Basic Information | |
---|---|
Family ID | F001719 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 647 |
Average Sequence Length | 40 residues |
Representative Sequence | MKHITGTALRIAACVVLLVTGLALLAGKDDIRKFHRMRSM |
Number of Associated Samples | 391 |
Number of Associated Scaffolds | 647 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 81.53 % |
% of genes near scaffold ends (potentially truncated) | 21.02 % |
% of genes from short scaffolds (< 2000 bps) | 82.53 % |
Associated GOLD sequencing projects | 354 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.869 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.910 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.629 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.314 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 647 Family Scaffolds |
---|---|---|
PF00543 | P-II | 58.73 |
PF00582 | Usp | 10.36 |
PF00916 | Sulfate_transp | 1.85 |
PF07690 | MFS_1 | 1.85 |
PF08240 | ADH_N | 1.70 |
PF00300 | His_Phos_1 | 1.70 |
PF01740 | STAS | 0.77 |
PF00162 | PGK | 0.62 |
PF13792 | Obsolete Pfam Family | 0.62 |
PF00406 | ADK | 0.62 |
PF07784 | DUF1622 | 0.46 |
PF01494 | FAD_binding_3 | 0.46 |
PF17179 | Fer4_22 | 0.46 |
PF00175 | NAD_binding_1 | 0.31 |
PF00107 | ADH_zinc_N | 0.31 |
PF02156 | Glyco_hydro_26 | 0.31 |
PF00027 | cNMP_binding | 0.31 |
PF06974 | WS_DGAT_C | 0.31 |
PF13193 | AMP-binding_C | 0.31 |
PF00989 | PAS | 0.15 |
PF00501 | AMP-binding | 0.15 |
PF13561 | adh_short_C2 | 0.15 |
PF00583 | Acetyltransf_1 | 0.15 |
PF13828 | DUF4190 | 0.15 |
PF00365 | PFK | 0.15 |
PF01636 | APH | 0.15 |
PF01243 | Putative_PNPOx | 0.15 |
PF02720 | DUF222 | 0.15 |
PF00011 | HSP20 | 0.15 |
PF02566 | OsmC | 0.15 |
PF00230 | MIP | 0.15 |
PF08327 | AHSA1 | 0.15 |
PF00378 | ECH_1 | 0.15 |
PF12724 | Flavodoxin_5 | 0.15 |
PF00652 | Ricin_B_lectin | 0.15 |
PF13546 | DDE_5 | 0.15 |
PF13607 | Succ_CoA_lig | 0.15 |
PF13560 | HTH_31 | 0.15 |
PF02800 | Gp_dh_C | 0.15 |
PF01750 | HycI | 0.15 |
PF03007 | WES_acyltransf | 0.15 |
PF01872 | RibD_C | 0.15 |
PF12840 | HTH_20 | 0.15 |
PF02738 | MoCoBD_1 | 0.15 |
PF06197 | DUF998 | 0.15 |
PF08386 | Abhydrolase_4 | 0.15 |
PF00441 | Acyl-CoA_dh_1 | 0.15 |
PF07730 | HisKA_3 | 0.15 |
PF03625 | DUF302 | 0.15 |
PF01814 | Hemerythrin | 0.15 |
COG ID | Name | Functional Category | % Frequency in 647 Family Scaffolds |
---|---|---|---|
COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 58.73 |
COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 1.85 |
COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 1.85 |
COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 1.85 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.93 |
COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.62 |
COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.62 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.46 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.46 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.46 |
COG4828 | Uncharacterized membrane protein | Function unknown [S] | 0.46 |
COG4124 | Beta-mannanase | Carbohydrate transport and metabolism [G] | 0.31 |
COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.15 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.15 |
COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.15 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.15 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.15 |
COG0680 | Ni,Fe-hydrogenase maturation factor | Energy production and conversion [C] | 0.15 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.15 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.15 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.15 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.15 |
COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.15 |
COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.15 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.15 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.15 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.15 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.15 |
COG4908 | Uncharacterized conserved protein, contains a NRPS condensation (elongation) domain | General function prediction only [R] | 0.15 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.87 % |
All Organisms | root | All Organisms | 45.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559006|FI_contig11027 | Not Available | 968 | Open in IMG/M |
2189573000|GPBTN7E01DS9EY | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
2189573001|GZR05M101DDW3X | Not Available | 511 | Open in IMG/M |
3300000335|actLayA5DRAFT_107413 | Not Available | 651 | Open in IMG/M |
3300000567|JGI12270J11330_10001992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 15038 | Open in IMG/M |
3300000567|JGI12270J11330_10284071 | Not Available | 520 | Open in IMG/M |
3300001356|JGI12269J14319_10069028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1958 | Open in IMG/M |
3300001356|JGI12269J14319_10074840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1840 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100105264 | All Organisms → cellular organisms → Bacteria | 2645 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100649528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 933 | Open in IMG/M |
3300002568|C688J35102_120973268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3930 | Open in IMG/M |
3300002675|Ga0005473J37261_106746 | Not Available | 524 | Open in IMG/M |
3300002874|Ga0006867J43190_105269 | Not Available | 840 | Open in IMG/M |
3300002875|Ga0006800J43185_106728 | Not Available | 585 | Open in IMG/M |
3300003219|JGI26341J46601_10134481 | Not Available | 699 | Open in IMG/M |
3300003298|Ga0006841J48915_107510 | Not Available | 614 | Open in IMG/M |
3300003368|JGI26340J50214_10008588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 3281 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10024463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2149 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10157743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 918 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10338762 | Not Available | 612 | Open in IMG/M |
3300004081|Ga0063454_101379616 | Not Available | 595 | Open in IMG/M |
3300004082|Ga0062384_100438689 | Not Available | 851 | Open in IMG/M |
3300004091|Ga0062387_100678297 | Not Available | 751 | Open in IMG/M |
3300004091|Ga0062387_100787482 | Not Available | 707 | Open in IMG/M |
3300004135|Ga0058884_1348195 | Not Available | 526 | Open in IMG/M |
3300004152|Ga0062386_100255765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1389 | Open in IMG/M |
3300004295|Ga0068932_1021269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
3300004467|Ga0068978_1000421 | Not Available | 600 | Open in IMG/M |
3300004468|Ga0068977_1002990 | Not Available | 744 | Open in IMG/M |
3300004470|Ga0068967_1035213 | Not Available | 519 | Open in IMG/M |
3300004470|Ga0068967_1051401 | Not Available | 692 | Open in IMG/M |
3300004475|Ga0068969_1019652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
3300004475|Ga0068969_1437197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300004561|Ga0068921_1210981 | Not Available | 523 | Open in IMG/M |
3300004593|Ga0068946_1203245 | Not Available | 549 | Open in IMG/M |
3300004608|Ga0068924_1342567 | Not Available | 528 | Open in IMG/M |
3300004631|Ga0058899_12254575 | Not Available | 565 | Open in IMG/M |
3300004643|Ga0062591_100990960 | Not Available | 798 | Open in IMG/M |
3300004977|Ga0072329_1343733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300005093|Ga0062594_100323592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1191 | Open in IMG/M |
3300005093|Ga0062594_102727448 | Not Available | 548 | Open in IMG/M |
3300005146|Ga0066817_1019332 | Not Available | 615 | Open in IMG/M |
3300005161|Ga0066807_1005811 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300005167|Ga0066672_10712285 | Not Available | 642 | Open in IMG/M |
3300005176|Ga0066679_10111587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1674 | Open in IMG/M |
3300005180|Ga0066685_10962855 | Not Available | 566 | Open in IMG/M |
3300005181|Ga0066678_10905047 | Not Available | 577 | Open in IMG/M |
3300005186|Ga0066676_10541491 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300005329|Ga0070683_101501991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
3300005330|Ga0070690_100450618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 954 | Open in IMG/M |
3300005332|Ga0066388_100048222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4330 | Open in IMG/M |
3300005332|Ga0066388_100797882 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300005332|Ga0066388_101067905 | Not Available | 1362 | Open in IMG/M |
3300005332|Ga0066388_101767864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1097 | Open in IMG/M |
3300005335|Ga0070666_11430413 | Not Available | 517 | Open in IMG/M |
3300005337|Ga0070682_100826931 | Not Available | 755 | Open in IMG/M |
3300005338|Ga0068868_101229597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 693 | Open in IMG/M |
3300005353|Ga0070669_101029200 | Not Available | 707 | Open in IMG/M |
3300005363|Ga0008090_15796202 | Not Available | 544 | Open in IMG/M |
3300005366|Ga0070659_100255205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1454 | Open in IMG/M |
3300005406|Ga0070703_10091673 | Not Available | 1055 | Open in IMG/M |
3300005434|Ga0070709_10006771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6255 | Open in IMG/M |
3300005434|Ga0070709_10014083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4515 | Open in IMG/M |
3300005434|Ga0070709_10031938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3172 | Open in IMG/M |
3300005434|Ga0070709_10351656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1089 | Open in IMG/M |
3300005434|Ga0070709_10377099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1054 | Open in IMG/M |
3300005434|Ga0070709_10444624 | Not Available | 975 | Open in IMG/M |
3300005434|Ga0070709_10456428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 963 | Open in IMG/M |
3300005434|Ga0070709_10673795 | Not Available | 803 | Open in IMG/M |
3300005434|Ga0070709_11067125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
3300005434|Ga0070709_11362116 | Not Available | 573 | Open in IMG/M |
3300005435|Ga0070714_100009352 | All Organisms → cellular organisms → Bacteria | 7701 | Open in IMG/M |
3300005435|Ga0070714_100177848 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
3300005435|Ga0070714_100241456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1667 | Open in IMG/M |
3300005435|Ga0070714_100553335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1102 | Open in IMG/M |
3300005435|Ga0070714_100907855 | Not Available | 855 | Open in IMG/M |
3300005435|Ga0070714_100988848 | Not Available | 818 | Open in IMG/M |
3300005435|Ga0070714_101992035 | Not Available | 566 | Open in IMG/M |
3300005436|Ga0070713_100234727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1668 | Open in IMG/M |
3300005437|Ga0070710_10055051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2246 | Open in IMG/M |
3300005439|Ga0070711_100028901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3652 | Open in IMG/M |
3300005439|Ga0070711_101707958 | Not Available | 551 | Open in IMG/M |
3300005445|Ga0070708_100755437 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300005445|Ga0070708_100996910 | Not Available | 785 | Open in IMG/M |
3300005445|Ga0070708_101197758 | Not Available | 710 | Open in IMG/M |
3300005446|Ga0066686_10783549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 636 | Open in IMG/M |
3300005457|Ga0070662_101393752 | Not Available | 604 | Open in IMG/M |
3300005467|Ga0070706_100639568 | Not Available | 988 | Open in IMG/M |
3300005468|Ga0070707_100210196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1897 | Open in IMG/M |
3300005471|Ga0070698_100007557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 11756 | Open in IMG/M |
3300005471|Ga0070698_100502088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces turgidiscabies | 1151 | Open in IMG/M |
3300005534|Ga0070735_10000119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 100823 | Open in IMG/M |
3300005536|Ga0070697_100814287 | Not Available | 827 | Open in IMG/M |
3300005537|Ga0070730_10392620 | Not Available | 899 | Open in IMG/M |
3300005537|Ga0070730_10523073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
3300005540|Ga0066697_10437620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
3300005541|Ga0070733_10860086 | Not Available | 609 | Open in IMG/M |
3300005542|Ga0070732_10105046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1666 | Open in IMG/M |
3300005553|Ga0066695_10693704 | Not Available | 598 | Open in IMG/M |
3300005556|Ga0066707_11000897 | Not Available | 510 | Open in IMG/M |
3300005569|Ga0066705_10691391 | Not Available | 616 | Open in IMG/M |
