NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F001461

Metagenome / Metatranscriptome Family F001461

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F001461
Family Type Metagenome / Metatranscriptome
Number of Sequences 690
Average Sequence Length 98 residues
Representative Sequence MKFTLAAFALIAAVSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Number of Associated Samples 406
Number of Associated Scaffolds 689

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.58 %
% of genes near scaffold ends (potentially truncated) 43.62 %
% of genes from short scaffolds (< 2000 bps) 99.86 %
Associated GOLD sequencing projects 370
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.710 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(33.333 % of family members)
Environment Ontology (ENVO) Unclassified
(64.928 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(86.087 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 24.80%    β-sheet: 3.20%    Coil/Unstructured: 72.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 689 Family Scaffolds
PF01205UPF0029 0.15

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 689 Family Scaffolds
COG1739Putative translation regulator, IMPACT (imprinted ancient) protein familyGeneral function prediction only [R] 0.15


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.71 %
UnclassifiedrootN/A0.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10245483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300000117|DelMOWin2010_c10170227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani698Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10135241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani837Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10158327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300000949|BBAY94_10153288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300001346|JGI20151J14362_10211589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300001354|JGI20155J14468_10135302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani808Open in IMG/M
3300001354|JGI20155J14468_10159776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300001355|JGI20158J14315_10188439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300001822|ACM39_103693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani636Open in IMG/M
3300002186|JGI24539J26755_10163764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300003216|JGI26079J46598_1053534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani810Open in IMG/M
3300003621|JGI26083J51738_10091635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300003677|Ga0008458J53046_102758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300003683|Ga0008459J53047_1008314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300003860|Ga0031658_1080699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300004507|Ga0008280_1132414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300004836|Ga0007759_11535735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300005433|Ga0066830_10062583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300005433|Ga0066830_10067794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300005516|Ga0066831_10128598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300005584|Ga0049082_10268452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300005599|Ga0066841_10094768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300005608|Ga0066840_10051703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani830Open in IMG/M
3300005662|Ga0078894_11507302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300005941|Ga0070743_10207850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300005941|Ga0070743_10303971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300005942|Ga0070742_10232706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300006029|Ga0075466_1147400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300006357|Ga0075502_1695799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300006374|Ga0075512_1261382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300006379|Ga0075513_1330938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300006383|Ga0075504_1371010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300006390|Ga0075509_1446155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300006393|Ga0075517_1442861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300006396|Ga0075493_1035244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300006403|Ga0075514_1814959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300006602|Ga0075484_1502042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300006641|Ga0075471_10580950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300006803|Ga0075467_10505117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300006803|Ga0075467_10565979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300006803|Ga0075467_10629074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300007231|Ga0075469_10185602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300007236|Ga0075463_10151236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani749Open in IMG/M
3300007513|Ga0105019_1207915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani957Open in IMG/M
3300007545|Ga0102873_1230535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300007552|Ga0102818_1079204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani649Open in IMG/M
3300007558|Ga0102822_1123081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300007623|Ga0102948_1194806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300007725|Ga0102951_1184498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300007863|Ga0105744_1103283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300007981|Ga0102904_1113025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani636Open in IMG/M
3300008108|Ga0114341_10492773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300008111|Ga0114344_1229965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300008832|Ga0103951_10680262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300008929|Ga0103732_1015383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1056Open in IMG/M
3300008929|Ga0103732_1069308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300008930|Ga0103733_1060785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300008931|Ga0103734_1003346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1830Open in IMG/M
3300008931|Ga0103734_1016573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1041Open in IMG/M
3300008931|Ga0103734_1034002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani765Open in IMG/M
3300008933|Ga0103736_1057477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300008934|Ga0103737_1010079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1093Open in IMG/M
3300008934|Ga0103737_1033975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300008935|Ga0103738_1055790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300008935|Ga0103738_1065077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300008936|Ga0103739_1009551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1133Open in IMG/M
3300008937|Ga0103740_1052438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300008958|Ga0104259_1014629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300008958|Ga0104259_1029457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300008993|Ga0104258_1081046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300008993|Ga0104258_1081841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani603Open in IMG/M
3300008993|Ga0104258_1104536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300008995|Ga0102888_1089404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300008996|Ga0102831_1144058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani791Open in IMG/M
3300009003|Ga0102813_1175708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300009003|Ga0102813_1192979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300009022|Ga0103706_10222040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300009028|Ga0103708_100241143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300009049|Ga0102911_1154134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300009071|Ga0115566_10360047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani846Open in IMG/M
3300009071|Ga0115566_10403491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani788Open in IMG/M
3300009071|Ga0115566_10476806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300009071|Ga0115566_10522770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300009071|Ga0115566_10541145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300009071|Ga0115566_10579137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300009071|Ga0115566_10637660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300009071|Ga0115566_10788040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300009079|Ga0102814_10606110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300009172|Ga0114995_10415782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani737Open in IMG/M
3300009172|Ga0114995_10492646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300009193|Ga0115551_1302910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani698Open in IMG/M
3300009195|Ga0103743_1028464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani798Open in IMG/M
3300009195|Ga0103743_1066257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300009263|Ga0103872_1063782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300009265|Ga0103873_1070298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300009265|Ga0103873_1094624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300009265|Ga0103873_1106240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300009265|Ga0103873_1133809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300009274|Ga0103878_1041856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300009279|Ga0103880_10056124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300009279|Ga0103880_10088409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300009357|Ga0103827_1014635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300009422|Ga0114998_10256147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani824Open in IMG/M
3300009432|Ga0115005_10602953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani879Open in IMG/M
3300009432|Ga0115005_10640679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani852Open in IMG/M
3300009432|Ga0115005_11023827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300009432|Ga0115005_11025713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani668Open in IMG/M
3300009432|Ga0115005_11039306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300009432|Ga0115005_11550627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300009433|Ga0115545_1229854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300009434|Ga0115562_1174799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300009434|Ga0115562_1219747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300009436|Ga0115008_10479411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani887Open in IMG/M
3300009436|Ga0115008_10604691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani790Open in IMG/M
3300009436|Ga0115008_10610452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300009436|Ga0115008_11007607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300009440|Ga0115561_1354290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300009440|Ga0115561_1380640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300009441|Ga0115007_10275612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1090Open in IMG/M
3300009441|Ga0115007_10474599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani824Open in IMG/M
3300009441|Ga0115007_10621575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300009441|Ga0115007_11047312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300009447|Ga0115560_1249161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300009449|Ga0115558_1381380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300009449|Ga0115558_1439234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300009466|Ga0126448_1114187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300009467|Ga0115565_10362341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300009476|Ga0115555_1216404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300009476|Ga0115555_1457328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300009495|Ga0115571_1281663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300009497|Ga0115569_10218447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani871Open in IMG/M
3300009497|Ga0115569_10294637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300009497|Ga0115569_10326026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300009498|Ga0115568_10302997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300009507|Ga0115572_10511916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani665Open in IMG/M
3300009543|Ga0115099_10151435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300009543|Ga0115099_10816950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300009544|Ga0115006_11419366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300009550|Ga0115013_10516304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300009592|Ga0115101_1170998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300009592|Ga0115101_1335829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300009592|Ga0115101_1843887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300009599|Ga0115103_1106653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300009599|Ga0115103_1247097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300009599|Ga0115103_1329567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani846Open in IMG/M
3300009599|Ga0115103_1329567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani846Open in IMG/M
3300009599|Ga0115103_1405251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300009599|Ga0115103_1759135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300009599|Ga0115103_1777491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300009606|Ga0115102_10016874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300009606|Ga0115102_10199029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300009606|Ga0115102_10345002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300009606|Ga0115102_10368597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300009606|Ga0115102_10474139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300009606|Ga0115102_10579712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300009606|Ga0115102_10698011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300009606|Ga0115102_10832633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300009608|Ga0115100_10217903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300009608|Ga0115100_10547306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300009608|Ga0115100_10810757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300009608|Ga0115100_11022664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300009677|Ga0115104_10562435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300009677|Ga0115104_10587387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300009679|Ga0115105_10158509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300009679|Ga0115105_10993166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300009741|Ga0123361_1045440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300009785|Ga0115001_10509574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300010297|Ga0129345_1238458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300010309|Ga0102890_1082401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300010309|Ga0102890_1119962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300010368|Ga0129324_10298106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300010404|Ga0129323_1015969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300010966|Ga0137675_1020138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300010970|Ga0137575_10058852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300010985|Ga0138326_11741160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300010987|Ga0138324_10470557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300010987|Ga0138324_10686626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300012030|Ga0136599_1068851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300012408|Ga0138265_1159696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300012412|Ga0138266_1335103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani922Open in IMG/M
3300012414|Ga0138264_1240766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300012414|Ga0138264_1462378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300012417|Ga0138262_1380830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300012472|Ga0129328_1013819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300012504|Ga0129347_1253470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300012516|Ga0129325_1152091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300012516|Ga0129325_1332042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300012518|Ga0129349_1060896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300012518|Ga0129349_1068040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300012518|Ga0129349_1172143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300012522|Ga0129326_1343561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300012523|Ga0129350_1472830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300012525|Ga0129353_1955456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300012528|Ga0129352_10651080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300012767|Ga0138267_1114183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300012782|Ga0138268_1116706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani595Open in IMG/M
