDWQ
Ga0073988_1209630213300030780MarineAIAALLGATTSAQMSNQDKLFDLMALQVSGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFIQVAKKVR
Ga0073988_1224952013300030780MarineYFPLKMKFASIALIGAAAATSKHNQVMLYNLMQLEEKGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKSKLAEAGQNPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073964_1002300113300030788MarineVAMASAISNQERLFQLMQLENCPPPLEISEDNLHYQLGEFSRNFNIKNWENAQHIKGELAKGGVNVKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAAEDNLNQNLSNQLALKRFIDTAKRVRANLNDKYDIGFIDPGVEGDWQ
Ga0073990_1000577413300030856MarineVAATSAFGVSDNQEKLYELMQLNSGECPKPLEITEDEMHYQLGEFSRNFQMENWNNAMHIKKKLAKKGIFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFIKVAKQVRSNLNDKYDIGFIDPGVEGDWQ
Ga0073990_1190818013300030856MarineAMLGAVAAFDRQLSNQEFLEEIMMLQDNCPEPLEISEDNLHYQLGEFSRNFEMQNWDNAMHIKNELAKGGQAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNSNLSNDLALKRFVDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0073990_1191343113300030856MarineFTALLFCGAIASTQAMGLKDNQEKLYELMQLNVESADCPKPLEISEDELNYQLGEFSRNFQMENWKNANHIKKKLNEKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNANLSNGLALDRFIQVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0073990_1192116713300030856MarineMKFTALLLCGAIASTSAMGVSDNQEKLYELMQLNTAECPKPLDITEDEMHYQLGEFSRNFQMESWNNAMHIKDKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0073970_1102408213300030919MarineMKFAFALVAMASAISNQERLFQLMQLENCPPPLEISEDNLHYQLGEFSRNFNIKNWENAQHIKGELAKGGVNVKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAAEDNLNQNLSNQLALKRFIDTAKRVRANLNDKYDIGFIDPGVEGDWQ
Ga0073977_164838313300030948MarineFITIAALLGATASAHESNQAKLYDLMQLQVSGADCPEPLEISEEELHYQLGEFSRNFGMENWNNAQKIAEGLAKQGKTPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFIQVAKKVR
Ga0073984_1125773113300031004MarineKFTALLFCGAIATTQAFSDMTNQEKLYDLMQLNECPKPLEITEEELHYQLGEFSRNFQMENWKNAMHIKDKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGLALERFVNVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0073980_1000629513300031032MarineAALALLGAVSASNISHNQERLYEIMALQTQQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKKGLSKVGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073980_1000633413300031032MarineGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKAGLAKVGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073980_1136556713300031032MarineIAIAALLGATTSAHESNQAKLYDIMALQMTGADCPEPLEISEEELHYQLGEFSRNFNMENWNNAQKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNAYALQKFISVAKKVR
Ga0073979_1000919723300031037MarineMALQTEQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKKGLSKVGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073986_1202828213300031038MarineIASSQAMDFSENQEKLYELMQLNECPKPLEITEDELHFQLGEFSRNFQMENWKNAMHIKSKLNKKGVFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEDNLNANLSNGLALDRFIQVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0073989_1315553613300031062MarineMKFTLVACLGALATTEAINITNQSKLESYMRDLECPEPLEMTEEELQHQMGLFSRTFEMAHWNNAMKIKDELVKAGGAPKIAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNQNLGNSLALSRFVEVAKRVRANLNAKYDIGFIDPAVDGDWQ
Ga0073989_1340450213300031062MarineKFVFALAAVLATTEASLSSNQSKLYMLMQLQNCPPPLEISEDNLHYQLGEFSRNFQMVNWDNAMEIAGKLRAAGGNPKVAVTTFDLYNKSFSFPKVRNYDYAVAQMNELEAANDNLNTNLSNGLALKKFLEVAKRVRANLNDKYDIGFVDPGVDGDW
Ga0073989_1355688913300031062MarineMKFATLALIGAASAVQVSDNQQMLYDIMALQTSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLAAAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0073958_1131858713300031120MarineKFAFALVAMASAISNQERLFQLMQLENCPPPLEISEDNLHYQLGEFSRNFNIKNWENAQHIKGELAKGGVNVKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAAEDNLNQNLSNQLALKRFIDTAKRVRANLNDKYDIGFIDPGVEGDWQ
Ga0138345_1037671113300031121MarineDVSDNQEKLYELMQLNTAECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKEKLNKKGSFPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNELEHYEENLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0073960_1112684713300031127MarineKFAVLALIGAASASISNQDKLYEIMALQTEQVDANGCKIPLEISEDELQYQLGEFSRNFNMDNWDNAMEVKKGLAKVGKNPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKVRANLNDKYDIGLIDPGVEGDW
Ga0307388_1043228413300031522MarineMQIQANGGVEAKTDAKVEVPDKGCKPPLDISEDSLHYQLGEFSRNFAMENWNNAMKINGELKKSGKSIKIAVTTKELYDKSFSFPKVRNYDYAVDQMNELEHFEDNLNKDLSNALALERFVTVAKKIRANLNDKYDIGFIDPGVESDWQ