3300005576|Ga0066708_10308142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1014 | Open in IMG/M |
3300005578|Ga0068854_101532062 | Not Available | 606 | Open in IMG/M |
3300005591|Ga0070761_10970531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → Candidatus Dormibacter → unclassified Candidatus Dormibacter → Candidatus Dormibacter sp. RRmetagenome_bin12 | 539 | Open in IMG/M |
3300005602|Ga0070762_10446624 | Not Available | 840 | Open in IMG/M |
3300005610|Ga0070763_10564672 | Not Available | 657 | Open in IMG/M |
3300005614|Ga0068856_101148391 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300005616|Ga0068852_100777107 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300005712|Ga0070764_11046500 | Not Available | 516 | Open in IMG/M |
3300005764|Ga0066903_104149434 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300005764|Ga0066903_108000127 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005841|Ga0068863_102040795 | Not Available | 583 | Open in IMG/M |
3300005952|Ga0080026_10013594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1926 | Open in IMG/M |
3300006028|Ga0070717_10208746 | Not Available | 1713 | Open in IMG/M |
3300006028|Ga0070717_10957757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 779 | Open in IMG/M |
3300006028|Ga0070717_11629510 | Not Available | 584 | Open in IMG/M |
3300006028|Ga0070717_11723689 | Not Available | 567 | Open in IMG/M |
3300006047|Ga0075024_100568140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
3300006052|Ga0075029_100972856 | Not Available | 585 | Open in IMG/M |
3300006059|Ga0075017_100833974 | Not Available | 714 | Open in IMG/M |
3300006059|Ga0075017_101170142 | Not Available | 602 | Open in IMG/M |
3300006162|Ga0075030_100145108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1922 | Open in IMG/M |
3300006162|Ga0075030_101141265 | Not Available | 613 | Open in IMG/M |
3300006172|Ga0075018_10403428 | Not Available | 696 | Open in IMG/M |
3300006173|Ga0070716_101772955 | Not Available | 511 | Open in IMG/M |
3300006174|Ga0075014_100633317 | Not Available | 615 | Open in IMG/M |
3300006175|Ga0070712_100593815 | Not Available | 937 | Open in IMG/M |
3300006175|Ga0070712_101514053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
3300006176|Ga0070765_100350469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1372 | Open in IMG/M |
3300006575|Ga0074053_10016939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1446 | Open in IMG/M |
3300006755|Ga0079222_10097091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1536 | Open in IMG/M |
3300006755|Ga0079222_10105301 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
3300006755|Ga0079222_10381976 | Not Available | 970 | Open in IMG/M |
3300006804|Ga0079221_10238472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1024 | Open in IMG/M |
3300006804|Ga0079221_10325009 | Not Available | 915 | Open in IMG/M |
3300006804|Ga0079221_10640949 | Not Available | 726 | Open in IMG/M |
3300006804|Ga0079221_11325716 | Not Available | 568 | Open in IMG/M |
3300006860|Ga0063829_1039931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 678 | Open in IMG/M |
3300006871|Ga0075434_100538261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1188 | Open in IMG/M |
3300006871|Ga0075434_102126707 | Not Available | 566 | Open in IMG/M |
3300006903|Ga0075426_11549801 | Not Available | 504 | Open in IMG/M |
3300006904|Ga0075424_100496048 | Not Available | 1304 | Open in IMG/M |
3300006904|Ga0075424_102659207 | Not Available | 523 | Open in IMG/M |
3300006954|Ga0079219_11141721 | Not Available | 666 | Open in IMG/M |
3300009012|Ga0066710_103211742 | Not Available | 627 | Open in IMG/M |
3300009029|Ga0066793_10118144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1543 | Open in IMG/M |
3300009038|Ga0099829_10137959 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
3300009038|Ga0099829_11764197 | Not Available | 507 | Open in IMG/M |
3300009090|Ga0099827_10038506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3517 | Open in IMG/M |
3300009090|Ga0099827_10245537 | Not Available | 1503 | Open in IMG/M |
3300009093|Ga0105240_12381077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 548 | Open in IMG/M |
3300009098|Ga0105245_10749403 | Not Available | 1012 | Open in IMG/M |
3300009520|Ga0116214_1001036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10943 | Open in IMG/M |
3300009522|Ga0116218_1304661 | Not Available | 713 | Open in IMG/M |
3300009522|Ga0116218_1435101 | Not Available | 585 | Open in IMG/M |
3300009523|Ga0116221_1500247 | Not Available | 532 | Open in IMG/M |
3300009552|Ga0116138_1105527 | Not Available | 781 | Open in IMG/M |
3300009623|Ga0116133_1195236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
3300009628|Ga0116125_1028936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1382 | Open in IMG/M |
3300009698|Ga0116216_10313823 | Not Available | 955 | Open in IMG/M |
3300009792|Ga0126374_10172608 | Not Available | 1337 | Open in IMG/M |
3300009792|Ga0126374_11812101 | Not Available | 511 | Open in IMG/M |
3300010043|Ga0126380_10024845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2942 | Open in IMG/M |
3300010047|Ga0126382_11445548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 629 | Open in IMG/M |
3300010048|Ga0126373_10748146 | Not Available | 1038 | Open in IMG/M |
3300010048|Ga0126373_12046438 | Not Available | 635 | Open in IMG/M |
3300010048|Ga0126373_12447753 | Not Available | 581 | Open in IMG/M |
3300010159|Ga0099796_10353948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 634 | Open in IMG/M |
3300010304|Ga0134088_10438211 | Not Available | 640 | Open in IMG/M |
3300010325|Ga0134064_10328019 | Not Available | 591 | Open in IMG/M |
3300010336|Ga0134071_10622901 | Not Available | 566 | Open in IMG/M |
3300010343|Ga0074044_10581941 | Not Available | 731 | Open in IMG/M |
3300010361|Ga0126378_10533381 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300010361|Ga0126378_10587433 | Not Available | 1228 | Open in IMG/M |
3300010366|Ga0126379_10410197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1405 | Open in IMG/M |
3300010366|Ga0126379_12402840 | Not Available | 626 | Open in IMG/M |
3300010373|Ga0134128_11463555 | Not Available | 752 | Open in IMG/M |
3300010376|Ga0126381_101094987 | Not Available | 1151 | Open in IMG/M |
3300010379|Ga0136449_100080197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6892 | Open in IMG/M |
3300010379|Ga0136449_100425914 | Not Available | 2341 | Open in IMG/M |
3300010379|Ga0136449_102639005 | Not Available | 715 | Open in IMG/M |
3300010379|Ga0136449_102692443 | Not Available | 706 | Open in IMG/M |
3300010379|Ga0136449_104291000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
3300010386|Ga0136806_1221245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3699 | Open in IMG/M |
3300010396|Ga0134126_10339841 | Not Available | 1753 | Open in IMG/M |
3300010396|Ga0134126_10650264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1202 | Open in IMG/M |
3300010396|Ga0134126_11548480 | Not Available | 730 | Open in IMG/M |
3300010396|Ga0134126_12993185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300010396|Ga0134126_13005006 | Not Available | 509 | Open in IMG/M |
3300010398|Ga0126383_10483274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1294 | Open in IMG/M |
3300010398|Ga0126383_12622767 | Not Available | 587 | Open in IMG/M |
3300010403|Ga0134123_11555071 | Not Available | 708 | Open in IMG/M |
3300010856|Ga0126358_1017612 | Not Available | 508 | Open in IMG/M |
3300010856|Ga0126358_1206351 | Not Available | 581 | Open in IMG/M |
3300010858|Ga0126345_1217410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1440 | Open in IMG/M |
3300010861|Ga0126349_1087563 | Not Available | 1844 | Open in IMG/M |
3300010861|Ga0126349_1123596 | Not Available | 801 | Open in IMG/M |
3300010865|Ga0126346_1121859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1729 | Open in IMG/M |
3300010867|Ga0126347_1359196 | Not Available | 637 | Open in IMG/M |
3300010867|Ga0126347_1466660 | Not Available | 514 | Open in IMG/M |
3300010876|Ga0126361_10074572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
3300010876|Ga0126361_10127584 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300010876|Ga0126361_10579303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2922 | Open in IMG/M |
3300011016|Ga0138589_113593 | Not Available | 579 | Open in IMG/M |
3300011024|Ga0138530_117792 | Not Available | 622 | Open in IMG/M |
3300011039|Ga0138593_123397 | Not Available | 749 | Open in IMG/M |
3300011043|Ga0138528_100079 | Not Available | 834 | Open in IMG/M |
3300011044|Ga0138545_110717 | Not Available | 829 | Open in IMG/M |
3300011044|Ga0138545_140863 | Not Available | 614 | Open in IMG/M |
3300011044|Ga0138545_157013 | Not Available | 679 | Open in IMG/M |
3300011052|Ga0138585_155114 | Not Available | 569 | Open in IMG/M |
3300011058|Ga0138541_1064623 | Not Available | 542 | Open in IMG/M |
3300011058|Ga0138541_1080301 | Not Available | 506 | Open in IMG/M |
3300011065|Ga0138533_1061986 | Not Available | 1240 | Open in IMG/M |
3300011067|Ga0138594_1070349 | Not Available | 682 | Open in IMG/M |
3300011067|Ga0138594_1111654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
3300011068|Ga0138599_1021049 | Not Available | 894 | Open in IMG/M |
3300011074|Ga0138559_1069633 | Not Available | 603 | Open in IMG/M |
3300011075|Ga0138555_1105518 | Not Available | 637 | Open in IMG/M |
3300011079|Ga0138569_1086857 | Not Available | 901 | Open in IMG/M |
3300011079|Ga0138569_1170897 | Not Available | 739 | Open in IMG/M |
3300011083|Ga0138560_1024543 | Not Available | 522 | Open in IMG/M |
3300011084|Ga0138562_1078939 | Not Available | 521 | Open in IMG/M |
3300011088|Ga0138576_1112090 | Not Available | 716 | Open in IMG/M |
3300011107|Ga0151490_1569444 | Not Available | 901 | Open in IMG/M |
3300011120|Ga0150983_12877480 | Not Available | 891 | Open in IMG/M |
3300011120|Ga0150983_16055870 | Not Available | 531 | Open in IMG/M |
3300011305|Ga0138532_1064388 | Not Available | 516 | Open in IMG/M |
3300012199|Ga0137383_11298553 | Not Available | 519 | Open in IMG/M |
3300012201|Ga0137365_10002467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14661 | Open in IMG/M |
3300012205|Ga0137362_11354927 | Not Available | 597 | Open in IMG/M |
3300012206|Ga0137380_10618838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
3300012209|Ga0137379_10876126 | Not Available | 802 | Open in IMG/M |
3300012210|Ga0137378_10152626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2141 | Open in IMG/M |
3300012211|Ga0137377_11511262 | Not Available | 597 | Open in IMG/M |
3300012212|Ga0150985_117982766 | Not Available | 806 | Open in IMG/M |
3300012350|Ga0137372_10078704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2813 | Open in IMG/M |
3300012356|Ga0137371_10065581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2811 | Open in IMG/M |
3300012360|Ga0137375_10213422 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300012481|Ga0157320_1028446 | Not Available | 551 | Open in IMG/M |
3300012898|Ga0157293_10053153 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300012917|Ga0137395_10555825 | Not Available | 828 | Open in IMG/M |
3300012957|Ga0164303_11099260 | Not Available | 574 | Open in IMG/M |
3300012960|Ga0164301_10527908 | Not Available | 857 | Open in IMG/M |
3300012960|Ga0164301_11565318 | Not Available | 545 | Open in IMG/M |
3300012984|Ga0164309_11178086 | Not Available | 642 | Open in IMG/M |
3300012985|Ga0164308_10289086 | Not Available | 1296 | Open in IMG/M |
3300012986|Ga0164304_11771486 | Not Available | 517 | Open in IMG/M |
3300012989|Ga0164305_11847766 | Not Available | 547 | Open in IMG/M |
3300013296|Ga0157374_12498352 | Not Available | 544 | Open in IMG/M |
3300013306|Ga0163162_12114160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 646 | Open in IMG/M |
3300013308|Ga0157375_10149198 | All Organisms → cellular organisms → Bacteria | 2472 | Open in IMG/M |
3300013308|Ga0157375_13485634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300014157|Ga0134078_10494990 | Not Available | 567 | Open in IMG/M |
3300014169|Ga0181531_10158624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1369 | Open in IMG/M |
3300014492|Ga0182013_10000781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 44473 | Open in IMG/M |
3300014495|Ga0182015_10669632 | Not Available | 655 | Open in IMG/M |
3300015265|Ga0182005_1230559 | Not Available | 566 | Open in IMG/M |
3300015371|Ga0132258_10186606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5018 | Open in IMG/M |
3300015372|Ga0132256_101229926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
3300015372|Ga0132256_103930123 | Not Available | 500 | Open in IMG/M |
3300015374|Ga0132255_101623589 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300016371|Ga0182034_11940434 | Not Available | 520 | Open in IMG/M |
3300016387|Ga0182040_11826760 | Not Available | 520 | Open in IMG/M |