3300012920|Ga0160423_10645805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300012928|Ga0163110_11279820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani591Open in IMG/M
3300012952|Ga0163180_11519840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300012953|Ga0163179_10910789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani761Open in IMG/M
3300012953|Ga0163179_10945081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani748Open in IMG/M
3300012953|Ga0163179_11010294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani726Open in IMG/M
3300012954|Ga0163111_10897965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani850Open in IMG/M
3300012954|Ga0163111_11001196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani807Open in IMG/M
3300012954|Ga0163111_11320381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300012965|Ga0129346_1009678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300012965|Ga0129346_1032067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani624Open in IMG/M
3300012967|Ga0129343_1045591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300012969|Ga0129332_1315704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300012969|Ga0129332_1469958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300013005|Ga0164292_10847400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300013295|Ga0170791_13169965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300016727|Ga0182051_1306707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300016735|Ga0182074_1374876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300016740|Ga0182096_1415262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300016743|Ga0182083_1585689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300016746|Ga0182055_1435716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300016754|Ga0182072_1087607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300016766|Ga0182091_1139706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300016882|Ga0186577_109031Not Available584Open in IMG/M
3300017709|Ga0181387_1047113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani856Open in IMG/M
3300017709|Ga0181387_1068885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300017709|Ga0181387_1135967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300017729|Ga0181396_1109016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300017739|Ga0181433_1170241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300017756|Ga0181382_1142343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300017757|Ga0181420_1071561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1089Open in IMG/M
3300017763|Ga0181410_1146049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300017771|Ga0181425_1123299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300017776|Ga0181394_1192222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani624Open in IMG/M
3300017776|Ga0181394_1264575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300017818|Ga0181565_10483888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani806Open in IMG/M
3300017824|Ga0181552_10453350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300017949|Ga0181584_10693981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300017951|Ga0181577_10554528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300017951|Ga0181577_10676398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300017952|Ga0181583_10644123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300017952|Ga0181583_10773041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300017958|Ga0181582_10563653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300017958|Ga0181582_10767810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300017967|Ga0181590_10729445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani665Open in IMG/M
3300017986|Ga0181569_10864954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300018049|Ga0181572_10699225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300018410|Ga0181561_10446584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300018417|Ga0181558_10636468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300018423|Ga0181593_10801387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani659Open in IMG/M
3300018424|Ga0181591_10954505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300018515|Ga0192960_106971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300018596|Ga0193060_1014572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani662Open in IMG/M
3300018601|Ga0188850_1024404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300018628|Ga0193355_1018719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani649Open in IMG/M
3300018628|Ga0193355_1022171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300018628|Ga0193355_1023902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300018628|Ga0193355_1026522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300018628|Ga0193355_1026727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300018628|Ga0193355_1028181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300018628|Ga0193355_1028821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300018649|Ga0192969_1050544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300018655|Ga0192846_1036817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300018670|Ga0192819_1048413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300018674|Ga0193166_1020198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300018674|Ga0193166_1030616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300018684|Ga0192983_1059999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300018684|Ga0192983_1062670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300018692|Ga0192944_1043406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300018692|Ga0192944_1052364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300018692|Ga0192944_1056483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300018692|Ga0192944_1058291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300018692|Ga0192944_1059295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300018725|Ga0193517_1073498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300018725|Ga0193517_1076430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300018730|Ga0192967_1057940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani645Open in IMG/M
3300018730|Ga0192967_1080759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300018730|Ga0192967_1081489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300018742|Ga0193138_1051053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300018745|Ga0193000_1067897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300018745|Ga0193000_1069844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300018745|Ga0193000_1073136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300018746|Ga0193468_1067283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300018762|Ga0192963_1078876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300018763|Ga0192827_1078686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300018763|Ga0192827_1079118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani565Open in IMG/M
3300018763|Ga0192827_1080083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300018765|Ga0193031_1076352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300018765|Ga0193031_1077137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300018765|Ga0193031_1081121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300018765|Ga0193031_1086896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300018765|Ga0193031_1088156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300018765|Ga0193031_1088283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300018779|Ga0193149_1064495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300018782|Ga0192832_1060752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300018787|Ga0193124_1071888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300018800|Ga0193306_1069144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300018800|Ga0193306_1075388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300018811|Ga0193183_1084410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300018812|Ga0192829_1106527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300018827|Ga0193366_1065470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300018827|Ga0193366_1071150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300018831|Ga0192949_1102744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300018831|Ga0192949_1108435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300018832|Ga0194240_1016804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300018832|Ga0194240_1035696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300018842|Ga0193219_1074940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300018846|Ga0193253_1120299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani591Open in IMG/M
3300018846|Ga0193253_1125898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300018846|Ga0193253_1128557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300018846|Ga0193253_1135938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300018848|Ga0192970_1099331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300018855|Ga0193475_1071813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300018855|Ga0193475_1082859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300018871|Ga0192978_1099720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300018873|Ga0193553_1145673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300018874|Ga0192977_1093344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300018874|Ga0192977_1099056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300018882|Ga0193471_1094012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300018913|Ga0192868_10081503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300018913|Ga0192868_10088948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300018913|Ga0192868_10090731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300018926|Ga0192989_10163311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300018926|Ga0192989_10164699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300018928|Ga0193260_10110740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300018928|Ga0193260_10120730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300018932|Ga0192820_10142036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300018932|Ga0192820_10176367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300018976|Ga0193254_10055900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani913Open in IMG/M
3300018977|Ga0193353_10212648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300018977|Ga0193353_10217372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300018977|Ga0193353_10240190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300018977|Ga0193353_10253525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300018979|Ga0193540_10210022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300018980|Ga0192961_10250186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300018981|Ga0192968_10157038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300018981|Ga0192968_10191548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300018982|Ga0192947_10178821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300018982|Ga0192947_10232718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300018982|Ga0192947_10234910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300018982|Ga0192947_10260131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300018982|Ga0192947_10272535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300018982|Ga0192947_10274803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300018982|Ga0192947_10290998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300018982|Ga0192947_10291944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300018982|Ga0192947_10300899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300018986|Ga0193554_10334148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300018988|Ga0193275_10299488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300018989|Ga0193030_10189523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300018989|Ga0193030_10194136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300018989|Ga0193030_10199405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300018989|Ga0193030_10263581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300018989|Ga0193030_10272550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300018989|Ga0193030_10273074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300018989|Ga0193030_10275660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300018989|Ga0193030_10280460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300018989|Ga0193030_10298820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300018989|Ga0193030_10301368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300018989|Ga0193030_10309712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300018989|Ga0193030_10310695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300018997|Ga0193257_10245274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300019001|Ga0193034_10162546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300019001|Ga0193034_10175018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300019001|Ga0193034_10184188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300019003|Ga0193033_10225814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300019010|Ga0193044_10126784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani839Open in IMG/M
3300019010|Ga0193044_10239557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300019010|Ga0193044_10268822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300019010|Ga0193044_10276641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300019012|Ga0193043_10194441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300019012|Ga0193043_10296333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300019012|Ga0193043_10357769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300019017|Ga0193569_10408370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300019021|Ga0192982_10346897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300019021|Ga0192982_10369311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300019021|Ga0192982_10370474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300019022|Ga0192951_10408937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300019025|Ga0193545_10145593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300019027|Ga0192909_10245953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300019027|Ga0192909_10252773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300019027|Ga0192909_10275934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300019027|Ga0192909_10278305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300019027|Ga0192909_10289233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300019027|Ga0192909_10307220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300019031|Ga0193516_10274515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300019031|Ga0193516_10279336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300019031|Ga0193516_10280229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300019031|Ga0193516_10283907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300019031|Ga0193516_10297642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300019031|Ga0193516_10298215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300019031|Ga0193516_10311593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300019032|Ga0192869_10329217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300019032|Ga0192869_10453220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300019032|Ga0192869_10464195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300019032|Ga0192869_10468628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300019032|Ga0192869_10482126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300019032|Ga0192869_10497737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300019033|Ga0193037_10304116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300019036|Ga0192945_10197288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300019036|Ga0192945_10240858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300019036|Ga0192945_10254464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300019036|Ga0192945_10279992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300019036|Ga0192945_10287810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300019039|Ga0193123_10405765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300019045|Ga0193336_10612513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300019045|Ga0193336_10666621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300019045|Ga0193336_10671697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300019048|Ga0192981_10239192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani698Open in IMG/M
3300019048|Ga0192981_10285627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani620Open in IMG/M
3300019048|Ga0192981_10307377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300019048|Ga0192981_10321348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300019048|Ga0192981_10344631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300019048|Ga0192981_10364022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300019050|Ga0192966_10238057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300019050|Ga0192966_10275522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani595Open in IMG/M