Ga0307388_1070764113300031522MarineKFTALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307388_1121689523300031522MarineKFTIVALLGLAAATGTSKHNQAMLYNLMQLEEMDCPPPLAMTEDELHYQLGEFSRNFDSKNWENAMKIRSSLAESGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0307492_1027302713300031523Sea-Ice BrineMQLEDEVAPVCPPPLAITEDELNYQLGEFSRNFDMKNWTNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0308148_101835413300031557MarineFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNALALKRFIDVSKNVRANLNDKYDIGFVDPGVEGDWQ
Ga0307489_1070192913300031569Sackhole BrineMKFATALLCAGAVTATVSVNQEMLYEIMNLQTSISADPACPPPLEISEEELSFQLGSFSRTFEMTAWNNAMEVAAGLAKTGKTPRFAVTTKELYDKSFSFPKVRNYDYAVSNMNELEHYEDNLNKNLSNKLALTRFIEVAKKVRLNLNDKYDIGFVDPGVEGDW
Ga0307489_1101091613300031569Sackhole BrineLSDVVACPPPLEISEEELTFQLGSFSRTFEMTNWNNAMEIAAGLAKSGKTPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNKNLANKLALVRFIEVAKKVRLNLNDKYDIGFVDPGNEGDW
Ga0308134_107147413300031579MarineKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFVDPGVEGDWQ
Ga0308134_110207913300031579MarineDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0308134_110997913300031579MarineLKMKFASIALVAVAAATTKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGDSGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307996_118783213300031589MarineMKFAIAALLFAGVSKAIINVSTNQEQLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKSGTSPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYD
Ga0302114_1014228813300031621MarineMKFAALALIGAVSASNISHNQERLYEIMALQTGSTFEYSKKVDANGCPIPLEITEDELQYQLGEFSRNFNMDNWDNAMKVKGGLSKVGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0302114_1014777313300031621MarineMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKAPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0302114_1038961413300031621MarineMKFIAIAALLGATTSAQMSNQDKLFDLMALQLSGADCPEPLEISEEELHYQLGEFSRNFNMENWTNAGKIADGLAKAGKSPRFAVTTKELYDHSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNSYALQKFVQVAKKVR
Ga0302126_1030279813300031622MarineMKFASIALVAVAAATTKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLGDSGKAPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDK
Ga0307385_1029886313300031709MarineFPLKMKFASIALIGVAAATSKHNQVMLYNLMQLEEKGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAETGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307386_1036312223300031710MarineKFTILALFGLTAATTHHFNQAMLYNLMQLEEQDCPPPLAMTEDELHYQLGEFSRNFDNKNWDNAMTIRGDLAKGGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0307386_1049428813300031710MarineFPLKMKFASIALLGVAAATTKHNQVMLYNLMQLEEGGAPACPPPLAITEDELNYQLGEFSRNFDMKNWENAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307386_1066717313300031710MarineAAALVGLVAATHSARHNQVMLYNLMQLEEKDCPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRGELAKGEQEPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307396_1034390213300031717MarineMQIQANGGVEAKTEAKVEVPDKGCKPPLDITEDSLHYQLGEFSRNFAMENWNNAMKINGELKKSGKSIKIAVTTKELYDKSFSFPKVRNYDYAVDQMNELEHFEDNLNKDLSNALALERFVTVAKKIRANLNDKYDIGFIDPGVESDWQ
Ga0307381_1016846513300031725MarineMKFAAAALIGLVSATQTSRHNQAMLYNLMQLEQQDCPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRGEVAASGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNTLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307381_1025604813300031725MarineASIALVAVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMQIKGDLAKAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307381_1026364813300031725MarineAYHNSNQDKLYEIMALQVESQQVDANGCPIPLEITEDELQYQLGEFSRNFNMDNWDNAMKVKAGLGKVGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGD
Ga0307391_1036449713300031729MarineSMKFTILALFGLTAATTHHFNQAMLYNLMQLEEQDCPPPLAMTEDELHYQLGEFSRNFDNKNWDNAMTIRGDLAKGGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0307391_1043894113300031729MarineTIVALLGLAAATHTTKHNQAMLYNLMQVEEMDCPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRGDLAGSGQNPKFAVTTKELYDKSFSFPKVRNYDYAVSQMNELEHYEDNLNANLSNTLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0307391_1049268813300031729MarineKFATLALIGAASAVQVSDNQQMLYDLMAIQTSQVDAAGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGSGKVPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0307391_1067645813300031729MarineFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLAGAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307391_1069159013300031729MarineTTKHNQVMLYNLMQLEEGGAPACPPPLAITEDELNYQLGEFSRNFDMKNWENAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307397_1033685913300031734MarineDNQQMLYDLMAIQTSQVDAAGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGEW
Ga0307397_1042131313300031734MarineIYFPLKMKFASIALLGVAAATTKHNQVMLYNLMQLEEGGAPACPPPLAITEDELNYQLGEFSRNFDMKNWENAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307394_1030979813300031735MarineRLKFTILALFGLTAATTHHFNQAMLYNLMQLEEQDCPPPLAMTEDELHYQLGEFSRNFDNKNWDNAMTIRGDLAKGGQNPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0307394_1039147713300031735MarineGAPACPPPLAITEDELNYQLGEFSRNFDMKNWENAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307387_1048601813300031737MarineALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307384_1058155713300031738MarineMKFAAAALVGLVAATHSARHNQVMLYNLMQLEEKDCPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRGELAKGEQEPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFIEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307384_1058946813300031738MarineGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAETGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307383_1028726713300031739MarineLNTEESKEDCPPPLEKTQEELNYQMGEFSRNFKMENWDNAIKIKGSLEGDGKKVQFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNTNNSNSLALKRFVEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0307383_1039685713300031739MarineMKFTIAALVFIGAMTSVEAIDMHSNVSNQSKLYSLMQFNDCPEPLEISEEELHHQLGLFSRHLENQYWDNAMSIKTALAKTGVFPKIAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNIENSLHLSKFIEVAKRVRGNLNAKYDIGFIDPGVDGEWQ
Ga0307383_1063117613300031739MarineFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWENAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307383_1073956313300031739MarineFPLKMKFASIALVAAAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMQIKGDLAKAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307395_1042873013300031742MarineMKFASIALLGVAAATTKHNQVMLYNLMQLESEGAPACPPPLAITEDELNYQLGEFSRNFDQKNWDNAMEIKGKLGEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307382_1034676113300031743MarineMQIQANGGVEAKTEAKVEVPDKGCKPPLDISEDSLHYQLGEFSRNFAMDNWNNAMKINGELKKSGKSPKIAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHFEDNLNKDLSNALALERFVTVAKKIRANLNDKYDIGFIDPGVESDWQ
Ga0307389_1052600813300031750MarineKFAALALLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRYVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314684_1034962113300032463SeawaterMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPIPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314684_1058510413300032463SeawaterKFVFMLGAVAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314670_1037869413300032470SeawaterAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314668_1034183713300032481SeawaterFVFMLGAVAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314675_1035929713300032491SeawaterAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314675_1056442513300032491SeawaterSIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314679_1025927413300032492SeawaterMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPIPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFIEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314679_1034488013300032492SeawaterKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314679_1040473613300032492SeawaterLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314688_1037822713300032517SeawaterKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0314688_1037851513300032517SeawaterMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAGGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314688_1040635013300032517SeawaterLGAVAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314688_1044761113300032517SeawaterDRKVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314689_1037142313300032518SeawaterLNMKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0314689_1044720013300032518SeawaterFPLKMKFASIALLGVAAATSKHNQIMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314676_1046608413300032519SeawaterFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314676_1052068913300032519SeawaterMKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNALALKRFIDAAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0314676_1067986213300032519SeawaterVFMLGAVAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNHNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314667_1049770613300032520SeawaterFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314680_1055447013300032521SeawaterPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314680_1095547313300032521SeawaterKFATLALIGAASAVQVSDNQQMLYDIMALQMSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314682_1047658513300032540SeawaterLGAVSASSISRNQEKLYEIMALQTESQQVDANGCPIPLEITEDEMQYQLGEFSRNFNMDNWDNAMKVKKGLSKVGKSPKFAVTTKELYDKSFSFPKVRNYDYATEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314682_1047790813300032540SeawaterAIINVSDNQERLFGLMQLQSSDCPEPLENTEDELHYQLGEFSRNFNMENWKNAMKIKEELEKGGASPKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNGQHLKKFVEIAKKVRANLNDKYDIGFIDPGVEGEWQ
Ga0314682_1057136713300032540SeawaterAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQMENWVNAMHIRDQLATQGVSPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314682_1058384513300032540SeawaterKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314674_1031007813300032615SeawaterRASEKFSAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPIPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314674_1032348113300032615SeawaterTLHLAPPALSRTMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314674_1048849913300032615SeawaterIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314674_1054196513300032615SeawaterMKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNTNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0314674_1054390813300032615SeawaterMKFATLALLGAVSATSDNQQMLYDIMALQMSQVYANGCPIPLAITEDELAFQLGEFSRNFNMDNWDNAMKVKEGLGGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314671_1027996813300032616SeawaterFMLGAAAAIERQISNQEFLEEIMMLQEPVPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314671_1034613613300032616SeawaterIAPRKRLSSTLHLAPPALSRTMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314671_1062930613300032616SeawaterQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314671_1076331813300032616SeawaterLQMSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314685_1025818713300032651SeawaterMNLQTEGPTFGFVNSKEVDAGGCPIPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314685_1038250013300032651SeawaterFMLGAVAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314685_1071299213300032651SeawaterLLGAVSATSDNQQMLYDIMALQMSQVDANGCPIPLAITEDELAFQLGEFSRNFNMDNWDNAMKVKEGLGGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314678_1044804713300032666SeawaterKFATLALLGAVSATSDNQQMLYYIMALQMSQVDANGCPIPLAITEDELAFQLGEFSRNFNMDNWDNAMKVKEGLGGSGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314687_1038841013300032707SeawaterMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314687_1046617113300032707SeawaterLALIGAASAVQVSDNQQMLYDIMALQMSQVYANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314687_1056449513300032707SeawaterYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314669_1008923623300032708SeawaterNMKFAVLILLGAIASTSAMDVSDNQEKLFELMQLNECPKPLEITEDEMHYQLGEFSRNFQMESWNNAMHIKKELSKKKGINAKFAVTTKELYDKSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNALALKRFIDVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0314669_1039360113300032708SeawaterKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314669_1082526113300032708SeawaterKFATLALLGAVSATSDNQQMLYDIMALQMSQVDANGCPIPLAITEDELAFQLGEFSRNFNMDNWDNAMKVKAGLGGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314672_119920313300032709SeawaterMNLQTEGPSYGYVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314672_123259213300032709SeawaterKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAGGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314681_1035803113300032711SeawaterMKFVVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPIPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314681_1056013313300032711SeawaterIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314686_1047593213300032714SeawaterPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314686_1056664613300032714SeawaterAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAGGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314703_1036221513300032723SeawaterVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDNIRYWFH
Ga0314695_113180113300032724SeawaterMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGYVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314695_122943213300032724SeawaterMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAGGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFTEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314702_122716813300032725SeawaterFIFMLGAVAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314696_1057227413300032728SeawaterCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314711_1035986913300032732SeawaterVFMLGAVAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314711_1041807013300032732SeawaterNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314707_1035939913300032743SeawaterMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314704_1036039613300032745SeawaterNMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPIPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314704_1042688223300032745SeawaterVNIIYFPLKMKFASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314704_1050845713300032745SeawaterAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0314701_1024664113300032746SeawaterNMKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGYVNSKEVDAGGCPVPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314701_1028834613300032746SeawaterKFATLALLGAVSATSDNQQMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314712_1028593913300032747SeawaterKFAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPIPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314713_1027840713300032748SeawaterAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314713_1037144613300032748SeawaterVFMLGAVAAFERAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGVWQ
Ga0314691_1021162613300032749SeawaterRLSSTLHLAPPALSRTMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314708_1027905513300032750SeawaterSIAPRKRLSSTLHLAPPALSRTMKFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314708_1053733713300032750SeawaterMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314694_1023425713300032751SeawaterFAWSFASSRXNRPFDSPAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAGGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314694_1036117013300032751SeawaterQVSDNQQMLYDIMALQMSQVDANGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGAGKTPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314692_1044822113300032754SeawaterFAVLALIGAASAAPVSHNQEMLYDIMALQMSQVDANGCPIPLAITEDELQFQLGEFSRNFNMDNWDNAQKVLSGLKAEGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFSEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314692_1056258013300032754SeawaterASIALLGVAAATSKHNQVMLYNLMQLEEQGAPACPPPLAITEDELNYQLGEFSRNFDMKNWDNAMEIKGKLAEAGSTPKFAVTTKELYDHSFSFPKVRNYDYAVQQMNELEHYEDNLNSNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0314709_1042820513300032755SeawaterPILTNEINDRVSGYKALNSEEEGKLLSLNAVLALIGAASATQISHNQERLYELMNLQTEGPTFGFVNSKEVDAGGCPIPLEITEDELQYQLGEFSRNFSMDKWDNAMKVKSALAKAGKSPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKTRANLNDKYDIGFIDPGVEGDW
Ga0314709_1061802613300032755SeawaterAISNQEFLEEIMMLQEPIPGYPNGVPAGCPPPLEISEDNLHYQLGEFSRNFQTENWVNAMHIKDQLAAEGVAPKFAVTTKELYDKSFSFPKVRNYDYAVQNMNDLEAVEDNLNQNLGNDLALHRFIDTAKKVRENLNAKYDIGFIDPGVDGDWQ
Ga0307390_1063490213300033572MarineMKFTILALVGLAAATHTTKHNQAMLYNLMQVEEMDCPPPLAMTEDELHYQLGEFSRNFDMKNWDNAMKIRGDLAGSGQNPKFAVTTKELYDKSFSFPKVRNYDYAVSQMNELEHYEDNLNANLSNTLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGDW
Ga0307390_1068135923300033572MarineAVQVSDNQQMLYDLMAIQTSQVDAAGCPIPLAITEDELAYQLGEFSRNFNMDNWDNAMKVKAGLGGSGKVPKFAVTTKELYDKSFSFPKVRNYDYAVEQMNELEHYEDNLNNNLSNKLALTRFVEVAKKVRANLNDKYDIGFIDPGVEGEW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.