3300016445|Ga0182038_10084716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2251 | Open in IMG/M |
3300016445|Ga0182038_10116777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora purpeofusca | 1973 | Open in IMG/M |
3300016702|Ga0181511_1313570 | Not Available | 909 | Open in IMG/M |
3300017821|Ga0187812_1005566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4339 | Open in IMG/M |
3300017821|Ga0187812_1014092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2768 | Open in IMG/M |
3300017821|Ga0187812_1033815 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
3300017821|Ga0187812_1042797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1536 | Open in IMG/M |
3300017821|Ga0187812_1084235 | Not Available | 1046 | Open in IMG/M |
3300017822|Ga0187802_10225857 | Not Available | 722 | Open in IMG/M |
3300017924|Ga0187820_1009168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2359 | Open in IMG/M |
3300017924|Ga0187820_1015212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1889 | Open in IMG/M |
3300017924|Ga0187820_1087841 | Not Available | 881 | Open in IMG/M |
3300017924|Ga0187820_1324327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300017926|Ga0187807_1015276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2365 | Open in IMG/M |
3300017926|Ga0187807_1021860 | Not Available | 1972 | Open in IMG/M |
3300017926|Ga0187807_1025371 | Not Available | 1832 | Open in IMG/M |
3300017926|Ga0187807_1066551 | Not Available | 1120 | Open in IMG/M |
3300017928|Ga0187806_1009390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2721 | Open in IMG/M |
3300017928|Ga0187806_1198365 | Not Available | 679 | Open in IMG/M |
3300017932|Ga0187814_10018317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2654 | Open in IMG/M |
3300017937|Ga0187809_10377039 | Not Available | 537 | Open in IMG/M |
3300017942|Ga0187808_10557523 | Not Available | 533 | Open in IMG/M |
3300017943|Ga0187819_10701193 | Not Available | 571 | Open in IMG/M |
3300017946|Ga0187879_10111526 | Not Available | 1563 | Open in IMG/M |
3300017946|Ga0187879_10123670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1474 | Open in IMG/M |
3300017946|Ga0187879_10161918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1262 | Open in IMG/M |
3300017946|Ga0187879_10197447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1129 | Open in IMG/M |
3300017959|Ga0187779_10375863 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300017959|Ga0187779_10628067 | Not Available | 721 | Open in IMG/M |
3300017959|Ga0187779_10670942 | Not Available | 699 | Open in IMG/M |
3300017959|Ga0187779_11032385 | Not Available | 572 | Open in IMG/M |
3300017959|Ga0187779_11056869 | Not Available | 566 | Open in IMG/M |
3300017970|Ga0187783_10066364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2658 | Open in IMG/M |
3300017970|Ga0187783_10213122 | Not Available | 1417 | Open in IMG/M |
3300017970|Ga0187783_10477386 | Not Available | 904 | Open in IMG/M |
3300017970|Ga0187783_10864046 | Not Available | 652 | Open in IMG/M |
3300017972|Ga0187781_10111370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1905 | Open in IMG/M |
3300017972|Ga0187781_10127552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1777 | Open in IMG/M |
3300017972|Ga0187781_10244660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1269 | Open in IMG/M |
3300017972|Ga0187781_10509259 | Not Available | 864 | Open in IMG/M |
3300017972|Ga0187781_10509754 | Not Available | 864 | Open in IMG/M |
3300017973|Ga0187780_10293341 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300017973|Ga0187780_10305927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
3300017973|Ga0187780_10674224 | Not Available | 745 | Open in IMG/M |
3300017974|Ga0187777_10211721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1308 | Open in IMG/M |
3300017974|Ga0187777_10234214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1243 | Open in IMG/M |
3300017974|Ga0187777_10385954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 967 | Open in IMG/M |
3300017975|Ga0187782_10260556 | Not Available | 1304 | Open in IMG/M |
3300017975|Ga0187782_10284994 | Not Available | 1245 | Open in IMG/M |
3300017975|Ga0187782_10737808 | Not Available | 760 | Open in IMG/M |
3300017975|Ga0187782_10743729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 757 | Open in IMG/M |
3300017975|Ga0187782_11570878 | Not Available | 519 | Open in IMG/M |
3300017993|Ga0187823_10306416 | Not Available | 554 | Open in IMG/M |
3300018034|Ga0187863_10110788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1536 | Open in IMG/M |
3300018035|Ga0187875_10374187 | Not Available | 763 | Open in IMG/M |
3300018038|Ga0187855_10128515 | Not Available | 1519 | Open in IMG/M |
3300018038|Ga0187855_10770271 | Not Available | 561 | Open in IMG/M |
3300018038|Ga0187855_10924849 | Not Available | 509 | Open in IMG/M |
3300018042|Ga0187871_10010928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 6188 | Open in IMG/M |
3300018042|Ga0187871_10050795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2495 | Open in IMG/M |
3300018044|Ga0187890_10267434 | Not Available | 962 | Open in IMG/M |
3300018044|Ga0187890_10478343 | Not Available | 700 | Open in IMG/M |
3300018058|Ga0187766_10396374 | Not Available | 912 | Open in IMG/M |
3300018058|Ga0187766_10883082 | Not Available | 629 | Open in IMG/M |
3300018060|Ga0187765_10359667 | Not Available | 889 | Open in IMG/M |
3300018060|Ga0187765_10739311 | Not Available | 650 | Open in IMG/M |
3300018060|Ga0187765_11146075 | Not Available | 542 | Open in IMG/M |
3300018064|Ga0187773_10788579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
3300018085|Ga0187772_10190809 | Not Available | 1372 | Open in IMG/M |
3300018085|Ga0187772_10269352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1161 | Open in IMG/M |
3300018085|Ga0187772_10556229 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300018085|Ga0187772_10959009 | Not Available | 623 | Open in IMG/M |
3300018086|Ga0187769_10034465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3459 | Open in IMG/M |
3300018086|Ga0187769_10605015 | Not Available | 828 | Open in IMG/M |
3300018086|Ga0187769_10790641 | Not Available | 717 | Open in IMG/M |
3300018433|Ga0066667_10409089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1099 | Open in IMG/M |
3300018468|Ga0066662_10850829 | Not Available | 891 | Open in IMG/M |
3300018468|Ga0066662_11493774 | Not Available | 703 | Open in IMG/M |
3300019251|Ga0187795_1207045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
3300019264|Ga0187796_1254726 | Not Available | 953 | Open in IMG/M |
3300019278|Ga0187800_1120139 | Not Available | 565 | Open in IMG/M |
3300019278|Ga0187800_1704805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
3300019284|Ga0187797_1023816 | Not Available | 602 | Open in IMG/M |
3300019284|Ga0187797_1263955 | Not Available | 636 | Open in IMG/M |
3300019284|Ga0187797_1355076 | Not Available | 636 | Open in IMG/M |
3300019284|Ga0187797_1454118 | Not Available | 947 | Open in IMG/M |
3300019284|Ga0187797_1623892 | Not Available | 589 | Open in IMG/M |
3300019361|Ga0173482_10225433 | Not Available | 783 | Open in IMG/M |
3300019885|Ga0193747_1080627 | Not Available | 800 | Open in IMG/M |
3300020002|Ga0193730_1034428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1468 | Open in IMG/M |
3300020082|Ga0206353_11071079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 891 | Open in IMG/M |
3300020199|Ga0179592_10147628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
3300020579|Ga0210407_11297002 | Not Available | 544 | Open in IMG/M |
3300020581|Ga0210399_10292722 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300020581|Ga0210399_10371814 | Not Available | 1193 | Open in IMG/M |
3300020581|Ga0210399_10475361 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300020582|Ga0210395_10005136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10026 | Open in IMG/M |
3300020582|Ga0210395_10068356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2610 | Open in IMG/M |
3300020582|Ga0210395_11023820 | Not Available | 611 | Open in IMG/M |
3300021171|Ga0210405_10736007 | Not Available | 760 | Open in IMG/M |
3300021178|Ga0210408_10042249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3575 | Open in IMG/M |
3300021178|Ga0210408_10608133 | Not Available | 865 | Open in IMG/M |
3300021178|Ga0210408_10937610 | Not Available | 672 | Open in IMG/M |
3300021361|Ga0213872_10149115 | Not Available | 1023 | Open in IMG/M |
3300021374|Ga0213881_10012339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3506 | Open in IMG/M |
3300021374|Ga0213881_10061958 | Not Available | 1592 | Open in IMG/M |
3300021377|Ga0213874_10058970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1198 | Open in IMG/M |
3300021401|Ga0210393_10551497 | Not Available | 942 | Open in IMG/M |
3300021402|Ga0210385_10146921 | Not Available | 1684 | Open in IMG/M |
3300021403|Ga0210397_10008756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6124 | Open in IMG/M |
3300021403|Ga0210397_10773930 | Not Available | 740 | Open in IMG/M |
3300021405|Ga0210387_10051109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3329 | Open in IMG/M |
3300021405|Ga0210387_10364352 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
3300021420|Ga0210394_10872843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 784 | Open in IMG/M |
3300021420|Ga0210394_11051257 | Not Available | 704 | Open in IMG/M |
3300021432|Ga0210384_10069215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3180 | Open in IMG/M |
3300021433|Ga0210391_10581287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 879 | Open in IMG/M |
3300021474|Ga0210390_11146775 | Not Available | 630 | Open in IMG/M |
3300021475|Ga0210392_10307832 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300021478|Ga0210402_10844743 | Not Available | 841 | Open in IMG/M |
3300021479|Ga0210410_11266564 | Not Available | 629 | Open in IMG/M |
3300021559|Ga0210409_10508653 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300021560|Ga0126371_10172666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2240 | Open in IMG/M |
3300021560|Ga0126371_10725820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
3300021560|Ga0126371_10935254 | Not Available | 1010 | Open in IMG/M |
3300021560|Ga0126371_11315096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 856 | Open in IMG/M |
3300021560|Ga0126371_11473987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
3300021560|Ga0126371_13557278 | Not Available | 526 | Open in IMG/M |
3300021560|Ga0126371_13837002 | Not Available | 507 | Open in IMG/M |
3300021858|Ga0213852_1464029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
3300021860|Ga0213851_1204157 | Not Available | 601 | Open in IMG/M |
3300021860|Ga0213851_1357022 | Not Available | 612 | Open in IMG/M |
3300021860|Ga0213851_1637859 | Not Available | 1237 | Open in IMG/M |
3300021860|Ga0213851_1683207 | Not Available | 592 | Open in IMG/M |
3300021861|Ga0213853_10443176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 970 | Open in IMG/M |
3300022513|Ga0242667_1019880 | Not Available | 696 | Open in IMG/M |
3300022528|Ga0242669_1106870 | Not Available | 549 | Open in IMG/M |
3300022529|Ga0242668_1027515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
3300022529|Ga0242668_1031123 | Not Available | 869 | Open in IMG/M |
3300022529|Ga0242668_1052357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 731 | Open in IMG/M |
3300022529|Ga0242668_1054333 | Not Available | 722 | Open in IMG/M |
3300022708|Ga0242670_1009270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1001 | Open in IMG/M |
3300022713|Ga0242677_1084834 | Not Available | 516 | Open in IMG/M |
3300022718|Ga0242675_1010666 | Not Available | 1127 | Open in IMG/M |
3300022720|Ga0242672_1014478 | Not Available | 1012 | Open in IMG/M |
3300022720|Ga0242672_1068595 | Not Available | 636 | Open in IMG/M |
3300022840|Ga0224549_1000150 | All Organisms → cellular organisms → Bacteria | 7995 | Open in IMG/M |
3300023101|Ga0224557_1000482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 44959 | Open in IMG/M |
3300024310|Ga0247681_1031559 | Not Available | 785 | Open in IMG/M |
3300025321|Ga0207656_10505706 | Not Available | 613 | Open in IMG/M |
3300025509|Ga0208848_1024546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1305 | Open in IMG/M |
3300025625|Ga0208219_1015705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2319 | Open in IMG/M |
3300025634|Ga0208589_1038643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1259 | Open in IMG/M |
3300025898|Ga0207692_10014877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3410 | Open in IMG/M |
3300025898|Ga0207692_10420859 | Not Available | 836 | Open in IMG/M |
3300025906|Ga0207699_10004384 | All Organisms → cellular organisms → Bacteria | 6751 | Open in IMG/M |
3300025910|Ga0207684_10405248 | Not Available | 1172 | Open in IMG/M |