3300019050|Ga0192966_10348072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300019051|Ga0192826_10362070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300019051|Ga0192826_10363271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300019051|Ga0192826_10364414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300019051|Ga0192826_10373863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300019051|Ga0192826_10384904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300019051|Ga0192826_10384935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300019095|Ga0188866_1023986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300019095|Ga0188866_1024752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300019095|Ga0188866_1035252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300019097|Ga0193153_1028610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300019097|Ga0193153_1032545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300019097|Ga0193153_1035642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300019100|Ga0193045_1075981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300019102|Ga0194243_1009133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300019111|Ga0193541_1085919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300019116|Ga0193243_1054684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300019116|Ga0193243_1054878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300019116|Ga0193243_1060226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300019116|Ga0193243_1060232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300019117|Ga0193054_1066161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300019117|Ga0193054_1075743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300019118|Ga0193157_1027109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300019118|Ga0193157_1033010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300019118|Ga0193157_1033395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300019118|Ga0193157_1033799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300019118|Ga0193157_1036958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300019118|Ga0193157_1037861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300019118|Ga0193157_1038122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300019123|Ga0192980_1099697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300019123|Ga0192980_1102875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300019125|Ga0193104_1065484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300019133|Ga0193089_1127690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300019133|Ga0193089_1143952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300019149|Ga0188870_10140978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300019150|Ga0194244_10042386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani719Open in IMG/M
3300019150|Ga0194244_10051665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300019153|Ga0192975_10324773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300019200|Ga0180036_1010777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300019253|Ga0182064_1047347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300019262|Ga0182066_1240845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300019266|Ga0182061_1123392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani565Open in IMG/M
3300019272|Ga0182059_1422438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300019272|Ga0182059_1445311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300019274|Ga0182073_1156012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300019276|Ga0182067_1270023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300019280|Ga0182068_1288364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300019459|Ga0181562_10452312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300020013|Ga0182086_1248302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300020074|Ga0194113_10937033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300020165|Ga0206125_10281626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300020165|Ga0206125_10332676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300020166|Ga0206128_1243757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani665Open in IMG/M
3300020175|Ga0206124_10260090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300020182|Ga0206129_10313690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300020372|Ga0211683_10191207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300020382|Ga0211686_10261103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani712Open in IMG/M
3300020382|Ga0211686_10265779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani705Open in IMG/M
3300020595|Ga0206126_10270550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani773Open in IMG/M
3300021085|Ga0206677_10351450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300021169|Ga0206687_1102863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300021169|Ga0206687_1200921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300021169|Ga0206687_1902214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300021325|Ga0210301_1314971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300021325|Ga0210301_1371661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300021342|Ga0206691_1032084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300021342|Ga0206691_1402302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300021348|Ga0206695_1228116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300021348|Ga0206695_1768167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300021353|Ga0206693_1625325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300021353|Ga0206693_1953526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300021355|Ga0206690_10416184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300021359|Ga0206689_10478076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300021359|Ga0206689_11075769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300021365|Ga0206123_10308541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300021373|Ga0213865_10373939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300021373|Ga0213865_10425952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300021378|Ga0213861_10421009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300021887|Ga0063105_1007052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300021887|Ga0063105_1046178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300021902|Ga0063086_1002600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300021902|Ga0063086_1003849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300021908|Ga0063135_1067546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300021912|Ga0063133_1011435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300021912|Ga0063133_1014992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300021913|Ga0063104_1054253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300021942|Ga0063098_1025275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300021957|Ga0222717_10315600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani887Open in IMG/M
3300021957|Ga0222717_10390927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani771Open in IMG/M
3300021962|Ga0222713_10641774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300021962|Ga0222713_10647955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300021962|Ga0222713_10705868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300021962|Ga0222713_10740519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300021962|Ga0222713_10810608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300022900|Ga0255771_1313660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300023173|Ga0255776_10592786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300023173|Ga0255776_10635565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300023178|Ga0255759_10623364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300023679|Ga0232113_1034480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300023679|Ga0232113_1035475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300023694|Ga0228683_1040081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300023698|Ga0228682_1051231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300023698|Ga0228682_1061311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300023704|Ga0228684_1068737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300024231|Ga0233399_1112995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300024294|Ga0228664_1093555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300024343|Ga0244777_10660870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani628Open in IMG/M
3300024346|Ga0244775_10738223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani791Open in IMG/M
3300024346|Ga0244775_10993071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300024346|Ga0244775_11428411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300025138|Ga0209634_1168503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani872Open in IMG/M
3300025138|Ga0209634_1186073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani809Open in IMG/M
3300025570|Ga0208660_1121933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300025620|Ga0209405_1121873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani712Open in IMG/M
3300025626|Ga0209716_1095650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani855Open in IMG/M
3300025626|Ga0209716_1116554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300025626|Ga0209716_1148532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300025636|Ga0209136_1146135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300025680|Ga0209306_1110573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani808Open in IMG/M
3300025684|Ga0209652_1184154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300025699|Ga0209715_1168506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300025704|Ga0209602_1177711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani654Open in IMG/M
3300025712|Ga0209305_1246309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300025732|Ga0208784_1204195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300025832|Ga0209307_1238054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300025869|Ga0209308_10332651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani624Open in IMG/M
3300025869|Ga0209308_10425427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300025879|Ga0209555_10273113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300025879|Ga0209555_10298163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300025880|Ga0209534_10345828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300025881|Ga0209309_10325665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani684Open in IMG/M
3300025887|Ga0208544_10333344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300025887|Ga0208544_10353050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300025887|Ga0208544_10358549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300025890|Ga0209631_10437897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300025897|Ga0209425_10434223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300026182|Ga0208275_1056237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani779Open in IMG/M
3300026390|Ga0247558_128676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300026403|Ga0247557_1034274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300026434|Ga0247591_1077140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300026447|Ga0247607_1077578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300026448|Ga0247594_1080253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani569Open in IMG/M
3300026448|Ga0247594_1104241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300026449|Ga0247593_1075720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300026449|Ga0247593_1117050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300026458|Ga0247578_1096080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300026461|Ga0247600_1127207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300026465|Ga0247588_1126013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300026500|Ga0247592_1106952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300026500|Ga0247592_1108507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani668Open in IMG/M
3300026500|Ga0247592_1157945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300026500|Ga0247592_1166960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300026503|Ga0247605_1110392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300026503|Ga0247605_1173430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300026503|Ga0247605_1179550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300026503|Ga0247605_1182507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300026504|Ga0247587_1187648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300027191|Ga0208021_1064648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300027708|Ga0209188_1208875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani698Open in IMG/M
3300027757|Ga0208671_10244245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300027759|Ga0209296_1351826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300027771|Ga0209279_10134292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300027810|Ga0209302_10161562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1090Open in IMG/M
3300027810|Ga0209302_10232369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani873Open in IMG/M
3300027810|Ga0209302_10254922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani824Open in IMG/M
3300027810|Ga0209302_10448052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300027810|Ga0209302_10488917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300027833|Ga0209092_10267465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani936Open in IMG/M
3300027833|Ga0209092_10468964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300027833|Ga0209092_10503726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300027849|Ga0209712_10513439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300027849|Ga0209712_10521801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300027849|Ga0209712_10554577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300027849|Ga0209712_10557228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300027849|Ga0209712_10585545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300027849|Ga0209712_10651448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300027883|Ga0209713_10746415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300027899|Ga0209668_11131436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300027906|Ga0209404_10797125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
(restricted) 3300027996|Ga0233413_10353264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani638Open in IMG/M
3300028102|Ga0247586_1083953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300028106|Ga0247596_1160967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300028110|Ga0247584_1114882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300028110|Ga0247584_1132987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300028110|Ga0247584_1145609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300028128|Ga0228645_1111465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300028134|Ga0256411_1163326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani723Open in IMG/M
3300028137|Ga0256412_1402009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300028137|Ga0256412_1405786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300028194|Ga0257106_1321722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300028233|Ga0256417_1183394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300028233|Ga0256417_1186807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300028279|Ga0228613_1108077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300028282|Ga0256413_1267588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300028282|Ga0256413_1341825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300028282|Ga0256413_1368625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300028282|Ga0256413_1370335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300028290|Ga0247572_1160402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300028335|Ga0247566_1074229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300028335|Ga0247566_1089106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300028335|Ga0247566_1090253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300028335|Ga0247566_1096853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300028405|Ga0306909_124793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300028595|Ga0272440_1208207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300028672|Ga0257128_1129340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300030671|Ga0307403_10676983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300030699|Ga0307398_10779602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300030702|Ga0307399_10481948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300030715|Ga0308127_1050608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300030724|Ga0308138_1065430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300030780|Ga0073988_10002316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300030781|Ga0073982_11750424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300030870|Ga0151493_119110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300030956|Ga0073944_11333182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300031004|Ga0073984_11285113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300031005|Ga0073974_1802207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300031269|Ga0307983_1093771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300031522|Ga0307388_10554772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300031522|Ga0307388_10764641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300031540|Ga0308143_128361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300031542|Ga0308149_1046311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300031557|Ga0308148_1043015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300031569|Ga0307489_10824953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani654Open in IMG/M
3300031569|Ga0307489_10831052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300031569|Ga0307489_11003359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300031579|Ga0308134_1164137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300031580|Ga0308132_1133225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300031589|Ga0307996_1115963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani709Open in IMG/M
3300031621|Ga0302114_10323738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300031621|Ga0302114_10394684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300031622|Ga0302126_10147091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani878Open in IMG/M
3300031622|Ga0302126_10171113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300031622|Ga0302126_10258491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300031626|Ga0302121_10156614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300031638|Ga0302125_10158335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300031658|Ga0307984_1104721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani819Open in IMG/M
3300031717|Ga0307396_10476862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300031729|Ga0307391_10870564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300031729|Ga0307391_10932839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300031734|Ga0307397_10538332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300031734|Ga0307397_10615630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300031737|Ga0307387_10981509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300031738|Ga0307384_10199172All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Chaetocerotales → Chaetocerotaceae → Chaetoceros → Chaetoceros debilis885Open in IMG/M
3300031738|Ga0307384_10424430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300031738|Ga0307384_10635876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300031739|Ga0307383_10635115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300031743|Ga0307382_10443255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300031743|Ga0307382_10598862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300031758|Ga0315907_11068395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300031851|Ga0315320_10733528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300032047|Ga0315330_10847480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300032092|Ga0315905_11345505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300032481|Ga0314668_10444203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300032481|Ga0314668_10676325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300032518|Ga0314689_10659696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300032518|Ga0314689_10703602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300032521|Ga0314680_10973636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300032615|Ga0314674_10551287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300032650|Ga0314673_10681787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300032650|Ga0314673_10689797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300032650|Ga0314673_10705162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300032707|Ga0314687_10375310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani785Open in IMG/M
3300032707|Ga0314687_10840898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300032708|Ga0314669_10733875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300032709|Ga0314672_1376886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300032711|Ga0314681_10806727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300032727|Ga0314693_10085885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1392Open in IMG/M
3300032730|Ga0314699_10531215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300032733|Ga0314714_10132532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Goniodomataceae → Pyrodinium → Pyrodinium bahamense1308Open in IMG/M
3300032733|Ga0314714_10560045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani635Open in IMG/M
3300032734|Ga0314706_10386615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300032734|Ga0314706_10615370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300032747|Ga0314712_10487408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300032747|Ga0314712_10567997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300032750|Ga0314708_10426663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani645Open in IMG/M
3300032751|Ga0314694_10524193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300033572|Ga0307390_11069636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine33.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.20%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.54%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.65%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.51%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.36%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.61%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.61%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica2.17%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.59%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.16%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.01%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.01%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.01%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.01%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.01%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.01%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.87%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.87%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.72%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.43%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.43%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.29%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.29%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.29%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.29%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.29%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.29%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.29%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.29%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.29%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.29%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.29%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.14%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.14%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.14%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.14%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.14%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.14%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.14%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.14%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.14%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.14%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.14%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.14%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.14%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.14%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.14%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001822Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM39, ROCA_DNA108_2.0um_23aEnvironmentalOpen in IMG/M
3300002186Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M MetagenomeEnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004507Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005599Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91AEnvironmentalOpen in IMG/M
3300005608Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84AEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006602Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008937Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3CEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008995Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009357Microbial communities of water from the North Atlantic ocean - ACM13EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010966Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016EnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012030Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016735Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016743Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016882Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)Host-AssociatedOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018596Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002183 (ERX1782364-ERR1711927)EnvironmentalOpen in IMG/M
3300018601Metatranscriptome of marine microbial communities from Baltic Sea - GS679_3p0_dTEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018670Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782175-ERR1712065)EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018827Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782415-ERR1712182)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020372Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022900Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaGEnvironmentalOpen in IMG/M
3300023173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaGEnvironmentalOpen in IMG/M
3300023178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaGEnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026390Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 3R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028128Seawater microbial communities from Monterey Bay, California, United States - 57DEnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028405Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697 (v2)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030781Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S7_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030870Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S8_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031269Marine microbial communities from Ellis Fjord, Antarctic Ocean - #991EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1024548313300000116MarineMKFAVAALIATVTAVQRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
DelMOWin2010_1017022723300000117MarineMKFTLAVLALVSNANAVEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
SA_S2_NOR15_50mDRAFT_1013524113300000130MarineMFKYAIAVLATAVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
KGI_S1_ANT02_95mDRAFT_1015832713300000136MarineMKFVIATIIASVAATEAGHDGFPLDLNEMYPNKVNLWNNDWSKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
BBAY94_1015328813300000949Macroalgal SurfaceMKFAVAALIASVAAVNRGDGYPENLNEMFPNKESLYSNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
JGI20151J14362_1021158923300001346Pelagic MarineKFAVAALIATVAAVQRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
JGI20155J14468_1013530213300001354Pelagic MarineMKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE*
JGI20155J14468_1015977623300001354Pelagic MarineMKFTLAAFALIAAVSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE*
JGI20158J14315_1018843913300001355Pelagic MarineMKFAVLALIATTAAVTRGDGYPENLNEMFPNKESLYSSNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
ACM39_10369313300001822Marine PlanktonMKLSFAVCALIATTQAAETQAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARKCEGQGWCYGDDACEEVHE*
JGI24539J26755_1016376413300002186MarineMKSFAVIALVMTVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVXESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE*
JGI26079J46598_105353413300003216MarineMMMKFVAVLAATVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
JGI26083J51738_1009163513300003621MarineMKYFAAIALIAGVSAIEKGEGFPMDLNEMYSTKENLYGGDWEKYKKSRQLMVDCDIYESENWLGTGRCKYSWECRGARQCEGQGWCYGDDACEEIHE*
Ga0008458J53046_10275813300003677SeawaterMKLSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0008459J53047_100831413300003683SeawaterKLSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0031658_108069913300003860Freshwater Lake SedimentMKFYALALISAVSASEGPALPDHLGELFSNKESLYSNNWGAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE*
Ga0008280_113241413300004507MarineKSIAVFAIALFAGVEATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0007759_1153573513300004836Freshwater LakeMKFYALAILSAVSASSGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE*
Ga0066830_1006258313300005433MarineMKFLLAVVALISETSAVKTQGFPEHFGEMFPNKSSMYGNDWERYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0066830_1006779413300005433MarineMKLSIVIAALMATTQAAEAQAYPDHLGGRCTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0066831_1012859813300005516MarineMKYIAALLIATCHAALPDHLGELFTTKENLYSSDWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0049082_1026845213300005584Freshwater LenticPKTPKPLINEIISLINNLVNIIIILKMKFYALAILSAVSASEGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE*
Ga0066841_1009476813300005599MarineMKFVIAALVAVNAQTNGFAENLNEMFPNKVNLWNNDWAHYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEVHE*
Ga0066840_1005170323300005608MarineMKLSIVIAALMATTEAAETQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0078894_1150730213300005662Freshwater LakeLNYDNYYRKEVVNIIIILKMKFYALAILSAVSASEGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE*
Ga0070743_1020785023300005941EstuarineMMKFVAVLAATVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0070743_1030397113300005941EstuarineMKSFAVIALVMSVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE*
Ga0070742_1023270613300005942EstuarineMKFVAVLAATVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0075466_114740013300006029AqueousMKFAFALMAIAASSVEAKGEGFAENLNEMFPNKENLWANDWNKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0075502_169579913300006357AqueousLTMKLSIVIAALFATVQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0075512_126138213300006374AqueousKLSIVIAALFATVQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0075513_133093813300006379AqueousLSIVIAALFATVQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0075504_137101013300006383AqueousMKLSIVIAALFATVQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0075509_144615513300006390AqueousILTMKLSIVIAALFATVQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0075517_144286113300006393AqueousTMKLSIVIAALFATVQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0075493_103524413300006396AqueousMAIAASSVEAKGEGFAENLNEMFPNKENLWANDWNKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0075514_181495913300006403AqueousKILTMKLSIVIAALFATVQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0075484_150204213300006602AqueousFTLAIAALMAAVNAEERLPDHLGELFPNKESLYANNWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0075471_1058095013300006641AqueousMKITAALIALVSATEAGHDGFPLDLNEMYPNKVNLWSNDWNKYKKARQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0075467_1050511713300006803AqueousMKITQAAMMLIGANAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0075467_1056597923300006803AqueousMKLVIATLIASAAAGVNDHGGAPLDLNEMYPNKVNLWANDWNKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0075467_1062907413300006803AqueousMKTICLMIASVMAYTPTGFAENLNEMYPNKENLWANDWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0075469_1018560213300007231AqueousMKLVCLLLASVSAYTPTGFAENLNEMYPNKENLWANDWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGYDGCEEIHE*
Ga0075463_1015123613300007236AqueousSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0105019_120791523300007513MarineMKLVQLSVALAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0102873_123053513300007545EstuarineMKFVIALVAYTALVEAKGEGFASNLNEMFPNKENLYNNDWNRYKKARQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEVHE*
Ga0102818_107920423300007552EstuarineMKFVYAALIAAVAAGPIEDNNGPAPLDLNEMFPNKQNLWANDWAKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0102822_112308123300007558EstuarineMKFAVLALIATATARGDGYPENLSEMFPNKLSLYSNDWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0102948_119480613300007623WaterMKFAAATIALIASASAVERNDQYPLNLDEMFPNKVSLYASNWEKYKKSRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACSEVHE*
Ga0102951_118449813300007725WaterMKFVAATIALIASASAVERNDQYPLNLDEMFPNKVSLYASNWEKYKKSRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACSEVHE*
Ga0105744_110328323300007863Estuary WaterMKLSFAVCALIATTQAAETEAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0102904_111302513300007981EstuarineMKFAVIALIATVSAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0114341_1049277313300008108Freshwater, PlanktonNYDNYYRKEVVNIIIILKMKFYALAILSAVSASEGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE*
Ga0114344_122996513300008111Freshwater, PlanktonPKTPKPLYIDNYYREEVVNIIIILKMKFYALAILSAVSASEGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE
Ga0103951_1068026213300008832MarineMKLTIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0103732_101538333300008929Ice Edge, Mcmurdo Sound, AntarcticaLKFAIATLALIASVDAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0103732_106930813300008929Ice Edge, Mcmurdo Sound, AntarcticaMKLSIVICALLATTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0103733_106078513300008930Ice Edge, Mcmurdo Sound, AntarcticaMLMKITLALVALVSTTEATVALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0103734_100334613300008931Ice Edge, Mcmurdo Sound, AntarcticaMKITLALVALVSTTEATVALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0103734_101657313300008931Ice Edge, Mcmurdo Sound, AntarcticaMKSAVAVLIATVAAVNRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0103734_103400213300008931Ice Edge, Mcmurdo Sound, AntarcticaKITLAIVAIIGSASAVEVDTSALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0103736_105747713300008933Ice Edge, Mcmurdo Sound, AntarcticaALVALISTTEATVALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0103737_101007923300008934Ice Edge, Mcmurdo Sound, AntarcticaMKITLAIVAIIGSASAVEVDTSALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0103737_103397513300008934Ice Edge, Mcmurdo Sound, AntarcticaVASVVEIKATRARVIFINIVKIIIALVALVSTTEATVALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0103738_105579013300008935Ice Edge, Mcmurdo Sound, AntarcticaMKFAVCALIATASAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0103738_106507713300008935Ice Edge, Mcmurdo Sound, AntarcticaLKFAVAVLIATVAAVNRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0103739_100955113300008936Ice Edge, Mcmurdo Sound, AntarcticaLKFVIATLALIASVDAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0103740_105243813300008937Ice Edge, Mcmurdo Sound, AntarcticaMKFVIATLALIASVDAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0104259_101462913300008958Ocean WaterLIATTQAAETEAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0104259_102945713300008958Ocean WaterLMKITLAVVAMIATTEANAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0104258_108104613300008993Ocean WaterMKSFAVIALVMTVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE*