3300025915|Ga0207693_10376059 | Not Available | 1111 | Open in IMG/M |
3300025916|Ga0207663_11234314 | Not Available | 602 | Open in IMG/M |
3300025922|Ga0207646_10151472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2092 | Open in IMG/M |
3300025922|Ga0207646_10915950 | Not Available | 777 | Open in IMG/M |
3300025926|Ga0207659_11245163 | Not Available | 639 | Open in IMG/M |
3300025928|Ga0207700_10636341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 951 | Open in IMG/M |
3300025929|Ga0207664_10473927 | Not Available | 1119 | Open in IMG/M |
3300025929|Ga0207664_10829797 | Not Available | 831 | Open in IMG/M |
3300025929|Ga0207664_11041135 | Not Available | 733 | Open in IMG/M |
3300025932|Ga0207690_11321930 | Not Available | 602 | Open in IMG/M |
3300025934|Ga0207686_11592441 | Not Available | 539 | Open in IMG/M |
3300025935|Ga0207709_10534537 | Not Available | 920 | Open in IMG/M |
3300025939|Ga0207665_10255874 | Not Available | 1295 | Open in IMG/M |
3300025952|Ga0210077_1121905 | Not Available | 546 | Open in IMG/M |
3300025981|Ga0207640_10686244 | Not Available | 876 | Open in IMG/M |
3300026035|Ga0207703_11389096 | Not Available | 675 | Open in IMG/M |
3300026035|Ga0207703_11960925 | Not Available | 562 | Open in IMG/M |
3300026217|Ga0209871_1029616 | Not Available | 1024 | Open in IMG/M |
3300026475|Ga0257147_1022474 | Not Available | 887 | Open in IMG/M |
3300026551|Ga0209648_10270886 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300027497|Ga0208199_1001741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7120 | Open in IMG/M |
3300027648|Ga0209420_1146347 | Not Available | 649 | Open in IMG/M |
3300027651|Ga0209217_1123095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
3300027680|Ga0207826_1011839 | All Organisms → cellular organisms → Bacteria | 2371 | Open in IMG/M |
3300027680|Ga0207826_1121711 | Not Available | 715 | Open in IMG/M |
3300027703|Ga0207862_1160976 | Not Available | 671 | Open in IMG/M |
3300027725|Ga0209178_1154734 | Not Available | 793 | Open in IMG/M |
3300027725|Ga0209178_1194797 | Not Available | 715 | Open in IMG/M |
3300027765|Ga0209073_10070234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1189 | Open in IMG/M |
3300027783|Ga0209448_10264100 | Not Available | 567 | Open in IMG/M |
3300027812|Ga0209656_10002288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12410 | Open in IMG/M |
3300027817|Ga0209112_10211126 | Not Available | 670 | Open in IMG/M |
3300027824|Ga0209040_10006595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8449 | Open in IMG/M |
3300027824|Ga0209040_10069342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2068 | Open in IMG/M |
3300027829|Ga0209773_10371420 | Not Available | 595 | Open in IMG/M |
3300027846|Ga0209180_10176738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
3300027857|Ga0209166_10343785 | Not Available | 780 | Open in IMG/M |
3300027857|Ga0209166_10610508 | Not Available | 554 | Open in IMG/M |
3300027882|Ga0209590_10010274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4350 | Open in IMG/M |
3300027882|Ga0209590_10448991 | Not Available | 833 | Open in IMG/M |
3300027905|Ga0209415_10604733 | Not Available | 811 | Open in IMG/M |
3300027905|Ga0209415_10680135 | Not Available | 742 | Open in IMG/M |
3300027908|Ga0209006_11387695 | Not Available | 538 | Open in IMG/M |
3300027915|Ga0209069_10467965 | Not Available | 704 | Open in IMG/M |
3300027915|Ga0209069_10744470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
3300027986|Ga0209168_10003476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10834 | Open in IMG/M |
3300028445|Ga0189899_105388 | Not Available | 625 | Open in IMG/M |
3300028715|Ga0307313_10130321 | Not Available | 772 | Open in IMG/M |
3300028768|Ga0307280_10320542 | Not Available | 568 | Open in IMG/M |
3300028808|Ga0302228_10014001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4295 | Open in IMG/M |
3300028906|Ga0308309_10246555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1493 | Open in IMG/M |
3300028906|Ga0308309_10475691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1078 | Open in IMG/M |
3300028906|Ga0308309_11332747 | Not Available | 617 | Open in IMG/M |
3300029999|Ga0311339_10138342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2891 | Open in IMG/M |
3300029999|Ga0311339_10362878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1526 | Open in IMG/M |
3300030007|Ga0311338_10058064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5092 | Open in IMG/M |
3300030043|Ga0302306_10139574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 936 | Open in IMG/M |
3300030053|Ga0302177_10289154 | Not Available | 877 | Open in IMG/M |
3300030057|Ga0302176_10206809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 783 | Open in IMG/M |
3300030494|Ga0310037_10082874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1499 | Open in IMG/M |
3300030707|Ga0310038_10116333 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
3300030743|Ga0265461_12655463 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300030763|Ga0265763_1012124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
3300030880|Ga0265776_105142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
3300030882|Ga0265764_117126 | Not Available | 508 | Open in IMG/M |
3300030885|Ga0265743_101686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
3300030885|Ga0265743_106949 | Not Available | 728 | Open in IMG/M |
3300030885|Ga0265743_115860 | Not Available | 562 | Open in IMG/M |
3300030980|Ga0074027_10921366 | Not Available | 536 | Open in IMG/M |
3300030990|Ga0308178_1085876 | Not Available | 647 | Open in IMG/M |
3300031017|Ga0265744_104189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
3300031017|Ga0265744_108271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
3300031231|Ga0170824_117906882 | Not Available | 674 | Open in IMG/M |
3300031469|Ga0170819_11869231 | Not Available | 624 | Open in IMG/M |
3300031543|Ga0318516_10007962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 4984 | Open in IMG/M |
3300031543|Ga0318516_10054148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2190 | Open in IMG/M |
3300031543|Ga0318516_10109396 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
3300031543|Ga0318516_10343039 | Not Available | 862 | Open in IMG/M |
3300031543|Ga0318516_10440382 | Not Available | 749 | Open in IMG/M |
3300031544|Ga0318534_10112263 | Not Available | 1564 | Open in IMG/M |
3300031544|Ga0318534_10178249 | Not Available | 1228 | Open in IMG/M |
3300031544|Ga0318534_10543446 | Not Available | 662 | Open in IMG/M |
3300031545|Ga0318541_10314946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
3300031561|Ga0318528_10072181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1778 | Open in IMG/M |
3300031561|Ga0318528_10205983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
3300031564|Ga0318573_10091522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1549 | Open in IMG/M |
3300031564|Ga0318573_10720031 | Not Available | 536 | Open in IMG/M |
3300031572|Ga0318515_10022109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3016 | Open in IMG/M |
3300031640|Ga0318555_10650766 | Not Available | 570 | Open in IMG/M |
3300031680|Ga0318574_10234047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1060 | Open in IMG/M |
3300031681|Ga0318572_10140589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1390 | Open in IMG/M |
3300031682|Ga0318560_10230851 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300031682|Ga0318560_10541084 | Not Available | 631 | Open in IMG/M |
3300031708|Ga0310686_100279705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3934 | Open in IMG/M |
3300031708|Ga0310686_103550638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 9699 | Open in IMG/M |
3300031708|Ga0310686_105635869 | Not Available | 1612 | Open in IMG/M |
3300031708|Ga0310686_106733875 | Not Available | 773 | Open in IMG/M |
3300031708|Ga0310686_116340627 | Not Available | 3003 | Open in IMG/M |
3300031713|Ga0318496_10563541 | Not Available | 630 | Open in IMG/M |
3300031716|Ga0310813_10216595 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300031744|Ga0306918_10818805 | Not Available | 727 | Open in IMG/M |
3300031748|Ga0318492_10161218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1135 | Open in IMG/M |
3300031748|Ga0318492_10533324 | Not Available | 624 | Open in IMG/M |
3300031748|Ga0318492_10733367 | Not Available | 530 | Open in IMG/M |
3300031751|Ga0318494_10125141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1434 | Open in IMG/M |
3300031754|Ga0307475_10676171 | Not Available | 824 | Open in IMG/M |
3300031768|Ga0318509_10623527 | Not Available | 600 | Open in IMG/M |
3300031792|Ga0318529_10340468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
3300031799|Ga0318565_10021145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2859 | Open in IMG/M |
3300031805|Ga0318497_10705410 | Not Available | 566 | Open in IMG/M |
3300031819|Ga0318568_10986005 | Not Available | 520 | Open in IMG/M |
3300031845|Ga0318511_10140079 | Not Available | 1052 | Open in IMG/M |
3300031859|Ga0318527_10105704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1159 | Open in IMG/M |
3300031879|Ga0306919_10609900 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300031880|Ga0318544_10343354 | Not Available | 580 | Open in IMG/M |
3300031880|Ga0318544_10408934 | Not Available | 528 | Open in IMG/M |
3300031890|Ga0306925_10218876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2054 | Open in IMG/M |
3300031890|Ga0306925_10735454 | Not Available | 1029 | Open in IMG/M |
3300031897|Ga0318520_10432295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
3300031897|Ga0318520_10799659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
3300031910|Ga0306923_12492220 | Not Available | 510 | Open in IMG/M |
3300031954|Ga0306926_12539949 | Not Available | 561 | Open in IMG/M |
3300031959|Ga0318530_10405752 | Not Available | 565 | Open in IMG/M |
3300031996|Ga0308176_11507517 | Not Available | 716 | Open in IMG/M |
3300032009|Ga0318563_10127373 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
3300032009|Ga0318563_10249321 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300032025|Ga0318507_10374567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300032039|Ga0318559_10183201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 960 | Open in IMG/M |
3300032055|Ga0318575_10523689 | Not Available | 602 | Open in IMG/M |
3300032055|Ga0318575_10661445 | Not Available | 529 | Open in IMG/M |
3300032060|Ga0318505_10321056 | Not Available | 731 | Open in IMG/M |
3300032063|Ga0318504_10090532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1357 | Open in IMG/M |
3300032066|Ga0318514_10373437 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300032067|Ga0318524_10001900 | All Organisms → cellular organisms → Bacteria | 7742 | Open in IMG/M |
3300032067|Ga0318524_10024903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2717 | Open in IMG/M |
3300032067|Ga0318524_10359818 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300032068|Ga0318553_10035505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2409 | Open in IMG/M |
3300032160|Ga0311301_10031620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13614 | Open in IMG/M |
3300032160|Ga0311301_10055746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8839 | Open in IMG/M |
3300032160|Ga0311301_10066764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7703 | Open in IMG/M |
3300032160|Ga0311301_10074781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7068 | Open in IMG/M |
3300032160|Ga0311301_10086312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6350 | Open in IMG/M |
3300032160|Ga0311301_10642380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1513 | Open in IMG/M |
3300032205|Ga0307472_100603596 | Not Available | 969 | Open in IMG/M |
3300032205|Ga0307472_101500478 | Not Available | 658 | Open in IMG/M |
3300032261|Ga0306920_100522011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1761 | Open in IMG/M |
3300032261|Ga0306920_100570359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1676 | Open in IMG/M |
3300032261|Ga0306920_100725940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1463 | Open in IMG/M |
3300032261|Ga0306920_101335700 | Not Available | 1030 | Open in IMG/M |
3300032261|Ga0306920_101548134 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300032261|Ga0306920_101733836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 884 | Open in IMG/M |
3300032515|Ga0348332_13797747 | Not Available | 849 | Open in IMG/M |
3300032770|Ga0335085_10020094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9553 | Open in IMG/M |
3300032770|Ga0335085_10022209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9024 | Open in IMG/M |
3300032770|Ga0335085_10025371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8341 | Open in IMG/M |
3300032770|Ga0335085_10026382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 8155 | Open in IMG/M |
3300032770|Ga0335085_10034263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7031 | Open in IMG/M |
3300032770|Ga0335085_10117611 | All Organisms → cellular organisms → Bacteria | 3400 | Open in IMG/M |
3300032770|Ga0335085_10200897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2441 | Open in IMG/M |
3300032770|Ga0335085_10367006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1682 | Open in IMG/M |
3300032770|Ga0335085_10586504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1257 | Open in IMG/M |
3300032770|Ga0335085_10586734 | Not Available | 1257 | Open in IMG/M |
3300032770|Ga0335085_10729743 | Not Available | 1098 | Open in IMG/M |
3300032770|Ga0335085_10778491 | Not Available | 1055 | Open in IMG/M |
3300032770|Ga0335085_11119168 | Not Available | 842 | Open in IMG/M |
3300032770|Ga0335085_11362766 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300032770|Ga0335085_11944686 | Not Available | 598 | Open in IMG/M |
3300032770|Ga0335085_11981714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 591 | Open in IMG/M |
3300032770|Ga0335085_12010066 | Not Available | 586 | Open in IMG/M |
3300032770|Ga0335085_12066568 | Not Available | 576 | Open in IMG/M |
3300032783|Ga0335079_10046924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4952 | Open in IMG/M |
3300032783|Ga0335079_10112050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3084 | Open in IMG/M |
3300032783|Ga0335079_10757517 | Not Available | 1009 | Open in IMG/M |
3300032783|Ga0335079_11534688 | Not Available | 657 | Open in IMG/M |
3300032805|Ga0335078_10263384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2343 | Open in IMG/M |
3300032805|Ga0335078_10364391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1913 | Open in IMG/M |
3300032805|Ga0335078_10610908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1373 | Open in IMG/M |
3300032805|Ga0335078_10649565 | Not Available | 1319 | Open in IMG/M |
3300032805|Ga0335078_10797649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 1152 | Open in IMG/M |
3300032828|Ga0335080_10801449 | Not Available | 973 | Open in IMG/M |
3300032828|Ga0335080_10874387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
3300032828|Ga0335080_11787625 | Not Available | 600 | Open in IMG/M |
3300032829|Ga0335070_10130255 | All Organisms → cellular organisms → Bacteria | 2588 | Open in IMG/M |
3300032892|Ga0335081_10005992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 19275 | Open in IMG/M |
3300032892|Ga0335081_10393685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1785 | Open in IMG/M |
3300032892|Ga0335081_10551504 | Not Available | 1435 | Open in IMG/M |
3300032892|Ga0335081_11072108 | Not Available | 931 | Open in IMG/M |
3300032892|Ga0335081_11622883 | Not Available | 709 | Open in IMG/M |
3300032893|Ga0335069_10013656 | All Organisms → cellular organisms → Bacteria | 11397 | Open in IMG/M |
3300032893|Ga0335069_10066888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4639 | Open in IMG/M |
3300032893|Ga0335069_12433169 | Not Available | 543 | Open in IMG/M |
3300032895|Ga0335074_10024312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8545 | Open in IMG/M |
3300032895|Ga0335074_10032868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7256 | Open in IMG/M |
3300032895|Ga0335074_10060083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5188 | Open in IMG/M |
3300032895|Ga0335074_10073317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 4611 | Open in IMG/M |
3300032895|Ga0335074_10123002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3355 | Open in IMG/M |
3300032895|Ga0335074_10789523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
3300032895|Ga0335074_11333789 | Not Available | 589 | Open in IMG/M |
3300032896|Ga0335075_10378839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1519 | Open in IMG/M |
3300032896|Ga0335075_11406002 | Not Available | 588 | Open in IMG/M |
3300032897|Ga0335071_10084342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3115 | Open in IMG/M |
3300032898|Ga0335072_10766973 | Not Available | 929 | Open in IMG/M |
3300032898|Ga0335072_10922723 | Not Available | 814 | Open in IMG/M |
3300032898|Ga0335072_11554843 | Not Available | 561 | Open in IMG/M |
3300032954|Ga0335083_10100194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2857 | Open in IMG/M |
3300032954|Ga0335083_10154418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2162 | Open in IMG/M |
3300032955|Ga0335076_10051954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4063 | Open in IMG/M |
3300033134|Ga0335073_10047241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5778 | Open in IMG/M |
3300033134|Ga0335073_10332079 | Not Available | 1809 | Open in IMG/M |
3300033134|Ga0335073_11008222 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300033134|Ga0335073_11226869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 750 | Open in IMG/M |
3300033134|Ga0335073_11616467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
3300033158|Ga0335077_10006187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14764 | Open in IMG/M |
3300033158|Ga0335077_10793303 | Not Available | 965 | Open in IMG/M |
3300033818|Ga0334804_009680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3889 | Open in IMG/M |
3300034124|Ga0370483_0080915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1055 | Open in IMG/M |
3300034163|Ga0370515_0125616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1103 | Open in IMG/M |
3300034817|Ga0373948_0126423 | Not Available | 622 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.91% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.05% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.49% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.09% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.16% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.47% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.70% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.70% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.70% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.55% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.24% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.39% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.39% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.39% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.08% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.08% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.77% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.46% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.46% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.46% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.46% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.31% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.31% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.31% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.31% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.31% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.31% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.31% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.31% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.31% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.15% |
Sediment | Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment | 0.15% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.15% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.15% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.15% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.15% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.15% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.15% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.15% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.15% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.15% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.15% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.15% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.15% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.15% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.15% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.15% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.15% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.15% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.15% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.15% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.15% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000335 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002675 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF122 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300002874 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 68 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300002875 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003298 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004135 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004295 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004467 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 75 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004470 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004561 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004593 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004608 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004977 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005146 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB | Environmental | Open in IMG/M |
3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010386 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 kmer 63 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011016 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 81 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011024 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 8 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011039 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 20 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011043 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011044 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 26 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011052 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 75 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011058 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011065 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011067 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011068 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011083 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011305 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019251 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025952 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028445 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030980 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FI_00098970 | 2166559006 | Grass Soil | MKHITGTALRIAACVVLLVTGLALLAGKDDIRKFHRMRSM |
N55_07521430 | 2189573000 | Grass Soil | MKHITGTAPKIAACVVLLVTGLALLAGKDDIRKFHRMRSM |
FD2_05739270 | 2189573001 | Grass Soil | ITGTVLRSAACVVLLATGLALLAGKDDIRKFHRMRSM |
actLayA5DRAFT_1074132 | 3300000335 | Soil | MKHIKGVALTVFALGIGVALLAGKDDIRKFHRMRSM* |
JGI12270J11330_1000199218 | 3300000567 | Peatlands Soil | HIVGTALRVAGCIVLAITGVALLAGKDDIRKFRRMRSM* |
JGI12270J11330_102840712 | 3300000567 | Peatlands Soil | MKHIVGTTLRVGACVVVGITGVALLAGKDDIRKFRRMRNM* |
JGI12269J14319_100690281 | 3300001356 | Peatlands Soil | MKHIAGTALAAGCLALVGAALLAGKDDIRKFHRMRSM* |
JGI12269J14319_100748404 | 3300001356 | Peatlands Soil | MRHIAGTALAVGCVALVGAALLAGMDDIRRFHRMRSM* |
JGIcombinedJ26739_1001052643 | 3300002245 | Forest Soil | MKYITGTELRFVACLVLLGAGLTLLAGKDDIRKFRRMRSM* |
JGIcombinedJ26739_1006495282 | 3300002245 | Forest Soil | MKHITGTALRITAYVVLLVTGLXLLAGKDDIRKFHRMHSM* |
C688J35102_1209732684 | 3300002568 | Soil | MKHITGTALRSAACVVLLVTGLALLAGNDDIRKFHRMRSM* |
Ga0005473J37261_1067461 | 3300002675 | Forest Soil | MKHITGTALKIAAGVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0006867J43190_1052691 | 3300002874 | Peatlands Soil | MKHIAGTALRVAGCTVVAITGVALLAGKDDIRKFRRMRSM* |
Ga0006800J43185_1067281 | 3300002875 | Peatlands Soil | EMKHIIGTVLRVAGCLVLLFVGLALLAGKDDIRKFRRMRRM* |
JGI26341J46601_101344811 | 3300003219 | Bog Forest Soil | MKHIVGTTLRVGACAVLAITGLALLAGKDDIRKFRQMRSM* |
Ga0006841J48915_1075101 | 3300003298 | Peatlands Soil | SEMKHIVGTALRVAGCIVLAITGVALLAGKDDIRKFRRMRSM* |
JGI26340J50214_100085883 | 3300003368 | Bog Forest Soil | MKHIMGTALRVGGCLVLAITGVALLVGRDDIRKFRRMRSM* |
JGIcombinedJ51221_100244633 | 3300003505 | Forest Soil | MKHIMGTALRVAGCVVLLGAGVALVAGKDDIRKFHRMRSM* |
JGIcombinedJ51221_101577433 | 3300003505 | Forest Soil | VRTMKHITGAILRVASCVVLLVTAAALLAGKDDIRKFHRMRSM* |