Ga0104258_108184123300008993Ocean WaterSMKLSFAVCALIATTQAAETEAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0104258_110453613300008993Ocean WaterKMLMKITLAVVAMIATTEANAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0102888_108940413300008995EstuarineMMMKFVAVLAATVAATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0102831_114405813300008996EstuarineMMKYALVALVSAVAATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0102813_117570813300009003EstuarineMKFAVIALIATASAVTRGDGYPENMNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0102813_119297923300009003EstuarineMKFAVAALIATVAAVNRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMADCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0103706_1022204013300009022Ocean WaterNFSTMKLSIVLCALLATTQAAEAEAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0103708_10024114313300009028Ocean WaterSAATNKKMKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE*
Ga0102911_115413413300009049EstuarineMKSIAVFAIALFAGVEATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115566_1036004713300009071Pelagic MarineMKFAVCALIATASAVQRGDGFPEHLGEMFPNKSSLWANDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115566_1040349113300009071Pelagic MarineMLMKITLAVVAMIATTEANAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0115566_1047680623300009071Pelagic MarineMKFTLAAFALIAAVSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEG*
Ga0115566_1052277023300009071Pelagic MarineMKFAVALALIASVEAVQRGDGFPEHLGEMFPNKSSLWANDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115566_1054114513300009071Pelagic MarineMKSTLAIALIGSVIAAQVDNQALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0115566_1057913713300009071Pelagic MarineMKSIAVFAIALFAGVEASEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115566_1063766013300009071Pelagic MarineMKITAAIALIASVGAVEKDNAYPLNLDEMFPNKVSLYASDWAKYKHTRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACSEVHE*
Ga0115566_1078804013300009071Pelagic MarineMKIVAAIALIASVGAVEKDNAYPLNLDEMFPNKVSLYASDWAKYKHTRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACSEVHE*
Ga0102814_1060611013300009079EstuarineMKIVIAALIASVSSHEGFPENLNEMYPNKVNLWANDWSKYKKARQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0114995_1041578213300009172MarineMKLTIVIIALLGLTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0114995_1049264613300009172MarineMKSTLAIALIGSVIAAQVDNQALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGTCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0115551_130291023300009193Pelagic MarineMKFTLAVLALVSNANAVEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0103743_102846413300009195Ice Edge, Mcmurdo Sound, AntarcticaMKFAIVALIATASAVTRGDGYPENLNEMFPNRESLYANNWAGYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARVCEGQGWC*
Ga0103743_106625713300009195Ice Edge, Mcmurdo Sound, AntarcticaMKFAVAALIATVAAVNRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0103872_106378213300009263Surface Ocean WaterIFSTIKLTFAVCALIATAQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0103873_107029813300009265Surface Ocean WaterMKLTFAVCALIATAQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0103873_109462413300009265Surface Ocean WaterKNMMMKFVAVLAATVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0103873_110624013300009265Surface Ocean WaterMKLSFAVCALIATTQAAETQAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0103873_113380913300009265Surface Ocean WaterMKSALIALIGAAVATEGYPDNLHEMFPNKESLYGSNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0103878_104185613300009274Surface Ocean WaterAVMAASTESEKLPDHLGELFPNKESLYANNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0103880_1005612413300009279Surface Ocean WaterMFAKVTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0103880_1008840913300009279Surface Ocean WaterLVQSMALFVIGAQAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0103827_101463513300009357River WaterLSFAVCALIATTQAAETQAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0114998_1025614713300009422MarineMAAMIFGAEAINKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0115005_1060295313300009432MarineMKLVQLSVTIAALICGAEAVNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0115005_1064067913300009432MarineMKFAVFALIALSSVEAIQRGDGFPEHLGEMFPNKESLWSNDWGKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115005_1102382713300009432MarineMKFALIAIIATASAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115005_1102571313300009432MarineMKFAIIALVATATAVTRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115005_1103930613300009432MarineMKFAIIAIIATASAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115005_1155062713300009432MarineMKFIIAAIVATVAATTQDHDGFPLDLNEMYPNKVNLWGNDWSKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0115545_122985423300009433Pelagic MarineMKFAVAALIATVAAVQRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115562_117479913300009434Pelagic MarineMKFVGVIACLVATTQAIEIEAPLPDHLGELFTTKENLYSSDWETYKKTRQLMVDCDIYESENWLGQGKCKYSWECRGARMCEGQGWCYGDDACEEIHE*
Ga0115562_121974713300009434Pelagic MarineMKFAVIALIATASAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115008_1047941113300009436MarineMKLVNLTLAVALLISSAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0115008_1060469123300009436MarineMKLSLVICALIATTEAAEAQAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115008_1061045213300009436MarineMTLVKVTFAIAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0115008_1100760713300009436MarineMKFACIALIATATAVSRGDGYPENMNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115561_135429013300009440Pelagic MarineMKFAVLALIATSAAVQRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115561_138064013300009440Pelagic MarineMKFAVAALIATVAAVQRGDGFPEHLGEMFPNKSSLWANDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115007_1027561213300009441MarineMKFTLAIAAIMAVVNAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115007_1047459913300009441MarineMTLVKITLAMAALICSAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0115007_1062157513300009441MarineMTLVKITLAMAALILGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDMYESENWLGTGKCKYSWECRGARACEGQGWCYGDDACEEVHE*
Ga0115007_1104731213300009441MarineMMKLVQLSVAMAAMIFGAEAVHKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0115560_124916113300009447Pelagic MarineMKFAVIALIATTSAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115558_138138013300009449Pelagic MarineTEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115558_143923413300009449Pelagic MarineMMMKFVAVLATTVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0126448_111418723300009466Meromictic PondMKFVAATIALIASASAVERNDQYPLNLDEMFPNKVSLYGNNWEKYKKSRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACNEVHE*
Ga0115565_1035751213300009467Pelagic MarineNLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0115565_1036234113300009467Pelagic MarineMKLVIAALVASVSATEQAHGGFPLDLNEMYPNKVNLWSNDWTRYKKQRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0115555_121640413300009476Pelagic MarinePKTPKPHGNEKLKDKNQKVCIINKYLFEMKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE*
Ga0115555_145732813300009476Pelagic MarineVFAIALFAGVEASEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115571_128166323300009495Pelagic MarineSFVGVILLNSLIISNNNKNNFLMKFTLAVLALVSNANAVEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0115569_1021844723300009497Pelagic MarineMKLAVIAALVMTASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0115569_1029463713300009497Pelagic MarineMKFTLAVLALVSNTGAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0115569_1032602613300009497Pelagic MarineMKFAVIALIATVSAVTRGDVYPEYLNEMVPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115568_1030299713300009498Pelagic MarineAALMAAVNAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115572_1051191623300009507Pelagic MarineMKFVIAALVASATAADAGHNGFPLDLNEMFPNKVNLWGNDWSKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0115099_1015143513300009543MarineSQVDSEALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0115099_1081695013300009543MarineTFAVAAVMAATTEKLPDHLGELFPNKESLYGNNWEKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115006_1141936623300009544MarineMKFAVAALIASVAAVQRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115013_1051630413300009550MarineMKLVQSMALFVIGAQAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0115101_117099813300009592MarineMKFTLAIAALMAAVNAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115101_133582913300009592MarineMKFVGVIAMLVAGTSAVHNEAPLPDHLGELYTNKENYYSSNWESYKKTRQLMVDCDIYESENWIGTGKCKYSWECRGARMCEGQGYCYGDDACEEIHE*
Ga0115101_184388713300009592MarineFNMKFVGVIAMLVAGTSAINSEAPLPDHLGELWGNKENYYNSNWESYKKTRQLMVDCDIYESENWLGQGKCKYSWECRGARMCEGQGYCYGDDACEEIHE*
Ga0115103_110665313300009599MarineLTMKLSIVLCALFATTQATEAAAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115103_124709713300009599MarineEAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0115103_132956713300009599MarineLPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0115103_132956723300009599MarineMFAKVTFAIAAMIFGAEAVNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDVYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0115103_140525113300009599MarineMKFAVFALIALSSVEAIQRGDGFPEHLGEMFPNKESLWANDWGKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0115103_175913513300009599MarineMKFVAAIALIASVGAVEKDNAYPLNLDEMFPNKVSLYSSNWAQYKKTRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACSEVHE*
Ga0115103_177749113300009599MarineMRFCFAAAAVMAATTEKLPDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115102_1001687413300009606MarineKMLMKITLAVVAMISTTEAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0115102_1019902913300009606MarineNNFNMKFVGVIAMLVAGTSAINSEAPLPDHLGELWGNKENYYNSNWESYKKTRQLMVDCDIYESENWLGQGKCKYSWECRGARMCEGQGYCYGDDACEEIHE*
Ga0115102_1034500213300009606MarineLGLTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115102_1036859713300009606MarineKMKFTLAIAALMAAVNAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115102_1047413913300009606MarineKVTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0115102_1057971213300009606MarineKNLTMKLSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115102_1069801113300009606MarineVIAMLVAATSAVQNGAPLPDNLNELWGNKENYYSSNWEAYKKTRQLMVDCDIYESENWLGQGKCKYSWECRGARMCEGQGYCYGDDACEEIHE*
Ga0115102_1083263313300009606MarineVGVILLNSLIISNNNKNNFLMKFTLAVLALVSNANAVEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0115100_1021790313300009608MarineNMKLSIVIAALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115100_1054730613300009608MarineIYFTMKFTLAIVALIGSSIASQVDSEALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0115100_1081075713300009608MarineAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0115100_1102266413300009608MarineMKLSIVLCALFATTQATEAAAYPDHLGELFTNKEKLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115104_1056243513300009677MarineKLSIVICALLATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115104_1058738713300009677MarineMKSFAVIALVMSVATAVDVQGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE*
Ga0115105_1015850913300009679MarineMKLSIAICALMATTEAAKTTAYPDHLGEIFTNKENLYGSNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115105_1099316613300009679MarineATAEARLPDHLGELFNNKESLYANDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0123361_104544013300009741MarineSTMKLTFAVCALIATAQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0115001_1050957413300009785MarineMKLVQLSVTIAALICGAEAVNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGGRMCEGQGWCYGDDACEEVHE*
Ga0129345_123845813300010297Freshwater To Marine Saline GradientQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0102890_108240113300010309EstuarineMKSIAVFAIALFAGVEATEGYPENLHETFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0102890_111996213300010309EstuarineMKFAIALIAYTSLVEAKGEGFAANLNEMFPNKENLYNNDWNRYKKARQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEVHE*
Ga0129324_1029810613300010368Freshwater To Marine Saline GradientMKSIAIVAIALFAGVEATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0129323_101596913300010404AqueousGVILLNSLIISNNNKNNFLMKFTLAVLALVSNANAVEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0137675_102013813300010966Pond Fresh WaterMKFYALALISAVSATEGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE*
Ga0137575_1005885223300010970Pond Fresh WaterPKPQNPKTPKPLNYDNYYRKEVVNIIIILKMKFYALAILSAVSASEGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE*
Ga0138326_1174116013300010985MarineMAAMIFSAEAVKKQYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0138324_1047055723300010987MarineKIMKLVQSIALFVIGAQAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0138324_1068662613300010987MarineNMKFALAIVALMSQTAEARLPDHLGELFNNKESLYNNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0136599_106885113300012030Saline LakeMKFVLATLIASVAATGHDGFPLDLNEMYPNKVNLWSNDWSKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE*
Ga0138265_115969613300012408Polar MarineKFTLAVVALISTSSAAMPDHLGELFPNKESMYGNDWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0138266_133510323300012412Polar MarineMKFTLAIFALVSIANAVEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0138264_124076613300012414Polar MarineFTLAVVALISTSSAAMPDHLGELFPNKESMYGNDWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0138264_146237813300012414Polar MarineYKIIFVMMKFTLAVFALIASVSATEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0138262_138083013300012417Polar MarineITNMKFTLAVVALISTSSAAMPDHLGELFPNKESMYGSDWDKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0129328_101381913300012472AqueousLNSLIISNNNKNNFLMKFTLAVLALVSNANAVEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0129347_125347013300012504AqueousKMKFTLAIAALMASVSATERLPDHLGELFPNKESLYGSNWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEAVHE*
Ga0129325_115209113300012516AqueousMKIAAAIALIASVGAVEKDNAYPLNLDEMFPNKVSLYASDWAKYKHTRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACSEVHE*
Ga0129325_133204213300012516AqueousMKYALVALVSAVAATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0129349_106089613300012518AqueousTERLPDHLGELFPNKESLYGSNWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEAVHE*
Ga0129349_106804013300012518AqueousLSIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0129349_117214313300012518AqueousTMKLTFAVCALIATAQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0129326_134356113300012522AqueousVILLNSLIISNNNKNNFLMKFTLAVLALVSNANAVEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0129350_147283013300012523AqueousKFAFAIAAVMAATTEKLPDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0129353_195545613300012525AqueousFTLAIAALMASVSATERLPDHLGELFPNKESLYGSNWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEAVHE*
Ga0129352_1065108013300012528AqueousTVKLTFAVCALIATAQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0138267_111418313300012767Polar MarineMKIAIYIAALAMTASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0138268_111670613300012782Polar MarineMKFTLAVVALISTSSAAMPDHLGELFPNKESMYGNDWDKYNKSRQLMVDCDVYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE*
Ga0160423_1064580513300012920Surface SeawaterMKFAVIALIAGASAVTRGDGYPENLNEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0163110_1127982023300012928Surface SeawaterMKFAVIALIAGASAVTRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE*
Ga0163180_1151984023300012952SeawaterMTLVKITLAMAALIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVTKFFIKNSSENIQKYIP*
Ga0163179_1091078923300012953SeawaterMKFLLAVVALISETSAVKTEGFPEHFGEMFPNKSSMYGNDWERYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0163179_1094508113300012953SeawaterMTFVKLSIAMAALIFSAEAVKKQYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGAR*
Ga0163179_1101029413300012953SeawaterMKLAQLSVAVAAMIYSAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE*
Ga0163111_1089796513300012954Surface SeawaterMKLAVIAALVMTASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0163111_1100119613300012954Surface SeawaterMKSFALIALLGLATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE*
Ga0163111_1132038113300012954Surface SeawaterMKFTLAVLALVSNANASEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0129346_100967813300012965AqueousKFTLAIAALMASVSATERLPDHLGELFPNKESLYGSNWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEAVHE*
Ga0129346_103206713300012965AqueousIFSTMKLTFAVCALIATAQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE*
Ga0129343_104559113300012967AqueousYLKMKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE*
Ga0129332_131570413300012969AqueousLKNLTMKLSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHG*
Ga0129332_146995813300012969AqueousKLSIVLCALFATTQATKAEAYPDHLGELFTNKENIYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGGRQCEGQGWCYGDDACE*
Ga0164292_1084740013300013005FreshwaterPKTPKPLNYDNYYRKEVVNIIIILKMKFYALAILSAVSASESPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE
Ga0170791_1316996513300013295FreshwaterMETGFPDHLGEMFPNKESLYHNDWNRYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE*
Ga0182051_130670713300016727Salt MarshMKFVAAFALIASVSAYETKDDQYPLNLDEIFPNKVSLYASDWAKYKKTRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACNEVHEXKTKLEILNLQ
Ga0182074_137487613300016735Salt MarshKFTLAALALIASVEAKGEGYPNDLNEMFPNKESMYGNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0182096_141526213300016740Salt MarshVIAALFATVQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0182083_158568913300016743Salt MarshFSSMKLSFAVCALIATTQAAETQAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0182055_143571613300016746Salt MarshALSCTLAIAALMAAVSAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0182072_108760713300016754Salt MarshLAIAALMASVSATERLPDHLGELFPNKESLYGSNWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEAVHE
Ga0182091_113970613300016766Salt MarshAAVSAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0186577_10903113300016882Host-AssociatedKVYFRKMKFALATIALLATVEAKGEGFPEHLGEMFPNKESMYGSDWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDSCEEVHE
Ga0181387_104711313300017709SeawaterMKITLAVVAMISTTEAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0181387_106888513300017709SeawaterMKSFAVIALVMSVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQEW
Ga0181387_113596713300017709SeawaterMKTTFAIAALLAVTEAQVKQVYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0181396_110901613300017729SeawaterPQNPKTPKPQNPVITKSLLACIIIKMKFAFAIVAVMANTTEKLPDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181433_117024113300017739SeawaterMKLSFAVCALIATAQAAETQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181382_114234323300017756SeawaterMKLSFVLCALMATTQAAEAEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEIHE
Ga0181420_107156113300017757SeawaterMKFVLAIIALASATERLPDHLGELFPNKESMYKNNWDSYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181410_114604913300017763SeawaterKNPKTPKPQNPVIKKSLLACIIIKMKFAFAIAAVMAATTEKLPDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181425_112329923300017771SeawaterMKLSFVLCALMATTQAAEAEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181394_119222223300017776SeawaterMKFVLAAIVAVQAQTNGFAENLNEMFPNKVNLWNNDWAHYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEVHE
Ga0181394_126457513300017776SeawaterMAATTEKLPDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181565_1048388813300017818Salt MarshMMMKFVAVLAATVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181552_1045335013300017824Salt MarshMKFAFALMAIAASSVEAKGEGFAENLNEMFPNKENLWANDWNKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0181584_1069398123300017949Salt MarshMKFVFAALVASASATQGSHDGFPLDLNEMFPNKVNLWANDWARYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0181577_1055452813300017951Salt MarshMKFTLAALVLLSATNAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0181577_1067639813300017951Salt MarshMKSIAVFAIALFAGVEATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181583_1064412313300017952Salt MarshMKFTIAIAALVASATASQKGGGFPMDLNEMYPNKENLYGSDWEKYKKTRQLMVDCDIYESENWLGTGRCKYSWECRGARMCEG
Ga0181583_1077304113300017952Salt MarshMKFTIALMALAAASVEAKGEGFAENLNEMFPNKENLWSNDWNKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0181582_1056365313300017958Salt MarshMKFTLAALALIASVEAKGEGYPNDLNEMFPNKESMYGNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0181582_1076781013300017958Salt MarshMMKVIAALIGAAVATEGYPDNLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181590_1072944513300017967Salt MarshMKFVIATLAASVAATEAGHDGFPLDLNEMFPNKVNLWNNDWNRYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181569_1086495413300017986Salt MarshMKFAVAALIASVAAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0181572_1069922523300018049Salt MarshMKFTVLALIATATARGDGYPENLSEMFPNKLSLYNNDWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHEXDITYXCAISSIPM
Ga0181561_1044658413300018410Salt MarshMKIAAAIALIASVGAVEKDNAYPLNLDEMFPNKVSLYASDWAKYKHTRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACSEVHE
Ga0181558_1063646813300018417Salt MarshMKFVAVLAATVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181593_1080138723300018423Salt MarshMKYVLLALVSTAAATEGYPDNLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHEXAFQAVLMRSATVTINQPNAETI
Ga0181591_1095450513300018424Salt MarshMKFVIAALVASVSATEAGHDGFPLDLNEMFPNKQNLWQGDWNKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0192960_10697113300018515MarineMKLSIVLCALLATTQGAETEAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193060_101457213300018596MarineMKLSIVLCALLATTQAAEAEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0188850_102440413300018601Freshwater LakeMKFTLAIAALMAAVSAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193355_101871913300018628MarineMKFALAIVALMSSTAEARLPDHLGELFNNKESLYNNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193355_102217113300018628MarineMGILKLIIYINKSIMQLVQLSMAVAAMIYGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193355_102390213300018628MarineMKLSIVLCALMATTQAAEATAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193355_102652213300018628MarineMKLSIVLCALLATTEAAESQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193355_102672713300018628MarineMKLSIVLCALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193355_102818113300018628MarineMTLVKLTLAMAALIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193355_102882113300018628MarineMQLVSLSVAMAAMIYGAEAVKKGYPDHLGEMFPNKESMYANDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192969_105054413300018649MarineMKLSIVLCALLATTNGAETEAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192846_103681713300018655MarineMKFTLAALVLISATNAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0192819_104841313300018670MarineMKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193166_102019813300018674MarineMRFTLAVVALIGASEAAMPDHLGELFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0193166_103061613300018674MarineTWGIIINMKFAFAIAAVMAATTEKLPDHLGELFPNKESLYANNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192983_105999913300018684MarineMKFAVAVLIATVAAVNRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0192983_106267013300018684MarineHGEYKKYFTMKITLAIVAIIGSASAVEVDTSALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0192944_104340613300018692MarineMKLSIVICALLATTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192944_105236413300018692MarineMKSFAVIALVMSVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0192944_105648313300018692MarineHGELNNNNFYYKKMLMKITLAVVAMIATTEANAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0192944_105829113300018692MarineMKFTLAAFALIAAVSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0192944_105929513300018692MarineMKLAVIAALVMTASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0193517_107349813300018725MarineMKFIAAALLAMTAQATEALPDHLGELFTTKENLYSSDWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193517_107643013300018725MarineTWGIKFFIYFTMTLVKVTFAIAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192967_105794013300018730MarineMGKLAVIAALVMVASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0192967_108075913300018730MarineMKITLAIVAIIGSASAVEVDTSALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0192967_108148913300018730MarineMKITLALVALISTTEATVALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0193138_105105313300018742MarineIFSTMKLTIVIAALMATTQAAEATAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193000_106789713300018745MarineTWGIFIRKMKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193000_106984413300018745MarineMKSFAVIALVMSVATAVDVQGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193000_107313613300018745MarineHGELKMKFALAAIVALINTAEARLPDHLGELFNNKESLYNNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193468_106728313300018746MarineLCALLATTQAAEAEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192963_107887613300018762MarineKILTMKLSIVLCALLATTNGAETEAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192827_107868613300018763MarineMKLSFAIAALIATTQAAETAAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192827_107911813300018763MarineMKLSIVLCALFATTNAAEAEAYPDHLGELFTTKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192827_108008313300018763MarineMKSFAVIALVMSVATASEVQGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193031_107635213300018765MarineMKLTLAVAALIAFTKAAEVEAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHEXADKPPNGGDGRIVYPDV
Ga0193031_107713713300018765MarineMKLSIVIAALMATTEAAETQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193031_108112113300018765MarineMKLSFAVCALIATTQAAETQAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHEXADKPPNGGDGRIVYPDV
Ga0193031_108689613300018765MarineTWGIIKFFIDSINMTFVKLSLAMAALIFSAEAVKKQYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193031_108815613300018765MarineMKFVIALLIATTNAATTEALPDHLGELYANKESLYHNNWEQYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193031_108828313300018765MarineMKFLVAVAALISTSSAVKTQGFPEHLGEMFPNKSSMYGNDWERYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193149_106449513300018779MarineSIVLCALFATTNAAEVEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192832_106075213300018782MarineMKFALAIIATMSSTAQARLPDHLGELFNNKESLYNNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193124_107188823300018787MarineKLSIVLCALFATTNAAEVEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193306_106914413300018800MarineKILTMKLSIVLCALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193306_107538813300018800MarineLSFAIAALIATTQAAETEAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193183_108441013300018811MarineHELKILTMKLSIVLCALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192829_110652713300018812MarineLTMKLSIVLCALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193366_106547013300018827MarineMKITLAVAALIGMTSAVDVQGYPDHHGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193366_107115013300018827MarineMKFTLAIAALVGIATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0192949_110274413300018831MarineATMKLSIVLCALLATTQAAEVEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192949_110843513300018831MarineKILTMKLSIVLCALLATTQGAETEAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0194240_101680423300018832MarineMKLTIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0194240_103569613300018832MarineHGEYKKYFTMKFTLAIVALIGSSIATESEALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193219_107494013300018842MarineVIAALVMSASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193253_112029913300018846MarineMKFTLAIVALIGSSIAAQTDVEALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193253_112589813300018846MarineMKFTLAIVALIGSSIAAQTDVEALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0193253_112855713300018846MarineKILNMKLSIVIAALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193253_113593813300018846MarineKFLTMKLSIVLCALFATTQATEAAAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192970_109933123300018848MarineLTMKLSIVLCALLATTNGAETEAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193475_107181313300018855MarineMKLVQSMALFVIGAQAMXXXXTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193475_108285913300018855MarineMGNYKNILITMKFLLAVVALISEPSAVQTSGFPEHFGEMFPNKSSMYGNDWERYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192978_109972013300018871MarineIFIYFTMTLVNLTLAMTALIFGAEAVQKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGGRMCEGQGWCYGDDACEEVHE
Ga0193553_114567313300018873MarineILKLIIYINKSIMQLVQLSMAVAAMIYGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192977_109334413300018874MarineMKFTLAVVALISTSSAAMPDHLGELFPNKESMYGSDWDKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0192977_109905613300018874MarineKYFTMKITLAIVAIIGSASAVEVDTSALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0193471_109401213300018882MarineLAIAALMAAVNAEEKLPDHLGELFPNKESMYHDNWASYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192868_1008150313300018913MarineMKLTLAIVALIGSSIATEALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0192868_1008894813300018913MarineMKFAVAALIATVAAVQRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0192868_1009073113300018913MarineTWGIIIFYYKKMLSKITLAVVAMVSTTEAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0192989_1016331113300018926MarineFLTMKLSIVLCALFATTQATEAAAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192989_1016469913300018926MarineAIAALMASVSATERLPDHLGEMFPNKESMYGNNWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEAVHE
Ga0193260_1011074013300018928MarineIFSSMKLSIVLCALFATTNAAEAEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193260_1012073013300018928MarineCDIYESENWLGTGKPVHLGELFPNKESLYGNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192820_1014203613300018932MarineMKFTLAALVLLSATNAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192820_1017636713300018932MarineMALFVIGAQAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193254_1005590023300018976MarineMCFSSSTFSLSLFATTQATEAAAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193353_1021264813300018977MarineMTLLKISVAMAALIFNAEAVKKGYPDHLGEMFPNKESLYANDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193353_1021737213300018977MarineMGNNINFIYFTMTLVKLTLAMAALIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193353_1024019013300018977MarineMKFTLLALIGVNAAMPDHLGELFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193353_1025352513300018977MarineMKLVQSMALFVIGAQAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193540_1021002213300018979MarineENNIYLKMKSFAVIALVMSVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0192961_1025018613300018980MarineMFKFAIAVLATAVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192968_1015703813300018981MarineMKLPIVLCALLATTNGAETEAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192968_1019154813300018981MarineMKLAVIAALVMVASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0192947_1017882113300018982MarineMKLTIVIAALMATTQAAETTAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192947_1023271813300018982MarineTWGINLKMKFVLAIIALASATERLPDHLGELFPNKESMYKNNWDSYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192947_1023491013300018982MarineTWGIYKNMKLSIVICALLATTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192947_1026013113300018982MarineMKLVPTIALFVIGAQAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192947_1027253513300018982MarineMLVKVTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192947_1027480313300018982MarineMKFAVLALIAMSANQVEAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0192947_1029099813300018982MarineMKFAIATLALIASVEAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0192947_1029194413300018982MarineMKFAVAALIATVAAVNRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0192947_1030089913300018982MarineTWGDFINLFSIINMKFAVCALIATASAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0193554_1033414813300018986MarineMKLSIVLCALLATTQAAETQAYPDHLGELFTNKENLYSNNCEKYNKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193275_1029948813300018988MarineMKLVQLSVALAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193030_1018952313300018989MarineMKLSFAVAALIAVTKAAEVEAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193030_1019413623300018989MarineMKLSIVLCALFATTNAAEVEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193030_1019940523300018989MarineMKLSIVICALLATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193030_1026358113300018989MarineMGIKNNIYLKMKSFAVIALVMSVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193030_1027255013300018989MarineMTLVKLTLAMAALIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGSRMCEGQGWCYGDDACEEVHE
Ga0193030_1027307413300018989MarineMGIIKFLINLIMTLVKITLAMAALIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193030_1027566013300018989MarineMKLVQSTLLLVGASAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193030_1028046013300018989MarineTWDQRRVHGELKILTMKLSIVLCALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193030_1029882023300018989MarineMKFVIALLIATTNAATTEALPDHLGELYANKESLYHNNWEQYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193030_1030136813300018989MarineMKLSFAVAALIAVTKAAEVEAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193030_1030971213300018989MarineMKLVQLSVAVAAMIYGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193030_1031069513300018989MarineMKFALAIVALMSQTAEARLPDHLGELFNNKESLYNNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193257_1024527413300018997MarineKLSIVIAALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193034_1016254613300019001MarineHGEYKLIIYIKKSIMKLVQLSVAVAAMIYGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193034_1017501813300019001MarineMGNLKMKFVLAIIALASATERLPDHLGELFPNKESMYKNNWDSYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193034_1018418813300019001MarineTWGIYINQEIMKLVQLSVAMAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193033_1022581413300019003MarineLSIVLCALFATTNAAEVEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193044_1012678413300019010MarineMGIINLKMKFVLAIIALASATERLPDHLGELFPNKESMYKNNWDSYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193044_1023955713300019010MarineMTWGKIIFFIKMKLAVIAALVMTASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0193044_1026882213300019010MarineMKFTLAVFALIASVSATEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0193044_1027664113300019010MarineMKTTFAIAALVAVTEAQVKQVYPDHLGEMFPNKESMYGNNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193043_1019444113300019012MarineAIIALASATERLPDHLGELFPNKESMYKNNWDSYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193043_1029633313300019012MarineLAVIAALVMTASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0193043_1035776913300019012MarineKMKLAVIAALVMTASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0193569_1040837013300019017MarineLTLAVAALIAFTKAAEVEAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192982_1034689713300019021MarineMKIAIYIAALAMTASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0192982_1036931113300019021MarineMKFAVLALIATVAAVNRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0192982_1037047413300019021MarineMKFAVLALIATVAAVNRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHEXVLSLAXKFVNVSKP
Ga0192951_1040893713300019022MarineMLMKITLAVVAMIATTEANAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0193545_1014559313300019025MarineMKISLAVVAMISTTEAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192909_1024595313300019027MarineMKLSIVIAALMATTQAAEAEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192909_1025277313300019027MarineMTLVKLTIAMAALIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192909_1027593413300019027MarineMKFAIATLALIASVEAVQRGDGFPEHLGEMFPNKSSLWNSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0192909_1027830513300019027MarineMKLTIVIAALMAATQGAETQAYPDHLGELFTTKENLYNGNWEKYKKSRQLMVDCDTYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0192909_1028923313300019027MarineMKLIQLAAMALIGAQAKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192909_1030722013300019027MarineMGKINFTMKFTLAALVLISATGAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193516_1027451513300019031MarineMKLVQLSVAMAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193516_1027933613300019031MarineMTLVKVTFAIAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193516_1028022913300019031MarineRGIIKILITMKFLLAVVALISETSAVKTEGFPEHFGEMFPNKSSMYGNDWERYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193516_1028390713300019031MarineMGNINFIYFTMTLVKLTLAMAALIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193516_1029764213300019031MarineTWGININMKLITFAALVLGTSALKKGAGFPENMNEMFPNKESMYGNDWDRYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGAR
Ga0193516_1029821513300019031MarineTWGIIIKIFILTMKFLLAVVALISETSAVKTQGFPEHFGEMFPNKSSMYGNDWERYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARSCEGQGWCYGDDACEEVHE
Ga0193516_1031159313300019031MarineMKFTLAAIALLSVAQSVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0192869_1032921713300019032MarineHGELNMKFALAIVALMSQTAEARLPDHLGELFNNKESLYNNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192869_1045322013300019032MarineMGRLIIKNIFFIKMKLAVIAALVMTASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0192869_1046419523300019032MarineMTLVKITLAMAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWERRGARMCEGQGWCYGDDACEEVHE
Ga0192869_1046862813300019032MarineTWGIKIIFYIYFTMTLVKLSVAIVALIFGADANQKGYPDHLGEIFPNKESMYANDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192869_1048212613300019032MarineTWGINNISVIKIMKLVVALLVMGAQAMRKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGSRMCEGQGWCYGDDACEEVHE
Ga0192869_1049773713300019032MarineTFVNNKIFIFLMFAKVIASLMLSASAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEESVNEHDEWQKGHAAIFQPLIPT
Ga0193037_1030411613300019033MarineTWGIKFFIYFTMTLVKITFAIAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192945_1019728813300019036MarineMKLSIVPCALLATTQAAEAEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192945_1024085813300019036MarineMGNNIINMKFAAIAALVMTVSASAGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0192945_1025446413300019036MarineMKFTLAALVFISASGAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0192945_1027999213300019036MarineMKFAAALALIASVEAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0192945_1028781013300019036MarineMKFAVLALIATATAVNRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0193123_1040576513300019039MarineHGELNMKFVLALVALMKNCEARLPDHLGELFNNKESLYNNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193336_1061251313300019045MarineMKLSIVICALMATTQATEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193336_1066662113300019045MarineMKFALALIATMSSTAQARLPDHLGELFNNKESLYNNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193336_1067169713300019045MarineTWDFTMKFTLAAIALLSVAQSVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192981_1023919213300019048MarineMKLVQLSVAIAALICSADAVNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHEXATLVTV
Ga0192981_1028562713300019048MarineMTLVKITLAMAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGGRMCEGQGWCYGDDACEEVHE
Ga0192981_1030737713300019048MarineMKLVQLSVAIAALICSADAVNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGGRMCEGQGWCYGDDACEEVHE
Ga0192981_1032134813300019048MarineMKFVIAAIIASASAVDQAHDGFPLDLNEMYPNKVNLWTNDWAKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0192981_1034463113300019048MarineMKFIIAAIVAVVAAKQDHDGFPLDLNEMYPNKVNLWTNDWNKYKKSRQLMVDCDIYESENWMGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192981_1036402213300019048MarineMKLACIAALVMVASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0192966_1023805713300019050MarineMKLAVIVALVMVASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0192966_1027552213300019050MarineMKLSIAICAILATTTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192966_1034807213300019050MarineMKLVPTIALLVIGAQAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192826_1036207013300019051MarineHGENNFTMKFTLAVLALVSNANASEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0192826_1036327113300019051MarineHGEFIFFIKMKLAVIAALVMSATATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0192826_1036441413300019051MarineTWEFIFFIKMKLAVIAALVMSATATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0192826_1037386313300019051MarineMKLSIVLCALMATTQAAETQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0192826_1038490413300019051MarineMKLSIVICALLATTQAAEAEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192826_1038493513300019051MarineHGELKMKFALALIATMSSTAQARLPDHLGELFNNKESLYNNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0188866_102398613300019095Freshwater LakeMKFTLAIAALMASTQAAERLPDHLGELFPNKDSLYASNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0188866_102475213300019095Freshwater LakeFCFAAAAVMAATTEKLPDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0188866_103525213300019095Freshwater LakeTMKLSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193153_102861013300019097MarineHGGYNKYKLIQKMKITLAVAALIGMTSAVDVQGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193153_103254513300019097MarineMGIIKNIFFIKMKLAVIAALVMTASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0193153_103564213300019097MarineRVHGEYKLIFNKLIMKFAVAALIATVTAVQRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0193045_107598113300019100MarineEIKIIFFIKMKLAVIAALVMTASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0194243_100913313300019102MarineHGDINHIYLKMKSFAVIALVMSVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193541_108591913300019111MarineNNIYLKMKSFAVIALVMSVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193243_105468413300019116MarineMKLIALFALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193243_105487813300019116MarineMGKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193243_106022613300019116MarineMKFAVLALIASVSAVQRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0193243_106023213300019116MarineMKFTLAVLALVSNANASEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0193054_106616113300019117MarineNMGKIIFIRKMKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0193054_107574313300019117MarineTWGYKLIILINKIMKLVQSIALFVIGAQAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193157_102710913300019118MarineTWGIINLKMKFVLAIIALASATERLPDHLGELFPNKESMYKNNWDSYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0193157_103301013300019118MarineMKFVILSVIGAVSAVQKGVGFPEHLGEMFPNKESMYGNDWERYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193157_103339513300019118MarineTWGRSLINNIYFTMTLVKITLAMAALIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGSRMCEGQGWCYGDDACEEVHE
Ga0193157_103379913300019118MarineHGEIHIKIKLIIYIYQSIMKLVQLSVAMAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193157_103695813300019118MarineMGKLILNKLIMKFAVAALIATVAAVQRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0193157_103786113300019118MarineMKLVQLSVAVAMMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193157_103812213300019118MarineMKLSIAICALIAGTQAAETQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192980_109969713300019123MarineMKLVQLSVAMAAMILSAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0192980_110287513300019123MarineMKFAVLAVIATASAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHEXS
Ga0193104_106548413300019125MarineMGNKIFIFLMFAKVTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0193089_112769013300019133MarineMKVVLAIVALIGSSIAAQTDVEALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0193089_114395213300019133MarineMKIVMFTAVATVAALNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDVYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0188870_1014097813300019149Freshwater LakeMKLSLVICALIATTEAAEAQAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0194244_1004238623300019150MarineMGIINNIYLKMKSFAVIALVMSVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0194244_1005166513300019150MarineHGEFIFFIKMKLAVIAALVMSASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0192975_1032477313300019153MarineILTMKLSIVLCALLATTNGAETEAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0180036_101077713300019200EstuarineMKSIAIVAIALFAGVEATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQSEGQGWCYGDDACEEVHE
Ga0182064_104734713300019253Salt MarshLAIAALMAAVSAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0182066_124084513300019262Salt MarshVLLSATNAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0182061_112339213300019266Salt MarshFTLAIAALMAAVSAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0182059_142243813300019272Salt MarshKMKFTLAALALIASVEAKGEGYPNDLNEMFPNKESMYGNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0182059_144531113300019272Salt MarshKFTLAIAALMAAVSAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0182073_115601213300019274Salt MarshSKMKFTLAALALIASVEAKGEGYPNDLNEMFPNKESMYGNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0182067_127002313300019276Salt MarshIAALMAAVSAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0182068_128836413300019280Salt MarshFTLAIAALMAAVNAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0181562_1045231213300019459Salt MarshMKFVAAFALIASVSAYETKDDQYPLNLDEIFPNKVSLYASDWAKYKKTRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACNEVHE
Ga0182086_124830213300020013Salt MarshLMAAVSAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0194113_1093703323300020074Freshwater LakeMKFYALAILSAVSASEGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE
Ga0206125_1028162613300020165SeawaterMKFAVAALIATVAAVQRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0206125_1033267623300020165SeawaterMKFTLAVLALVSNANAVEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0206128_124375713300020166SeawaterMKFVIAALVASATAADAGHNGFPLDLNEMFPNKVNLWGNDWSKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0206124_1026009013300020175SeawaterMKLSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0206129_1031369013300020182SeawaterMKFAVAALIASVAAVNRGDGYPENLNEMFPNKESLYSNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0211683_1019120713300020372MarineMMKFTLAVFALIASVSATEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0211686_1026110313300020382MarineMKFTLAVLALVSIANASEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0211686_1026577923300020382MarineMKLSIAICALLATTTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0206126_1027055013300020595SeawaterMKFAVCALIATASAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0206677_1035145013300021085SeawaterMKFVIATLALIASTEAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0206687_110286313300021169SeawaterLNMKLSIVIAALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0206687_120092113300021169SeawaterMKFVGVIAMLVAATSAVQNGAPLPDNLNELWGNKENYYSSNWEAYKKTRQLMVDCDIYESENWLGQGKCKYSWECRGARMCEGQGYCYGDDACEE
Ga0206687_190221413300021169SeawaterMAAMIFGAEAINKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0210301_131497113300021325EstuarineMKFVYAALIAAVAAGPIEDNNGPAPLDLNEMFPNKQNLWANDWAKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0210301_137166113300021325EstuarineMMKFVAVLAATVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0206691_103208413300021342SeawaterINFTFTMKFATLALIAMSAASVEAVQKGDGFPEHLGEMFPNKESLWANDWTKYKHSRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0206691_140230213300021342SeawaterMKFVYAALIASTSAQANGFAENLNEMFPNKVNLWNNDWAHYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEVHE
Ga0206695_122811613300021348SeawaterMKLSIVLCALFATTQATEAAAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0206695_176816713300021348SeawaterMKFVIAALVATISASESGPVFPLDLNEMFPNKVNLWKNDWASYKKSRTLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0206693_162532513300021353SeawaterMKLIAIAALMATSYAAEAYPDHLGEIFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0206693_195352613300021353SeawaterKMLMKITLAVVAMISTTEAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0206690_1041618423300021355SeawaterMKSVGVIAMLVAATSAVQNAAPLPDNLNELWGNKENYYSSNWEAYKKTRQLMVDCDIYESENWMGQGKCKYSWECRGARMCEGQGYCYGDDACEEIHE
Ga0206689_1047807613300021359SeawaterMTLVKITLAMAALICNAESVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0206689_1107576913300021359SeawaterAAVMAATTEKLPDHLGELFPNKESLYGNNWEKYKKSRKLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0206123_1030854113300021365SeawaterMKFAVALALIASVEAVQRGDGFPEHLGEMFPNKSSLWANDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0213865_1037393923300021373SeawaterMKLVIASIIAAAAGAEFHDGFPLDLNEMYPNKVNLWTNDWSRYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCQEIHE
Ga0213865_1042595213300021373SeawaterMKFVIAALVATASAVEAGHDGFPLDLNEMFPNKVNLWANDWNKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDAGCQEIHE
Ga0213861_1042100913300021378SeawaterMKSIAVFAIALFAGVEASEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0063105_100705213300021887MarineILTMTLVKITLAMAALICSAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0063105_104617813300021887MarineLAIAAIMAVVNAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0063086_100260013300021902MarineINTIIMKIVMFTAVATVAALNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDVYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0063086_100384913300021902MarineYFTMFAKVTFAIAAMIFGAEAVNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDVYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0063135_106754613300021908MarineLSFAVAALIAVTKAAEVEAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0063133_101143513300021912MarineNFSTMKLSIVLCALLATTQAAEAEAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0063133_101499213300021912MarineKLSIVLCALFATTQATEAAAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0063104_105425313300021913MarineKFTLAIAAIMAVVNAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0063098_102527513300021942MarineKMKFTLAIAAIMAVVNAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0222717_1031560013300021957Estuarine WaterMKITQAAMMLIGANAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0222717_1039092713300021957Estuarine WaterMFAKVTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0222713_1064177413300021962Estuarine WaterMKIVFAALVASATAMEATHDGFPLDLNEMFPNKVNLWANDWNKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0222713_1064795513300021962Estuarine WaterMKSIVAIALLAGVEAGYPDNLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0222713_1070586813300021962Estuarine WaterMKFTIALMALAAASVEAKGEGFAENLNEMFPNKENLWNNDWNKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0222713_1074051913300021962Estuarine WaterMKFVIALVAYTALVEAKGEGFASNLNEMFPNKENLYNNDWNRYKKARQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEVHE
Ga0222713_1081060813300021962Estuarine WaterMKFAIALIAYTSLVEAKGEGFAANLNEMFPNKENLYNNDWNRYKKARQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEVHE
Ga0255771_131366013300022900Salt MarshALMAIAASSVEAKGEGFAENLNEMFPNKENLWANDWNKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0255776_1059278613300023173Salt MarshMKFTLAIAALMAAVNAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0255776_1063556513300023173Salt MarshMMKYVLLALVSTAAATEGYPDNLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0255759_1062336423300023178Salt MarshMKFAAALALIASVEAVQRGDGFPEHLGEMFPNKSSLWANDWGKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0232113_103448013300023679SeawaterINIGIYYTFIFIVNNKFLYFAMFAKVTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0232113_103547513300023679SeawaterLSIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0228683_104008113300023694SeawaterFFRMKLSIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0228682_105123113300023698SeawaterMKLSIVIAALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0228682_106131113300023698SeawaterFNMKFVGVIAMLVAGTSAINSEAPLPDHLGELWGNKENYYNSNWESYKKTRQLMVDCDIYESENWLGQGKCKYSWECRGARMCEGQGYCYGDDACEEIHE
Ga0228684_106873713300023704SeawaterLSIVIAALMATTQAAEAQAYPDHLGERFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0233399_111299513300024231SeawaterMKFAVLALIATATARGDGYPENLSEMFPNKLSLYSNDWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0228664_109355513300024294SeawaterMKLSIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0244777_1066087023300024343EstuarineMKFALVALIATVSAGPTAEHGGFPENLNEMFPNKVNLWANDWSKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0244775_1073822323300024346EstuarineMKYALVALVSAVAATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0244775_1099307113300024346EstuarineMKFAVIALIATVSAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0244775_1142841113300024346EstuarineMLMKITLAVVAMISTTEAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0209634_116850313300025138MarineMKLVQSMALFAIGAQAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0209634_118607323300025138MarineMKLSIVICALMATTQAAEATAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0208660_112193313300025570AqueousMKTICLMIASVMAYTPTGFAENLNEMYPNKENLWANDWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0209405_112187313300025620Pelagic MarineMKFTLAAFVLISATSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0209716_109565023300025626Pelagic MarineMKSFAVIALVMTVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0209716_111655413300025626Pelagic MarineMKLTIVIIALLGLTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0209716_114853223300025626Pelagic MarineMKFAVLALIATSAAVQRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0209136_114613513300025636MarineMMNSVLLAIVATVSATTTEGYPDNMHEMFPNKESLYGGNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0209306_111057313300025680Pelagic MarineMKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0209652_118415413300025684MarineMKFVAVLAATVSATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARSCERGGFCSGWDACVETPFPMQAPGILPDH
Ga0209715_116850613300025699Pelagic MarineMKFTLAVLALVSNTGAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0209602_117771113300025704Pelagic MarineMKFAVIALIATTSAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0209305_124630913300025712Pelagic MarineMKFAIATLALIASVEAVQRGDGFPEHLGEMFPNKSSLWANDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0208784_120419513300025732AqueousMKITAALIALVSATEAGHDGFPLDLNEMYPNKVNLWSNDWNKYKKARQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0209307_123805423300025832Pelagic MarineVASVSATEQAHGGFPLDLNEMYPNKVNLWSNDWTRYKKQRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0209308_1033265123300025869Pelagic MarineMKITAAIALIASVGAVEKDNAYPLNLDEMFPNKVSLYASDWAKYKHTRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACSEVHE
Ga0209308_1042542713300025869Pelagic MarineMKIVAAIALIASVGAVEKDNAYPLNLDEMFPNKVSLYASDWAKYKHTRQLQVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACSEVHE
Ga0209555_1027311313300025879MarineMKYFAAIALIAGVSAIEKGEGFPMDLNEMYSTKENLYGGDWEKYKKSRQLMVDCDIYESENWLGTGRCKYSWECRGARQCEGQGWCYGDDACEEIHE
Ga0209555_1029816313300025879MarineMKIAIALNALVLAATAKGEGFPMDLNEMYSTKENLYGNDWEKYKKSRQLMVDCDIYESENWLGTGRCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0209534_1034582823300025880Pelagic MarineMKLVIAALVASVSATEQAHGGFPLDLNEMYPNKVNLWSNDWTRYKKQRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0209309_1032566513300025881Pelagic MarineMKFAVCALIATASAVQRGDGFPEHLGEMFPNKSSLWANDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0208544_1033334413300025887AqueousMKLVIATLIASAAAGVNDHGGAPLDLNEMYPNKVNLWANDWNKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0208544_1035305013300025887AqueousMKLVCLLLASVSAYTPTGFAENLNEMYPNKENLWANDWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0208544_1035854913300025887AqueousMKTICLMIASVIAYTPTGFAENLNEMYPNKENLWANDWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0209631_1043789713300025890Pelagic MarineMKFAVLALIATTAAVTRGDGYPENLNEMFPNKESLYSSNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0209425_1043422323300025897Pelagic MarineMKFTLAVLALVSNANAVEVEGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEVHE
Ga0208275_105623713300026182MarineMKYIAALLIATCHAALPDHLGELFTTKENLYSSDWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247558_12867613300026390SeawaterLAAIALLSVAQTVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247557_103427413300026403SeawaterMKLSIVLCALMATTQAAETQAYPDHLGELFTTKENLYNGNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247591_107714013300026434SeawaterMKSIAIALVAAVAASTTEGYPDNKHEMFPNKESLYGSNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247607_107757813300026447SeawaterMFAKTFAIAALIFGAEAVNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGSRMCEGQGWCYGDDACEEVHE
Ga0247594_108025313300026448SeawaterKLSFAVCALIATTQAAETQAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247594_110424113300026448SeawaterKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0247593_107572013300026449SeawaterKLSIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247593_111705013300026449SeawaterLTMKLSIVLCALFATTQATEAAAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247578_109608023300026458SeawaterMKLTFAVCALIATAQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0247600_112720713300026461SeawaterMKFTLAIVALIGSSIASQVDSEALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0247588_112601313300026465SeawaterMKLSFAVCALIATTQAAETQAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247592_110695213300026500SeawaterMLMKITLDVVAMISTTEAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0247592_110850723300026500SeawaterFTLAIAALMAAVSAEERLPDHLGELFPNKESMYNNSWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247592_115794513300026500SeawaterKMKSFAIVLVAAVAASATEGYPDNMHEMFPNKESLYGSNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247592_116696013300026500SeawaterMKLTFAVCALIATAQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247605_111039213300026503SeawaterMFLVASAAALNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0247605_117343013300026503SeawaterEKMKSFAIVLVAAVAASATEGYPDNMHEMFPNKESLYGSNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247605_117955013300026503SeawaterMKSFAIALVGAVAATATEGYPDNMHEMFPNKESLYGSNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247605_118250713300026503SeawaterSIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247587_118764813300026504SeawaterFAMFAKVTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0208021_106464813300027191EstuarineMKFAVIALIATASAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0209188_120887513300027708Freshwater LakeMKYFTLALLGAVSATESHALPDHLGELFSTKENLYGGSWETYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE
Ga0208671_1024424523300027757EstuarineMKSIAIVAIALFAGVEATEGYPENLHEMFPNKESLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0209296_135182613300027759Freshwater LakePKTPKPLFNDNYYRKEVVNIIIILKMKFYALAILSAVSASEGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE
Ga0209279_1013429213300027771MarineMLMKITLALVALVSTTEATVALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0209302_1016156213300027810MarineMKFTLAIAAIMAVVNAEERLPDHLGELFPNKESLYNNNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0209302_1023236913300027810MarineMMKLVQLSVAMAAMIFGAEAVHKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0209302_1025492213300027810MarineMTLVKITLAMAALICSAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0209302_1044805213300027810MarineMKFIIAAVVAVVAAKQDHDGFPLDLNEMYPNKVNLWTNDWNKYKKSRQLMVDCDIYESENWMGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0209302_1048891713300027810MarineMKFACIALIATATAVSRGDGYPENMNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0209092_1026746513300027833MarineMKLVNLTLAVALLISSAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0209092_1046896423300027833MarineMKFACIALIATATAVSRGDGYPENMNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0209092_1050372613300027833MarineMKFVYTALVAAVAASEQSHDGFPLDLNEMYPNKVNLWNNDWSKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0209712_1051343913300027849MarineMKFAIIALVATATAVTRGDGYPENLNEMFPNKESLYANNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0209712_1052180113300027849MarineMKFAIIAIIATASAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHEXSNTLTFKSLIDIKSNYGVILY
Ga0209712_1055457723300027849MarineMKFSCAAIIATVAAVNRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0209712_1055722813300027849MarineMKFALIAIIATASAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0209712_1058554513300027849MarineMKFAAIALIATASAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0209712_1065144813300027849MarineMKFIIAAIVATVAATTQDHDGFPLDLNEMYPNKVNLWGNDWSKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0209713_1074641523300027883MarineMKFAVAALIASVAAVQRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHEXVTSLTXNIVNSL
Ga0209668_1113143613300027899Freshwater Lake SedimentMKFYALALISAVSASEGPALPDHLGELFSNKESLYSNNWGAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE
Ga0209404_1079712523300027906MarineMKFTAVLALIASATARGDGYPENLSEMFPNKLSLYNDDWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
(restricted) Ga0233413_1035326423300027996SeawaterMKFAYTALIAVVAANPISDNNGPAPLDLNEMYPNKVNLWSNDWAKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEVHE
Ga0247586_108395313300028102SeawaterMKLSIVICALLATTQAAETQAYPDHLGELFTTKENLYNGNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247596_116096713300028106SeawaterAIASMILSAEAMKKGYPDHLGEMFPNKESMYGSNWDKYKKTRQLMVDCDIYESENWLGSGKCKYSWECRGARMCEGQGWCYGDDACEEIHE
Ga0247584_111488213300028110SeawaterKMKSFAVIALVMSVATAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247584_113298713300028110SeawaterLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWYYGDDACEEVHE
Ga0247584_114560913300028110SeawaterGIYINIGIYYTFILIVNNKFLYFAMFAKVTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0228645_111146513300028128SeawaterMLSKITLAVVAMVSTTEAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0256411_116332613300028134SeawaterFRMKLSIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0256412_140200913300028137SeawaterMKSIAIALVAAVAASTAEGYPDNMHEMFPNKESLYGSNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0256412_140578613300028137SeawaterMKFTLAVLALVSNANASEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0257106_132172213300028194MarineMLMKFTLAVVAMIATTEANAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0256417_118339413300028233SeawaterIYINIGIYYTFIFIVNNKFLYFAMFAKVTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVH
Ga0256417_118680713300028233SeawaterEFSCDLIYKIIAFIILSLHSLIINFYISMFAKLLLLVSATSAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0228613_110807713300028279SeawaterMKFAVIALIATASAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHEXAYRP
Ga0256413_126758813300028282SeawaterIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0256413_134182513300028282SeawaterLSIVLCALFATTQATEAAAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0256413_136862513300028282SeawaterFTMKFTLAIVALIGSSIASQVDSEALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0256413_137033513300028282SeawaterFCFAAAAVMASTTEKLPDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247572_116040213300028290SeawaterFAFAIVAVMANTTEKLPDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247566_107422913300028335SeawaterAIMKLVMFLVASAAALNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0247566_108910613300028335SeawaterWEHFSEMVWVSSVAMAAMIFGAEAINKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0247566_109025313300028335SeawaterKILTMKLSIVIAALLATTQAAETQAYPDHLGELFTNKENLYSNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0247566_109685313300028335SeawaterNMKFVGVIAMLVAGTSAINSEAPLPDHLGELWGNKENYYNSNWESYKKTRQLMVDCDIYESENWLGQGKCKYSWECRGARMCEGQGYCYGDDACEEIHE
Ga0306909_12479313300028405Saline LakeMKFVISTMMAAVACTEAGHDGFPLDLNEMYPNKVNLWSNDWSKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0272440_120820713300028595Marine SedimentMKATFAIAFAGALFSAEAITRGDGFPEHLGEMFPNKESMYGNDWERYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0257128_112934013300028672MarineKLSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0307403_1067698313300030671MarineALICSADAVNKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0307398_1077960213300030699MarineNMKLSIAICALLATTTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0307399_1048194813300030702MarineLFCINMKFAVCALIATASAVQRGDGFPEHLGEMFPNKSSLWSSDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0308127_105060813300030715MarineLTIVIIALLGLTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0308138_106543013300030724MarineSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0073988_1000231613300030780MarineKFVLALVALMKNCEARLPDHLGELFNNKESLYANDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0073982_1175042413300030781MarineMKFAFAIAAVMAATTETEKLPDHLGELFPNKESLYANNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0151493_11911013300030870MarineAFAIAAVMATTTEKLPDHLGELFPNKESLYANNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0073944_1133318213300030956MarineFTLAIAALMASTQAAERLPDHLGELFPNKDSLYASNWDKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0073984_1128511313300031004MarineIFSSMKLTIVIAALMATTQAAEAQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0073974_180220713300031005MarineMPWVWHATCAWTPGYCLEAVLWRWQFVFAALVASVAASETNHDGFPLDLNEMFPNKKNLWNDDWNKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0307983_109377113300031269Saline WaterMKFVLATLIASVAATGHDGFPLDLNEMYPNKVNLWSNDWSKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0307388_1055477213300031522MarineMIAKVTFAIASIILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0307388_1076464113300031522MarineINNIYKIMKLVPTIALLVIGAQAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0308143_12836113300031540MarineNMKLTIVIIALLGLTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0308149_104631113300031542MarineALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0308148_104301513300031557MarineLTMKLSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0307489_1082495323300031569Sackhole BrineMKFVFATLIAAVAAGPIDNNNGPAPLDLNEMFPNKQNLWTNDWAKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0307489_1083105223300031569Sackhole BrineMKFVYATLIAAVAAGPIDNNNGPAPLDLNEMFPNKQNLWTNDWAKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0307489_1100335913300031569Sackhole BrineMKIVFAALIASVSATTHDGFPLDLNEMFPNKQNLWANDWSKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0308134_116413713300031579MarineLSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0308132_113322513300031580MarineNLTLAMAALIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGGRMCEGQGWCYGDDACEEVHE
Ga0307996_111596313300031589MarineVALISTTEATVALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0302114_1032373823300031621MarineMKFVLAAIVAVNAQTNGFAENLNEMFPNKVNLWNNDWAHYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEVHE
Ga0302114_1039468413300031621MarinePKPQNPVITKSLLACIIIKMKFAFAIVAVMAATTEKLPDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0302126_1014709113300031622MarineMKLVQLTVAMAAMICGAEAVHKGYPDHLGEMFPNKESMYANDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0302126_1017111313300031622MarineMTLVKITIAMAALICGAEAVKKGYPDHLGEMFPNKESMYANDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0302126_1025849113300031622MarineMKFAAIALIATVSAVTRGDGYPENMNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0302121_1015661423300031626MarineMKFACIAIIATASAVTRGDGYPENMNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHEXSNHXR
Ga0302125_1015833513300031638MarineMKFTLAVLALATTTGAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0307984_110472113300031658MarineMKLSIAICALLATTTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0307396_1047686213300031717MarineFIKMKLAVIAALVMVASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0307391_1087056413300031729MarineKNMKLSIAICAILATTTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0307391_1093283913300031729MarineIKMKFAIFALIAASSVEAIQRGDGFPEHLGEMFPNKESLWSNDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0307397_1053833213300031734MarineLIIKFFIYFTMTLVKITLAMAAMIFGAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0307397_1061563013300031734MarineIKMKLAVIAALVMVASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0307387_1098150913300031737MarineMLAKVTFTIASIILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0307384_1019917213300031738MarineLIGLVVATAAATEQSHGGFPLDLNEMYPNKVNLWANDWSKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDGCEEIHE
Ga0307384_1042443023300031738MarineFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0307384_1063587613300031738MarineLSIVICALLATTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0307383_1063511513300031739MarineYKNMKLSIVICALLATTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0307382_1044325513300031743MarineMKFALALVALMANTAEARLPDHLGELFNNKESLYNNDWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0307382_1059886213300031743MarineFLYFAMFAKVTFAIASMILSAEAMKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0315907_1106839513300031758FreshwaterPKTPKPLNYDNYYRKEVVNIIIILKMKFYALAILSAVSASEGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE
Ga0315320_1073352813300031851SeawaterMKFVIATLALIASTEAVQRGDGFPEHLGEMFPNKESLWANDWGKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARICEGQGWCYGDDACEEVHE
Ga0315330_1084748013300032047SeawaterMKLSIVLCALMATTQAAETQAYPDHLGELFTTKENLYNNNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0315905_1134550513300032092FreshwaterPKTPKPLNNDNYYRKEVVNIIIILKMKFYALAILSAVSASEGPALPDHLGELFSNKESLYGNNWEAYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACKEIHE
Ga0314668_1044420313300032481SeawaterMTVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0314668_1067632513300032481SeawaterRTLPPVSTTLPDTKMSSAFVLISATSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0314689_1065969613300032518SeawaterKNMKLTIVIIALLGLTQATKAYPDHLGELYTNKENLYGNNWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0314689_1070360213300032518SeawaterKLVNLTLAVALLISSAEAVKKGYPDHLGEMFPNKESMYGNDWDKYKHTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDACEEVHE
Ga0314680_1097363613300032521SeawaterKNLTMKLSIVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0314674_1055128713300032615SeawaterMKFTLAAFVLISATSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQG
Ga0314673_1068178713300032650SeawaterKLAVIAALVMTASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0314673_1068979713300032650SeawaterKMKSFAVIALVMTVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0314673_1070516213300032650SeawaterNNNFYYKKMLMKITLAVVAMIATTEANAALPDHLGEFFPNKESMYGNDWDKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARLCEGQGWCYGDDSCEEVHE
Ga0314687_1037531013300032707SeawaterVLIALFATTQATEAEAYPDHLGELFTNKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0314687_1084089813300032707SeawaterKMKLAVIAALVMTASATEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGSRQCEGQGWCYGDDSCEEVHE
Ga0314669_1073387513300032708SeawaterSMKLSLVICALIATTEAAEAQAYPDHLGELFTTKENLYGSNWEKYKKSRQLMVDCDIYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0314672_137688623300032709SeawaterKFAVIALIATASAVTRGDGYPENLNEMFPNKESLYQNNWAGYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE
Ga0314681_1080672713300032711SeawaterVLISATSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0314693_1008588513300032727SeawaterMVSDLFAVIALVMTVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0314699_1053121523300032730SeawaterLAAFVLISATSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0314714_1013253223300032733SeawaterFTMKFTLAAFVLISATSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0314714_1056004513300032733SeawaterSRLLTTCCCLDVEHHGKQGKYGIVERWHQYAKVVMTVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVH
Ga0314706_1038661513300032734SeawaterMCSHGSLYPFVRLHQFAVIALVMTVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0314706_1061537013300032734SeawaterKAACKDGPKKEACHASQSGLTDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0314712_1048740813300032747SeawaterVVPLFILPPPVWRGLLVAAAAFVLISATSAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0314712_1056799713300032747SeawaterERLPDHLGELFPNKESLYANNWAKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0314708_1042666323300032750SeawaterSRNSAARTLLFAMAADFAVIALVMTVASAVEVEGYPDHLGEMFPNKESMYGNNWDKYKKSRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDSCEEVHE
Ga0314694_1052419313300032751SeawaterIVAVMAATTEKLPDHLGELFPNKESLYANNWEKYKKTRQLMVDCDVYESENWLGTGKCKYSWECRGARQCEGQGWCYGDDACEEVHE
Ga0307390_1106963613300033572MarineLIKMKFAIFALIAASSVEAIQRGDGFPEHLGEMFPNKESLWSNDWGKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARVCEGQGWCYGDDACEEVHE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.