JGIcombinedJ51221_103387621 | 3300003505 | Forest Soil | MKHITGTALRVAGCLVLAITAVALLAGQDDIRKFRRMRSM* |
Ga0063454_1013796162 | 3300004081 | Soil | MKHITGTALRSAACVVLLATGLALLAGKDDIRKFYRMRSM* |
Ga0062384_1004386893 | 3300004082 | Bog Forest Soil | VKHIMGTALRVAGCVVLLGAGVALVAGKDDIRKFNRMRSM* |
Ga0062387_1006782972 | 3300004091 | Bog Forest Soil | MKHITGATLRVASCVVLLVTAAALLAGKGDVRKFHRMRSM* |
Ga0062387_1007874821 | 3300004091 | Bog Forest Soil | MKHIMGTALRVAGCVVLLGAGVALVAGKDDIRKFNRMRSM* |
Ga0058884_13481952 | 3300004135 | Forest Soil | MKHITGTALRITAYVVLLVTGLVLLAGKDDIRKFHRMHSM* |
Ga0062386_1002557652 | 3300004152 | Bog Forest Soil | MKHIVGTALRVGGCLVVGITCVALLAGKDDIRKFRRMRNM* |
Ga0068932_10212691 | 3300004295 | Peatlands Soil | SKMKHIVGTTLRVGACLVVGITGVALLAGKDDIRKFRRMRNM* |
Ga0068978_10004212 | 3300004467 | Peatlands Soil | MKHIVGTTLRVAACLVAGIAGVALLAGKDDIRKFRRMRNM* |
Ga0068977_10029903 | 3300004468 | Peatlands Soil | GSKMKHIVGTTLRVAACLVAGIAGVALLAGKDDIRKFRRMRNM* |
Ga0068967_10038893 | 3300004470 | Peatlands Soil | RRKAGTMRHIAGTALAVGCVALVGAALLAGMDDIRRFHRMRSM* |
Ga0068967_10352131 | 3300004470 | Peatlands Soil | MKHIVGTALRVAGCIVLAITAAALLAGKNDIRKFRRMRSM* |
Ga0068967_10514011 | 3300004470 | Peatlands Soil | ARRRRRAQKMKHIVGTTLRVGACAVLAITGLALLAGKDDIRKFRQMRSM* |
Ga0068969_10196523 | 3300004475 | Peatlands Soil | SKMKHIVGTTLRVAACLVAGIAGVALLAGKDDIRKFRRMRNM* |
Ga0068969_14371971 | 3300004475 | Peatlands Soil | AQIMKHVAGTVLRGGACLVLLATGVALLAGKDDIRKFHRMRSM* |
Ga0068921_12109811 | 3300004561 | Peatlands Soil | RRRRRAQKMKHIVGTALRVAGCIVLAITGVALLAGKDDIRKFRRMRSM* |
Ga0068946_12032451 | 3300004593 | Peatlands Soil | QQKGSKMKHIAGTALRVGGCLVLAITAVALLAGKDDIRKFRRMRSM* |
Ga0068924_13425672 | 3300004608 | Peatlands Soil | MKHIMGTTLRVGACAVLAITGLALLAGKDDIRKFRQMRSM* |
Ga0058899_122545752 | 3300004631 | Forest Soil | MKHTTGTALRITAYVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0062591_1009909601 | 3300004643 | Soil | MKHITGTALRSAVCVVLLATGLALLAGKDDIRKLHRMHSM* |
Ga0072329_13437332 | 3300004977 | Peatlands Soil | MKHITGTALRVASCVALLVTAAALLAGKDDIRKFHRMRSM* |
Ga0062594_1003235923 | 3300005093 | Soil | MKHITGTALRSAACVVLLATGLALLAGKDDIRKFHRMRSM* |
Ga0062594_1027274482 | 3300005093 | Soil | MKHITTGTALRSAACVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0066817_10193321 | 3300005146 | Soil | MKHITGTALRIAACAVLLVTGLALLAGKDDIRKFRRMHSM* |
Ga0066807_10058112 | 3300005161 | Soil | MKHITGTALRIAACAVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0066672_107122852 | 3300005167 | Soil | MKHITGTAPRFAACAVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0066679_101115874 | 3300005176 | Soil | MKHITGTALRSAACVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0066685_109628551 | 3300005180 | Soil | REARTMKHITGTALRSAACVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0066678_109050471 | 3300005181 | Soil | ARTMKHITGTALRSAACVVLLVTGLALLAGKDDIRKFHRVRSM* |
Ga0066676_105414913 | 3300005186 | Soil | MKHITGTALRIAACVVLLVTGVALLAGKDDIRKFHRMRSM* |
Ga0070683_1015019912 | 3300005329 | Corn Rhizosphere | MKHISGTTLRIAACAVLAGTGLALLAGKDDIRRFHRMRSM* |
Ga0070690_1004506181 | 3300005330 | Switchgrass Rhizosphere | MKHITGTALRSAACVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0066388_1000482224 | 3300005332 | Tropical Forest Soil | MKHVIGTALRVAAVAIVVVAGLALLAGKDDIRKFHRMRSM* |
Ga0066388_1007978823 | 3300005332 | Tropical Forest Soil | MKHITGTALRVAGCAVLLVAAVALLAGKDDIRKFHRMRSM* |
Ga0066388_1010679052 | 3300005332 | Tropical Forest Soil | MKHITGTALRVAACVVLLVTAAALLAGQDDIRKFHRMRSM* |
Ga0066388_1017678643 | 3300005332 | Tropical Forest Soil | MKHITGKALGIVTCVGLLATGLALLAGKDDIRKFHRMRSM* |
Ga0070666_114304132 | 3300005335 | Switchgrass Rhizosphere | MKHITGTALRTAACVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0070682_1008269312 | 3300005337 | Corn Rhizosphere | MKHITGTALRTAACVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0068868_1012295971 | 3300005338 | Miscanthus Rhizosphere | MKHITGTALRFAACVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0070669_1010292001 | 3300005353 | Switchgrass Rhizosphere | MKHITGTALRIAACVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0008090_157962021 | 3300005363 | Tropical Rainforest Soil | MKHITGTTLKVAACVVLLVTAAALLAGQDDIRKFHRMRSM* |
Ga0070659_1002552053 | 3300005366 | Corn Rhizosphere | MKHITTGTALRSAACVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0070703_100916732 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALRSAACVVLLATGLALLAGKDDIRRFHRMRSM* |
Ga0070709_100067716 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALRIAACAVLLVTGVALLAGKDDIRKFHRMHSM* |
Ga0070709_100140832 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGKTLRIAACIGLAGTGLALLAGKDDIRRFHRMRSM* |
Ga0070709_100319383 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHIMGTALRVTGCVVLLGAGVALVAGKDDIRKFNRMRSM* |
Ga0070709_103516562 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MMHITGTALRVVALSVLVVTGLALAGKDDIRKFYRMRSM* |
Ga0070709_103770992 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGMAPRIAACVVLAVTGLALLAGQDDIRRFHRMRSM* |
Ga0070709_104446243 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTTLRITACITLAGAGLALLAGKDDIRRFHRMRSM* |
Ga0070709_104564281 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALRITAYVVLLVTGLALLAGKDDIRKFHRMHTM* |
Ga0070709_106737952 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALRIAACVVLLGTGLALLAGKDDIRKFHRMRSM* |
Ga0070709_110671251 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGRALRVATFAILTATGLALLAGSNDIRRFRRMRRM* |
Ga0070709_113621161 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTTLRIAACVVLAGTGLALLAGKDDIRRFRRMRSM* |
Ga0070714_1000093528 | 3300005435 | Agricultural Soil | MKHITGAALRTAACVVLLATGLALLAGKDDIRKFHRMRSM* |
Ga0070714_1001778484 | 3300005435 | Agricultural Soil | MKHITGTAPRIAACVVLLGTGLALLAGKDDIRKFHRMRSM* |
Ga0070714_1002414563 | 3300005435 | Agricultural Soil | MKHITGTTPRIAACIVLAGAGLALLAGKDDIRRFYRMRSM* |
Ga0070714_1005533351 | 3300005435 | Agricultural Soil | MKHITGTALRTAACAVLLVTGVALLAGKDDIRKFHRMRSM* |
Ga0070714_1009078551 | 3300005435 | Agricultural Soil | MKHITGTTLRIAACVVLAGTGLALLAGKDDIRRFHRMRSM* |
Ga0070714_1009888482 | 3300005435 | Agricultural Soil | MKHITGTALRIAACVVLLATGLALLAGKDDIRKFHRMHSM* |
Ga0070714_1019920351 | 3300005435 | Agricultural Soil | MKHITGTALRITAYVVLLVTGLALLASKDDIRKFHRMHSM* |
Ga0070713_1002347273 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHTTGTTLRIAACVVLAGTGLALLAGKDDIRRFHRMRSM* |
Ga0070710_100550511 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GPMKHITGTALRIAACAVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0070710_104966103 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHIMGTALRAAGCVVLLCTGVALVAGKDDIRKFNRMRSM* |
Ga0070711_1000289016 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGKTLRIATCIGLAGTGLALLAGKDDIRRFHRMRSM* |
Ga0070711_1017079581 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHISGTTLRIAACAVLVGTGLALLAGKDDIRRFHRMRSM* |
Ga0070708_1007554372 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALRIAACAVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0070708_1009969102 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGAALRTAACVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0070708_1011977582 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHIAGTALRVTTCLVLAVAGLALLAGKDDIRKFRRMRGM* |
Ga0066686_107835492 | 3300005446 | Soil | PMKHITGTALRIAACAVLLVAGLTLLAGKDDIRKFHRMRSM* |
Ga0070662_1013937521 | 3300005457 | Corn Rhizosphere | KHITGTALRFAACVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0070706_1006395682 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHIAGTALRVTTCLVLAVTGLALLAGKDDIRKFRRMRSM* |
Ga0070707_1002101962 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALKIAACAVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0070698_1000075573 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHIVGTALRVATFVVLLGAGVAVLAGKDDIRKFRRMRCM* |
Ga0070698_1005020881 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITKTALKTAACVVVLAAGLALLAGKDDIRKFHRMRSM* |
Ga0070735_1000011919 | 3300005534 | Surface Soil | MKHITGTTLAVACLAAVGAALLAGKDDIRKFHRMRSM* |
Ga0070697_1008142872 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALRAAACAVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0070730_103926203 | 3300005537 | Surface Soil | MKHITGTALAVACLAAIGAALLAGKDDIRKFHRIRSM* |
Ga0070730_105230731 | 3300005537 | Surface Soil | ITGTALRIAAFAVLTVTGLTLLAGINDIRRFRRMRRM* |
Ga0066697_104376202 | 3300005540 | Soil | MKHITGAALRSAACVVLLATGLALLAGKDDIRKFHRMRSM* |
Ga0070733_108600862 | 3300005541 | Surface Soil | MRHITGTALAVGCVALVGAALLAGLDDIRRFHRMRSM* |
Ga0070732_101050462 | 3300005542 | Surface Soil | MRHIAGTALAVGCLALVGAALLAGMDDIRRFHRMRSM* |
Ga0066695_106937042 | 3300005553 | Soil | MKHITGAALRTAACVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0066707_110008972 | 3300005556 | Soil | TERLGPMKHITGTALRIAACAVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0066705_106913911 | 3300005569 | Soil | ARTMKHITGTALRSAACVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0066708_103081421 | 3300005576 | Soil | GGTERLGPMKHITGTVLRTAACAVLLVTGLALIAGKDDIRKFHRMHSM* |
Ga0068854_1015320622 | 3300005578 | Corn Rhizosphere | MKHITGTALRSAACVVLLATGLALLAGKDDIRKFHRM |
Ga0070761_100069417 | 3300005591 | Soil | MKHIAGTALAATCLALVAAALFAGKDDIRKFRRMRSM* |
Ga0070761_109705312 | 3300005591 | Soil | MKHIVATALGVVALGVGVALLAGKDDIRKFHRMRSM* |
Ga0070762_104466241 | 3300005602 | Soil | MKHTTGTALRITAYVVLLVTGLVLLAGKDDIRKFHRMHSM* |
Ga0070763_105646721 | 3300005610 | Soil | MKHITGTALRTVACLVLLSTGVALLAGRDDIRKFRRMHKM* |
Ga0068856_1011483911 | 3300005614 | Corn Rhizosphere | TTLRIAACVVLAGTGLALLAGKDDIRRFHRMRSM* |
Ga0068852_1007771074 | 3300005616 | Corn Rhizosphere | MKHITTGTALRSAACVVLLVTGLALLAGKDDIRKFHRM |
Ga0070764_110465001 | 3300005712 | Soil | MKHIMGTALRVAGCMVLLGAGVALVAGKDDIRKFNRMRSM* |
Ga0066903_1041494342 | 3300005764 | Tropical Forest Soil | MKHVIGTALRVAAVAVVVVAGLALLAGKDDIRKFHRMRSM* |
Ga0066903_1080001272 | 3300005764 | Tropical Forest Soil | MKHIAGTALAVGCLALAGAALFAGKDDIRKFHRMRSM* |
Ga0068863_1020407951 | 3300005841 | Switchgrass Rhizosphere | MKHITGTSLRSAACVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0080026_100135942 | 3300005952 | Permafrost Soil | MKHIKGTVLTVLALGICVALLAGKDDIRKFHHMRSM* |
Ga0070717_102087461 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TGTTLRITACITLAGAGLALLAGKDDIRRFHRMRSM* |
Ga0070717_109577572 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHSTGTTLRIAACAVLAGTGLALLAGKDDIRRFHRMRSM* |
Ga0070717_116295103 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTTLRIAACVVLAGTGLALLAGKDDIRRFHRMR |
Ga0070717_117236892 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGMAPRIAACGVLAVTGLALLAGQDDIRRFHRMRSM* |
Ga0075024_1005681402 | 3300006047 | Watersheds | MKHITGVTLRVASCVVLLVTAAALLAGKDDIRKFHRMRSM* |
Ga0075029_1009728562 | 3300006052 | Watersheds | MKHIAGTMLAAGCLALVGVALFAGKDDIRKFHRMRSM* |
Ga0075017_1008339742 | 3300006059 | Watersheds | MKHITGTALAVACFAAIGAALLAGKDDIRKFHRMRSM* |
Ga0075017_1011701422 | 3300006059 | Watersheds | MKHITGVTLRVGSCVVLLVTAAALLAGKDDIRKFHRMRSM* |
Ga0075030_1001451082 | 3300006162 | Watersheds | MKHITGTTLRVASCVILLVTAAALLAGKDDIRKFHRMRSM* |
Ga0075030_1011412652 | 3300006162 | Watersheds | GIHGKVRTMKHITGTALRVASCVVLLAAAAALLAGKDDIRKFHRMHGM* |
Ga0075018_104034282 | 3300006172 | Watersheds | MKHITGTALKIAAGVVLLATGLALLAGKDDIRKFHRMHSM* |
Ga0070716_1017729552 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGAALRTAACVVLLVTGLALLAGKDDIRKFHRM |
Ga0075014_1006333172 | 3300006174 | Watersheds | MKHIAGTALRVGGCLVLAITGVALLAGKDDIRKFRRMRSM* |
Ga0070712_1005938153 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTTLRITACVVLAGTGLALLAGKDDIRRFRRMRSM* |
Ga0070712_1015140532 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGMTPRIAACVVLALTGLALLAGQDDIRRFHRMRSM* |
Ga0070765_1003504694 | 3300006176 | Soil | MKHITGAILRVASCVVLLVTAAALLAGKDDIRKFHRMRSM* |
Ga0074053_100169392 | 3300006575 | Soil | MKHITGTALRIAACAVLLVTGLALLAGKDDIRKFHHMHSM* |
Ga0079222_100970912 | 3300006755 | Agricultural Soil | MKHITGAALRTAACTALLVVGVALLAGKDDIRKFHRMRSM* |
Ga0079222_101053013 | 3300006755 | Agricultural Soil | MKHISGTTLRIAACAVLAGTGLALLAGKDDIRRFRRMRSM* |
Ga0079222_103819763 | 3300006755 | Agricultural Soil | MKHITGTTLRIAACVVLAVTGLALLAGKDDIRRFHRMRSM* |
Ga0079221_102384723 | 3300006804 | Agricultural Soil | MKHITGAALRTATCAVLLVTGIALLAGKDDIRKFHRMRNM* |
Ga0079221_103250093 | 3300006804 | Agricultural Soil | MKHITGAALRTAACTALLVAGVALLAGKDDIRKFHRMRSM* |
Ga0079221_106409491 | 3300006804 | Agricultural Soil | MKHITGTTPRIAACIVLAGVGLALLAGKDDIRRFHRMRSM* |
Ga0079221_113257162 | 3300006804 | Agricultural Soil | MKHITGTTLKVIACVVLLVTAAALLAGQDDIRKFRRMRSM* |
Ga0063829_10399313 | 3300006860 | Peatlands Soil | MKHIVGTALRVAGCIVLAITGVALLAGKDDIRKFRRMRSM* |
Ga0075434_1005382611 | 3300006871 | Populus Rhizosphere | MKHITGTKPQIAACIVLAATGLALLAGKDDIRRFHRMRSM* |
Ga0075434_1021267073 | 3300006871 | Populus Rhizosphere | MKHTTGTTLRIAACVVLAGTGLALLAGQDDIRRFHRMRSM |
Ga0075426_115498011 | 3300006903 | Populus Rhizosphere | MKHITGTTLKVAACGVLLVTAAALLAGKDDIRKFHRMRSM* |
Ga0075424_1004960483 | 3300006904 | Populus Rhizosphere | MKHITGAALRTAACVVLLATGLALLAGKDDIRKFHRMHSM* |
Ga0075424_1026592072 | 3300006904 | Populus Rhizosphere | MKHTTGTTLRIAACVVLAGTGLALLAGQDDIRRFHRMRSM* |
Ga0079219_111417212 | 3300006954 | Agricultural Soil | MKHITGTKPQIAACVVLAGVGLALLAGKDDIRRFHRMRSM* |
Ga0066710_1032117422 | 3300009012 | Grasslands Soil | MKHITGAALRSAACVVLLATGLALLAGKDDIRKFHRMRSM |
Ga0066793_101181442 | 3300009029 | Prmafrost Soil | MKHIKGTALTVLALGICVALLAGKDDIRKFHHMRSM* |
Ga0099829_101379593 | 3300009038 | Vadose Zone Soil | MKHIIGTALRGTTLVALLGAGAALLAGKDDIRKFRRMRSM* |
Ga0099829_117641972 | 3300009038 | Vadose Zone Soil | MKHITGTALRVAACVVLLVTGVALLAGKDDIRKFRQMRNM* |
Ga0099827_100385062 | 3300009090 | Vadose Zone Soil | MKHITGTALKIVACLVLLGICVALLAGKDDIRKFRRMRST* |
Ga0099827_102455372 | 3300009090 | Vadose Zone Soil | MKHITGTALRAAACVVLLVTGVALLAGKDDIRKLRQMRNM* |
Ga0105240_123810772 | 3300009093 | Corn Rhizosphere | MKHITGTALRIAACVVLLVTGLALLAGKDDIRKFH |
Ga0105245_107494033 | 3300009098 | Miscanthus Rhizosphere | MKHITGTALRIAACVVLLVTGLALLAGKDDIRKFHHMRSM* |
Ga0116214_10010362 | 3300009520 | Peatlands Soil | MKHIAGTALAAGLALVGAALLAGQDDIRKFHRMRSM* |
Ga0116218_13046612 | 3300009522 | Peatlands Soil | VQQKGSKMKHIVGTTLRVAACLVAGIAGVALLAGKDDIRKFRRMRNM* |
Ga0116218_14351011 | 3300009522 | Peatlands Soil | MKHIVGTTLRVGGCLVVAIAGLALLAGKDDIRKFRQMRRM* |
Ga0116221_15002472 | 3300009523 | Peatlands Soil | MKHIAGTALAAGCLALVGAALLAGKDDIRKFHRMR |
Ga0116138_11055271 | 3300009552 | Peatland | MKKHIVGTALGVVALGVGVALLAGKDDIRKFHRMRSM* |
Ga0116133_11952362 | 3300009623 | Peatland | MKHITGKAPRIAACVVLAVTGLALLAGQDDIRKFNRMRRM* |
Ga0116125_10289363 | 3300009628 | Peatland | MKHVKGSALTIIGLGICAALLAGKDDIRKFHRMRSM* |
Ga0116135_14251522 | 3300009665 | Peatland | MKHIVGTALRVAATVVLLAACVLLIAGKDDIRKFRQMRGM* |
Ga0116216_103138231 | 3300009698 | Peatlands Soil | MKHIAGTALRAVAIVVLAGAGVAVLAGKDDIRKFRRMRSM* |
Ga0126374_101726083 | 3300009792 | Tropical Forest Soil | MKHITGKALGIVTFVGLLATGLALLAGKDDIRKFHRMRSM* |
Ga0126374_118121012 | 3300009792 | Tropical Forest Soil | ARTMKHITGTALRVAACVVLLVTAAALLAGQDDIRKFHRMRSM* |
Ga0126380_100248451 | 3300010043 | Tropical Forest Soil | MKHITGTTLRVAACVVLLVAAAALLVGQDDIRKFHRMRSM* |
Ga0126382_114455482 | 3300010047 | Tropical Forest Soil | MKHITGKALGIVTCVGLLATGLALLAGKDDIRRFRRMRRV* |
Ga0126373_107481463 | 3300010048 | Tropical Forest Soil | MKHFTGTVPRVAVCVALLVTAAALLAGQDDIRRFHRMRSM* |
Ga0126373_120464381 | 3300010048 | Tropical Forest Soil | MKHIAGTVIAAGCLALVGAALFAGKDDIRKFHRMRSM* |
Ga0126373_124477532 | 3300010048 | Tropical Forest Soil | MKHITGTALAVACRAALGAALLSGKDDIRKVHRMRSM* |
Ga0099796_103539481 | 3300010159 | Vadose Zone Soil | MKHITGTALRIAACAVLLVTGLALLAGKDDIRKFHCMRSM* |
Ga0134088_104382111 | 3300010304 | Grasslands Soil | ITGAALRTAACVVLLVTGLALLAGKDDIRKFHRVRSM* |
Ga0134064_103280192 | 3300010325 | Grasslands Soil | MKHITGTALRIAACAVVLVTGVALLAGKDDIRKFRRMRSM* |
Ga0134071_106229012 | 3300010336 | Grasslands Soil | MKHITGAALRTAACVVLLVTGLALLAGKDDIRKFRRMRSM* |
Ga0074044_105819412 | 3300010343 | Bog Forest Soil | MKHILGTTLRVGGCLVVGITGVALLAGKDDIRKFRRMRNM* |
Ga0126378_105333813 | 3300010361 | Tropical Forest Soil | MKHITGTALAVACLAAIGAALLAGKDDIRKFHRMRSM* |
Ga0126378_105874331 | 3300010361 | Tropical Forest Soil | RTMKHITGTALRVAACVVLLVTAAALLAGQDDIRKFHRMRSM* |
Ga0126379_104101971 | 3300010366 | Tropical Forest Soil | MKHITGTALRVAACVVLLVAAAALLAGQDDIRKFHRMRSM* |
Ga0126379_124028402 | 3300010366 | Tropical Forest Soil | MKHITGTALAVACLAAIGAALLAGKDDIRKFHHMRSM* |
Ga0134128_114635552 | 3300010373 | Terrestrial Soil | DPMKHITGTALRITAYVVLLVTGLALLAGKDDIRKFHRMHTM* |
Ga0126381_1010949873 | 3300010376 | Tropical Forest Soil | MKHIIGTTLRVAAVAVVVVAGLALLAGKDDIRKFRRMRSM* |
Ga0136449_1000801973 | 3300010379 | Peatlands Soil | MKHIVGMALRAVVFVGLAGAGVAVLAGQDDIRKFRRMRSM* |
Ga0136449_1004259143 | 3300010379 | Peatlands Soil | MKHIAGTALRVGGCLVVLITGVALLAGKDDIRKFRRMRKM* |
Ga0136449_1026390052 | 3300010379 | Peatlands Soil | MKHVTGKTLKVGACLVLLITGVALLAGKDDIRKFRRMHSM* |
Ga0136449_1026924432 | 3300010379 | Peatlands Soil | MKHITGTALAVACFAAIGGALLAGKDDIRKFHRMRSM* |
Ga0136449_1042910002 | 3300010379 | Peatlands Soil | MKHITGTALRIAALAVLAVTGLALLAGHDDIRRFRRMRSM* |
Ga0136806_12212454 | 3300010386 | Sediment | MKHISGKTLGAAAACTALLAVGVAVLAGKDDIRKFRRMHSM* |
Ga0134126_103398413 | 3300010396 | Terrestrial Soil | MKHITGTALRITAYVVLLVTGLALLEGKDDIRKFHRMHTM* |
Ga0134126_106502641 | 3300010396 | Terrestrial Soil | MKHIMGTALRVTGCVVLLGAGVALVAGKDDIRKFNRM |
Ga0134126_115484802 | 3300010396 | Terrestrial Soil | MKHITGTALRITAYVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0134126_129931851 | 3300010396 | Terrestrial Soil | MKHISGKTLGIAACTVLAGTGLALLAGKDDIRRFHRMRSM* |
Ga0134126_130050061 | 3300010396 | Terrestrial Soil | MKHITGTRLRITACIVLAGTGLALLAGKDDIRRFHRMRSM* |
Ga0126383_104832744 | 3300010398 | Tropical Forest Soil | MKHITGTALRVAGCAVLLVAAVALLAGQDDIRRFHRMRSM* |
Ga0126383_126227672 | 3300010398 | Tropical Forest Soil | MKHIMGTALRVVSCVVLLGAAVALLAGQDDIRKFHRMRSM* |
Ga0134123_115550711 | 3300010403 | Terrestrial Soil | RLGTMKHITGTALRFAACVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0126358_10176121 | 3300010856 | Boreal Forest Soil | DKAMKHIAGAILRTGACVVLLVTGVALLAGKDDIRKFRQMRNM* |
Ga0126358_12063511 | 3300010856 | Boreal Forest Soil | MKHITGTALRAAACVVLLVTGLALLAGKDDIRKFRRMHSM* |
Ga0126345_12174101 | 3300010858 | Boreal Forest Soil | MKHITGTVLRSAACVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0126349_10875634 | 3300010861 | Boreal Forest Soil | MKHIAGAILRTGACVVLLVTGVALLAGKDDIRKFRQMRNM* |
Ga0126349_11235961 | 3300010861 | Boreal Forest Soil | MKHITGTALRTAACVVLLVTGLALLAGKDDVRKFHRMRSM* |
Ga0126346_11218592 | 3300010865 | Boreal Forest Soil | MKHITGTALRIAACVMLAVIGLALLAGKGDIRRFHSMLGM* |
Ga0126347_13591962 | 3300010867 | Boreal Forest Soil | MKHITGTALRIAACVMLAVIGLALLAGKDDIRRFNRMRSM* |
Ga0126347_14666602 | 3300010867 | Boreal Forest Soil | MKHINGKVPRIAACVVLAVTGLALLAGKDDIRRFHRIHSM* |
Ga0126361_100745723 | 3300010876 | Boreal Forest Soil | MKHIKGTALTVLALSTCAALLAGKDDIRKFHYMRSI* |
Ga0126361_101275843 | 3300010876 | Boreal Forest Soil | MKHIKGTALTVIGLGICAALLAGKDDIRKFHRMRSM* |
Ga0126361_105793033 | 3300010876 | Boreal Forest Soil | MKHIKGTALTVLALGICAALLAGKDDIRRFHDMRSI* |
Ga0138589_1135931 | 3300011016 | Peatlands Soil | MKHIVGTTLRVGACAVLAITGLALLAGKDDIRRFRRMRNM* |
Ga0138530_1177921 | 3300011024 | Peatlands Soil | KGSKMKHIVGTTLRVAACLVAGIAGVALLAGKDDIRKFRRMRNM* |
Ga0138593_1233972 | 3300011039 | Peatlands Soil | MKHIAGTALRVGGCLVVLITGVALLAGKDDIRKFRRMRNM* |
Ga0138528_1000792 | 3300011043 | Peatlands Soil | GTTLRVGACAVLAITGLALLAGKDDIRRFRRMRNM* |
Ga0138545_1107173 | 3300011044 | Peatlands Soil | RRAQKMKHIVGTTLRVGACAVLAITGLALLAGKDDIRRFRRMRNM* |
Ga0138545_1408631 | 3300011044 | Peatlands Soil | QEMKHIIGTVLRVAGCLVMLLVGLALLAGKDDIRKFRRMRRM* |
Ga0138545_1570131 | 3300011044 | Peatlands Soil | AWTMKHIAGTALAAGCLALVGAALLAGKDDIRKFHRMRSM* |
Ga0138585_1551141 | 3300011052 | Peatlands Soil | RRARKMKHIAGTALRVGGCVVVLITGVALLAGKDDIRKFRRMRKM* |
Ga0138541_10646232 | 3300011058 | Peatlands Soil | MKHIAVTALREGGCLVVLITGVALLAGKDDIRKFRRMRKM* |
Ga0138541_10803011 | 3300011058 | Peatlands Soil | KAWTMKHIAGTALAAGCLALVGAALLAGKDDIRKFHRMRSM* |
Ga0138533_10619861 | 3300011065 | Peatlands Soil | MKHIAGTALAAGLALLGAALLAGQDDIRKFHRMRSM* |
Ga0138594_10703491 | 3300011067 | Peatlands Soil | MRHIAGTALAVGCVALVGAALLAGMDEIRRFHRMRSM* |
Ga0138594_11116541 | 3300011067 | Peatlands Soil | TALRVAGCIVLAITGVALLAGKDDIRKFRRMRSM* |
Ga0138599_10210491 | 3300011068 | Peatlands Soil | VQQKGSKMKHIVGTTLRVAACLVSGIAGVALLAGKDDIRKFRRMRNM* |
Ga0138559_10696331 | 3300011074 | Peatlands Soil | MKHIAGTALAAGCLPLVGAALLAGKHDIRQFHRMRSM* |
Ga0138555_11055181 | 3300011075 | Peatlands Soil | QQKGSKMKHIVGTTLRVAACLVAGIAGVALLAGKDDIRKFRRMRNM* |
Ga0138569_10868574 | 3300011079 | Peatlands Soil | MKHIVGTTLRVAGCLVVGIIGVALLAGKDDIRKFRRMRSM* |
Ga0138569_11708971 | 3300011079 | Peatlands Soil | RRAQKMKHIVGTTLRVGACAVLAITGLALLAGKDDIRKFRQMRSM* |
Ga0138560_10245432 | 3300011083 | Peatlands Soil | MKHITGTALRVGGCLVLTITGVALLAGKDDIRKFRRMRNM* |
Ga0138562_10789392 | 3300011084 | Peatlands Soil | MKHIVGTTLRVAGCTALLVAGVALVAGKDDIRKFRQMRRM* |
Ga0138576_11120902 | 3300011088 | Peatlands Soil | MKHIAGTMLTAGCLALVGVALFAGKDDIRKFHRMRSM* |
Ga0151490_15694443 | 3300011107 | Soil | MKHITGMALRTAACAVLLVTGLALLAGMDDIRKFHRMRSM* |
Ga0150983_128774803 | 3300011120 | Forest Soil | MKHITGTALRVAACAVLLVTAAALLVGQDDIRKFHRMRSM* |
Ga0150983_160558701 | 3300011120 | Forest Soil | MKHITGTALRVASCVVLLVTAAALLAGKDDVRKFHRMRSM* |
Ga0138532_10643881 | 3300011305 | Peatlands Soil | IIGTVLRVVGCLVLLFVGLALLAGKDDIRKFRRMHSM* |
Ga0137383_112985532 | 3300012199 | Vadose Zone Soil | MKHITGAALRTAACVVLLVAGLALLAGKDDIRKFHRMRCM* |
Ga0137365_1000246711 | 3300012201 | Vadose Zone Soil | MKHITGTALRIAACAVLLVVGLTLLAGKDDIRKFHRMHSM* |
Ga0137362_113549272 | 3300012205 | Vadose Zone Soil | MKHITGTALRIAACAVLLVTGLALLAGKDDIREFHRMRSM* |
Ga0137380_106188383 | 3300012206 | Vadose Zone Soil | GRNRKARTMKHITGTAPRIAACVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0137379_108761261 | 3300012209 | Vadose Zone Soil | MKHITGTTLRVAACAVLLVTALALLAGKDDIRKFHRMRSM* |
Ga0137378_101526263 | 3300012210 | Vadose Zone Soil | MKHITGTALRTAVSVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0137377_115112621 | 3300012211 | Vadose Zone Soil | MMHITGTPLRSAACVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0150985_1179827663 | 3300012212 | Avena Fatua Rhizosphere | MKHITGTAPRSAACVVLLVTGLALLAGNDDIRKFHRMRSM* |
Ga0137372_100787043 | 3300012350 | Vadose Zone Soil | MKHITGTALRVAAVVVLVVTGLALLAGQDDIRRFHRMRSM* |
Ga0137371_100655816 | 3300012356 | Vadose Zone Soil | MKHITGTAPRIAACVVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0137375_102134223 | 3300012360 | Vadose Zone Soil | MKHITGTALRIAACAVLLVTGLTLLAGKDDIRKFHRMHSM* |
Ga0157320_10284461 | 3300012481 | Arabidopsis Rhizosphere | TERLGPMKHITGAALRTAACTALLVAGVALLAGKDDIRKFHRMRSM* |
Ga0157293_100531532 | 3300012898 | Soil | MKHITGTALRVAACAVLLVTAAALLAGKDDIRKFHRMRSM* |
Ga0137395_105558252 | 3300012917 | Vadose Zone Soil | MKHIAGTALRVTTCLVLAVTGLALLAGKDDIRKFRR |
Ga0164303_110992602 | 3300012957 | Soil | MKHTTGTAPRIAACAVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0164299_109739611 | 3300012958 | Soil | MKHIMGTALRAAGCVVLLCAGVALVAGKDDIRKFNRMRSM* |
Ga0164301_105279082 | 3300012960 | Soil | MKHITGATLRVASCIVLLVTAAALLAGKDDIRKFHRMRSM* |
Ga0164301_115653181 | 3300012960 | Soil | MKHITGTAPRIAACAVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0164309_111780861 | 3300012984 | Soil | IHGKVRTMKHITGATLRVASCIVLLVTAAALLAGKDDIRKFHRMRSM* |
Ga0164308_102890862 | 3300012985 | Soil | MKHITGTALRITACVVLLVTGLTLLAGKDDIRKVHRMRSM* |
Ga0164304_117714861 | 3300012986 | Soil | MKHITGTALRITACFVLLVTGLTLLAGKDDIRKFHRMHSM* |
Ga0164305_118477661 | 3300012989 | Soil | MKHITGTALRSAACVVLLATGLALLAGKDDIRKFHRMHSM* |
Ga0157374_124983521 | 3300013296 | Miscanthus Rhizosphere | MKHITGTTPRIAACIVLAGAGLALLAGKGDIRRFHRMRSM* |
Ga0163162_121141602 | 3300013306 | Switchgrass Rhizosphere | MKHITTGTALRSAACVVLLATGLALLAGKDDIRKLHRMHSM* |
Ga0157375_101491983 | 3300013308 | Miscanthus Rhizosphere | GTERLGTMKHITGTALRFAACVVLLVTGLALLAGKDDIRKFHRMHSM* |
Ga0157375_134856342 | 3300013308 | Miscanthus Rhizosphere | MKHITGTALRTAACVVLLVTGLALLAGKDDIRKFHRM |
Ga0134078_104949902 | 3300014157 | Grasslands Soil | TALKIAAGAVLLVTGLALLAGKDDIRKFHRMRSM* |
Ga0181531_101586242 | 3300014169 | Bog | MKRIVATALRAAATVVLLAACVLLVAGKDDIRKFRRMCGM* |
Ga0182013_1000078116 | 3300014492 | Bog | MKHIKGKALTVVALGICVALLAGKDDIRKFHRMRSM* |
Ga0182015_106696321 | 3300014495 | Palsa | MKHIKGTALTALALGICVALLAGKDDIRKFRRMRSM* |
Ga0182005_12305592 | 3300015265 | Rhizosphere | DRIMKHNTGTTVRIAACIVLAGTGLALLAGKDDIRRFHRMRSM* |
Ga0132258_101866064 | 3300015371 | Arabidopsis Rhizosphere | MKHITGTALKVAACAVLLVTAAALLAGQDDIRRFHRMRSM* |
Ga0132256_1012299263 | 3300015372 | Arabidopsis Rhizosphere | IMKHITGTALRSAACVVLLATGLALLAGKDDIRKFHRMRSM* |
Ga0132256_1039301231 | 3300015372 | Arabidopsis Rhizosphere | GPMKHITGTALRAAACAVLLVTGLALLAGMDDIRKFRRMRSM* |
Ga0132255_1016235891 | 3300015374 | Arabidopsis Rhizosphere | MKHISGTALRTAACVVLLVTGLALLAGMDDIRKFHRMRTM* |
Ga0182034_119404342 | 3300016371 | Soil | MKHITGTALRVASCVVLLVTAAALLAGQDDIRKFHRIRSM |
Ga0182040_118267601 | 3300016387 | Soil | VGEKARAMKHIVGTALRVGMCATVIGACVALLAGKDDIRKFRRMRSM |
Ga0182038_100847165 | 3300016445 | Soil | KHITGTALRVAACAVVLVTAVALLAGQDDIRRFHRMRSM |
Ga0182038_101167771 | 3300016445 | Soil | MKHITGTALRVAACVVLLVTAAALLAGKDDIRRFRRMRSM |
Ga0181511_13135704 | 3300016702 | Peatland | VGTTLKVGACAVLAITGLALLAGKDDIRKFRQMRSM |
Ga0187812_10055662 | 3300017821 | Freshwater Sediment | MKRITGTALAVACLAAIGAALLAQKDDIRKFHRMRSM |
Ga0187812_10140925 | 3300017821 | Freshwater Sediment | MKHIIGTALRVAGCLVLLITGLALLAGKDDIRKFRRMRSM |
Ga0187812_10338152 | 3300017821 | Freshwater Sediment | MKHIAGTALAAGCLALVGAALLAGKDDIRKFHRMRSM |
Ga0187812_10427973 | 3300017821 | Freshwater Sediment | MKHITGTALAVACLAVIGAALLAGQDDIRKFHRMRSM |
Ga0187812_10842351 | 3300017821 | Freshwater Sediment | MKHVTGTALAVACFAAIGVALLAGKDDIRKFHRMRSM |
Ga0187802_102258572 | 3300017822 | Freshwater Sediment | MKHITGTALAVACFAAIGTALLAGKDDIRKFHRMRSM |
Ga0187820_10091682 | 3300017924 | Freshwater Sediment | MKHITGTALAAVCFAAIGAALLAGKDDIRKFRRILSM |
Ga0187820_10152122 | 3300017924 | Freshwater Sediment | MKHITGTALAVACFAAIGGALLAGKDDIRKFNRMRSM |
Ga0187820_10878411 | 3300017924 | Freshwater Sediment | MKHIAGTALAAGCLALVGVALLAGKDDIRKFHRMRSM |
Ga0187820_13243272 | 3300017924 | Freshwater Sediment | MKHITGTTLGVASCVVLLVTATALLAGKDDIRKFHRMRSM |
Ga0187807_10152762 | 3300017926 | Freshwater Sediment | MKHITGTALAVTCFAAIGAALLAGKDDIRKFHRMRSM |
Ga0187807_10218604 | 3300017926 | Freshwater Sediment | MKHIAGTALRAGMCAAVIGACAALLAGKDDIRKFRRMLSM |
Ga0187807_10253712 | 3300017926 | Freshwater Sediment | MRHIAGTALAAGCLALVGAALLAGKDDIRKFHRMRSM |
Ga0187807_10665513 | 3300017926 | Freshwater Sediment | MKHIARTALAVTCLAAIGAALLAGKDDIRRLRRMRSM |
Ga0187806_10093905 | 3300017928 | Freshwater Sediment | MRHIMGTALAVGCVALVGAALLAGLDDIRRFHRMRSM |
Ga0187806_11983651 | 3300017928 | Freshwater Sediment | MKHITGTALAAACFAAIGAALLAGKDDIRKFRRILSM |
Ga0187814_100183176 | 3300017932 | Freshwater Sediment | MKHIVGTALRVAGCTVLAITGVALLAGKDDIRKFRRMRSM |
Ga0187809_103770392 | 3300017937 | Freshwater Sediment | MKHITGTALRSAACVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0187808_105575232 | 3300017942 | Freshwater Sediment | MKHIAGTALAVGLALVGAALLAGQDDIRKFHRMRSM |
Ga0187819_107011931 | 3300017943 | Freshwater Sediment | MKHIARTALAVGCLAAIGAALLAGKDDIRKLRRMRSM |
Ga0187879_101115263 | 3300017946 | Peatland | MKHIVGTTLKVGACAVLAITGLALLAGKDDIRKFRQMRSM |
Ga0187879_101236702 | 3300017946 | Peatland | MKKHIVGTALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0187879_101619183 | 3300017946 | Peatland | MKHITGKAPRIAACVVLAVTGLALLAGQDDIRKFNRMRRM |
Ga0187879_101974471 | 3300017946 | Peatland | MKHIKGKALTVVALGICAALLAGKDDIRKFHRMRSM |
Ga0187779_103758632 | 3300017959 | Tropical Peatland | MKHVTGTALAVACLAAIGAALLAGKDDIRKFRRMRSM |
Ga0187779_106280672 | 3300017959 | Tropical Peatland | MKHIVGTALRAGMCATVIGACVALLAGKDDIRKFRRMRRM |
Ga0187779_106709422 | 3300017959 | Tropical Peatland | MKHITGTALRVAACVVLLATAVALLAGQDDIRKFHRMRSM |
Ga0187779_110323852 | 3300017959 | Tropical Peatland | MKHITGVTLRVAGCVVLLGAGLALLAGKDDIRRFQRMRSM |
Ga0187779_110568691 | 3300017959 | Tropical Peatland | MKHITGTALAVACFAAIGAALLAGKDDIRKFHRMRSM |
Ga0187783_100663645 | 3300017970 | Tropical Peatland | MKHFVGKALGVGCLVLVGAALFAGQDDIRKFHRMRSM |
Ga0187783_102131223 | 3300017970 | Tropical Peatland | VKHIAGTALAVGCFALVGAALLAGKDDIRKFYRMRSM |
Ga0187783_104773862 | 3300017970 | Tropical Peatland | MKRTTGMALAVACLAAIGAALLAGKDDIRKFHRMRSM |
Ga0187783_108640462 | 3300017970 | Tropical Peatland | MKHITGTALAVACLAAIGAALFAGKDDIRKFQRMRGM |
Ga0187781_101113704 | 3300017972 | Tropical Peatland | MKHIAGTALAVAGLAAVGAAIFAGLDDIRKFHRMRSM |
Ga0187781_101275522 | 3300017972 | Tropical Peatland | MKHITGTALCVAACLVLLGAGVALLAGKDDIRRFRRMRSM |
Ga0187781_102446603 | 3300017972 | Tropical Peatland | MKHIAGRVLAAACLAALSAALIAGQDDIRKFHRMRSM |
Ga0187781_105092593 | 3300017972 | Tropical Peatland | MKHITGTTLGVASCVVLLAAAAALLAGKDDIRRFHRMRSM |
Ga0187781_105097541 | 3300017972 | Tropical Peatland | MKHIAGTVLAAGCLALVAGALLAGMDDIRKFRRMRGM |
Ga0187780_102933413 | 3300017973 | Tropical Peatland | MKHITGTALAVACLAAIGAALLAGKDDIRKFRRMRSM |
Ga0187780_103059271 | 3300017973 | Tropical Peatland | TRKVRTMKHITGTALRVAACVVLLATAVALLAGRDDIRKFRRLRSM |
Ga0187780_106742242 | 3300017973 | Tropical Peatland | MKHTAGKALKVATCLVLMGACVALLAGKDDIRRFQRMRSM |
Ga0187777_102117213 | 3300017974 | Tropical Peatland | MKHITGTALRVAACVVLLATAVALLAGRDDIRKFRRLRSM |
Ga0187777_102342143 | 3300017974 | Tropical Peatland | MKHITGSRLGVAACVVLLGVGLALLAGKDDIRKFNRMRSM |
Ga0187777_103859541 | 3300017974 | Tropical Peatland | MKHTAGTALRLGMCAAVIGACIALLAGQDDIRKLRRMRRM |
Ga0187782_102605562 | 3300017975 | Tropical Peatland | MKHTAGTALRLGMCAAVIGACIALLAGQDDIRKLRRMRSM |
Ga0187782_102849942 | 3300017975 | Tropical Peatland | MKHIAGTALAVGCFALVGAALLAGKDDIRKFYRMRSM |
Ga0187782_107378081 | 3300017975 | Tropical Peatland | MKHIAGTVLAAGCLALVAGALLAGRDDIRKFRRMRAM |
Ga0187782_107437291 | 3300017975 | Tropical Peatland | MKHIAGTALAGAGLALIVAALFAGRDDIRKFHRMRSM |
Ga0187782_115708781 | 3300017975 | Tropical Peatland | KHIAGTALAAACLALIGAALFAGRDDIRKFHRMRSM |
Ga0187823_103064162 | 3300017993 | Freshwater Sediment | MKHIAGTALAVGLALVGAALLAGQEDIRKFHRMRSM |
Ga0187863_101107884 | 3300018034 | Peatland | MKHITGKAPRIAACVVLAVTGLALLAGQDDIRKFNRLRRM |
Ga0187875_103741872 | 3300018035 | Peatland | KRIMGTTLGIVALGVGVALLAGKDDIRKFHRMRSM |
Ga0187855_101285152 | 3300018038 | Peatland | MRKHIVGTALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0187855_107702711 | 3300018038 | Peatland | MKHVKGSALTIIGLGICAALLAGKDDIRKFHRMRSM |
Ga0187855_109248492 | 3300018038 | Peatland | KHIVGTALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0187871_100109283 | 3300018042 | Peatland | MKKHIVGTALGVVALGVGVALLAGKDDIRKFRRMRSM |
Ga0187871_100507951 | 3300018042 | Peatland | MKHIVATVLGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0187890_102674341 | 3300018044 | Peatland | MKHIVATALGVVALVVGAALLAGKDDIRKFHRMRSM |
Ga0187890_104783431 | 3300018044 | Peatland | MKHIVATALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0187766_103963741 | 3300018058 | Tropical Peatland | MKHTTGTALKVATCLVLLGAGVVLLAGKDDIRRFRRMRSM |
Ga0187766_108830821 | 3300018058 | Tropical Peatland | MKHMTGTALRVAACVLLLATAVALLAGQDDIRKFHRMRSM |
Ga0187765_103596672 | 3300018060 | Tropical Peatland | MKHITGTALKVAACMVLLATAVALLAGRDDIRKFHRMRSM |
Ga0187765_107393112 | 3300018060 | Tropical Peatland | MKHIAGTALKVATCVVLLGAGLALLAGQDDIRKFRRMRRM |
Ga0187765_111460751 | 3300018060 | Tropical Peatland | MKHTTGTALKVAACVVLLGVGVALLAGKDDIRRFRRMRSM |
Ga0187773_107885791 | 3300018064 | Tropical Peatland | MKHITGTALRVAACVVLLVTAAALLAGKDDIRRFHRMRSM |
Ga0187772_101908093 | 3300018085 | Tropical Peatland | MKHITGTALRLAACAVLLATAVALLVGKDDIRKFHRMRSM |
Ga0187772_102693522 | 3300018085 | Tropical Peatland | MKHEHITGTALRVASCVALLAAAAALLAGKDDIRRFRRMRGM |
Ga0187772_105562292 | 3300018085 | Tropical Peatland | MKHIIGTALRVAGCVVLLGVGVALLAGKDDIRKFRRMRRM |
Ga0187772_109590092 | 3300018085 | Tropical Peatland | MKHITGTTLGVASCVVLLAAAAALLAGKDDIRKFYRMRSM |
Ga0187769_100344654 | 3300018086 | Tropical Peatland | MKHIARTALAVACLAAIGAVLLAGKDDIRKLRRMRSM |
Ga0187769_106050153 | 3300018086 | Tropical Peatland | VRTMKHTAGTVLKGASCAVLLVTAAALLAGKDDIRRFRRMRSM |
Ga0187769_107906412 | 3300018086 | Tropical Peatland | MKHITGTALRLAACVVLLATAVALLAGQDDIRRFHRMRSM |
Ga0066667_104090893 | 3300018433 | Grasslands Soil | RNRKARIMKHITGTALRSAACVVLLATGLALLAGKDDIRKFHRMRSM |
Ga0066662_108508292 | 3300018468 | Grasslands Soil | MKHITGTTLRIAACVALAVTGLALLAGRDDIRRFHRMSSM |
Ga0066662_114937741 | 3300018468 | Grasslands Soil | MKHITGTAPRSAACVVLLVTGLALLAGNDDIRRFHRMRSM |
Ga0187795_12070452 | 3300019251 | Peatland | MKHTAGTVLKGASCAVLLVTAAALLAGKDDIRRFRRMRSM |
Ga0187796_12547263 | 3300019264 | Peatland | MKHTAGTVLKGASCAVLLVTAAALLAGKDDIRRFRSMRSM |
Ga0187800_11201391 | 3300019278 | Peatland | MKHIAGTALAAGCLALAGAALLAGKDDIRKFHRMRSM |
Ga0187800_17048053 | 3300019278 | Peatland | MKRITGTILAVACLATIGAALLAGKDDIRKFYRMRSM |
Ga0187797_10238162 | 3300019284 | Peatland | MMKHVTGTVVGVASCAVLLVAAAALLAGKDDIRKFHRMRSM |
Ga0187797_12639552 | 3300019284 | Peatland | MKHIAGTALAAGCLALVGAVLLAGKDDILRFQRMRSM |
Ga0187797_13550761 | 3300019284 | Peatland | SRRKAWTMKHVAGTALAVACLAAVGAALFAGLDDIRKFHRMRSM |
Ga0187797_14541182 | 3300019284 | Peatland | MKHITGTALRVTACVVLLVAAAALLAGQDDIRRFLRMRSM |
Ga0187797_16238921 | 3300019284 | Peatland | RRKAWTMKHIAGTALAVACLAAVGAALFAGRDDIRKFHRMRSM |
Ga0173482_102254331 | 3300019361 | Soil | MKHITTGTALRSAACVVLLVTGLALLAGKDDIRKFHRMHSM |
Ga0193747_10806272 | 3300019885 | Soil | MKHTTGTALRITAYVVLLVTGLVLLAGKDDIRKFHRMHSM |
Ga0193730_10344282 | 3300020002 | Soil | MKHITGTALKIAACVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0206353_110710791 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALRSAACVVLLATGLALLAGKDDIRKFHRMHSM |
Ga0179592_101476283 | 3300020199 | Vadose Zone Soil | MKHITGTALRIAACAVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0210407_112970022 | 3300020579 | Soil | MKHITGTALRVAACTVLLVAAAALLAGQDDIRKFHHMRSM |
Ga0210399_102927222 | 3300020581 | Soil | MKHIMGTALRVAGCVVLLGAGVALVAGKDDIRKFHRMRSM |
Ga0210399_103718142 | 3300020581 | Soil | MKHITGTPLRVASCVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0210399_104753613 | 3300020581 | Soil | MKHITGTALRVAACTILLVTAAALLAGKDDIRKFHRMHSM |
Ga0210395_100051362 | 3300020582 | Soil | MKHIAETALWAVAIVVLAGAGAAVLAGKDDIRKFRRMRSM |
Ga0210395_100683562 | 3300020582 | Soil | MKHIMGTALRVAGCMVLLGAGVALVAGKDDIRKFNRMRSM |
Ga0210395_110238202 | 3300020582 | Soil | MKHITGTALRSTACVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0210405_107360072 | 3300021171 | Soil | MKHITGTALRITAYVVLLVTGLVLLAGKDDIRKFHRMHSM |
Ga0210408_100422494 | 3300021178 | Soil | MKHITGTPLRSAACVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0210408_106081332 | 3300021178 | Soil | MKHITGAALRTAACVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0210408_109376102 | 3300021178 | Soil | MKQIAGTTLAVGCLALVGVALFAGKDDIRKFHRMRSM |
Ga0213872_101491153 | 3300021361 | Rhizosphere | MKHITGTALAVACLAAIGAALLAGQDDIRKFRRMRSM |
Ga0213881_100123393 | 3300021374 | Exposed Rock | MKHISGTTLKIAACTVLAGAGLALLAGKDDIRRFHRMRSM |
Ga0213881_100619584 | 3300021374 | Exposed Rock | IAGRKFKVAACLVLVGAGAALIAGKDDIRKFHRMRNM |
Ga0213874_100589701 | 3300021377 | Plant Roots | MKHITGTTLGVAACVVLLATAAALLAGKDDIRKFHRMRSM |
Ga0210393_105514972 | 3300021401 | Soil | MKHITGTALRITAYVVLLVTGLALLASKDDIRKFHRMHSM |
Ga0210385_101469212 | 3300021402 | Soil | MKHIAGTALRAVAIVVLAGAALAVLAGKDDIRKFHRMRSM |
Ga0210397_100087564 | 3300021403 | Soil | MKHTTGTALRITAYVVLLITGLVLLAGKDDIRKFHRMHSM |
Ga0210397_107739302 | 3300021403 | Soil | MKHTTGTALKITAYVVLLVTGLVLLAGKDDIRKFHRMHSM |
Ga0210387_100511094 | 3300021405 | Soil | MKHIMGTALRVAGCVVLLGAGVALVAGKDDIRKFNRMRRI |
Ga0210387_103643523 | 3300021405 | Soil | MKHITGTALKIAAGVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0210394_108728432 | 3300021420 | Soil | MKHITGTALRITAYVVLLVTGLALLAGKDDIRKFHRMHS |
Ga0210394_110512571 | 3300021420 | Soil | GSDPMKHITGTALRITAYVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0210384_100692154 | 3300021432 | Soil | MKHITGTALRTAACVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0210391_105812871 | 3300021433 | Soil | NRTMKHIMGTALRVAGCVVLLGAGVALVAGKDDIRKFHRMRSM |
Ga0210390_111467752 | 3300021474 | Soil | MKHTTGTALKITAYVVLLVTGLVLLAGKDDIRKFHRMRSM |
Ga0210392_103078322 | 3300021475 | Soil | MKHITGTTLKIAAGVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0210402_108447432 | 3300021478 | Soil | MKHITGTALKIAAGVVLLVTGLALLAGKDDIRKFH |
Ga0210410_112665642 | 3300021479 | Soil | GTERLGPMKHITGTAPRFAACAVLLVTGLALLAGKDDIRKFHRMHSM |
Ga0210409_105086533 | 3300021559 | Soil | MKHITGTALKTAACVVLLVAGLALLAGKDDIRKFHRMRSM |
Ga0126371_101726665 | 3300021560 | Tropical Forest Soil | MKHITGTTLKVAACVVLLVTAAALLAGQDDIRKFHRMRSM |
Ga0126371_107258202 | 3300021560 | Tropical Forest Soil | MKHITGTALRVVSCVVLLGAAVALLAGQDDIRKFHRMRSM |
Ga0126371_109352542 | 3300021560 | Tropical Forest Soil | MKHITGTALRVAACAVLLVAAAALLAGQDDIRRFHRMRSM |
Ga0126371_113150961 | 3300021560 | Tropical Forest Soil | MKHITGTALRVAACVVLLVTAAALLAGQDDIRKFHRMRSM |
Ga0126371_114739871 | 3300021560 | Tropical Forest Soil | MKHNTGTTVRIAACIVLAGTGLALLAGKDDIRRFHRMRSM |
Ga0126371_135572781 | 3300021560 | Tropical Forest Soil | MKHITGTALRVAACVVLLVTAAALLAGQDDIRKFHR |
Ga0126371_138370022 | 3300021560 | Tropical Forest Soil | MKHITGTTLRVAACVVLLVAAAALLAGQDDIRKFHRMRSM |
Ga0213852_14640292 | 3300021858 | Watersheds | MKHITGATLRVASCVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0213851_12041572 | 3300021860 | Watersheds | MKHIIGTALRVATCVVLLGAGLALLAGKDDIRKFRRMRSM |
Ga0213851_13570222 | 3300021860 | Watersheds | MKHITGVTLKVGSCVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0213851_16378593 | 3300021860 | Watersheds | MKHITGTALRVASCVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0213851_16832072 | 3300021860 | Watersheds | MKHITGTALAVACFAAIGGALLAGKDDIRKFHRMRSM |
Ga0213853_104431762 | 3300021861 | Watersheds | MKHITGTTLGVASCVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0242667_10198802 | 3300022513 | Soil | MKHIMGTALRVAGCVVLLGAAVALVAGKDDIRKFNRMRSM |
Ga0242669_11068701 | 3300022528 | Soil | TGTAPRFAACAVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0242668_10275153 | 3300022529 | Soil | KHITGTAPRFAACAVLLVTGLALLAGKDDIRKFHRMHSM |
Ga0242668_10311231 | 3300022529 | Soil | HITGTALKIAAGVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0242668_10523572 | 3300022529 | Soil | GRYRKARTMKHIVATALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0242668_10543331 | 3300022529 | Soil | TGAILRVASCVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0242670_10092701 | 3300022708 | Soil | MKHIVATALGVVALAVGVALLAGKHDIRKFHRMRSM |
Ga0242677_10848341 | 3300022713 | Soil | MKHIAGTALWAVAIVVLAGAGAAVLAGKDDIRKFHRMRSM |
Ga0242675_10106661 | 3300022718 | Soil | PGGTERLGPMKHTTGTALRITAYVVLLITGLVLLAGKDDIRKFHRMHSM |
Ga0242672_10144782 | 3300022720 | Soil | MKHITGTALRVAACTVLLVAAAALLAGQDDIRKFHRMRSM |
Ga0242672_10685951 | 3300022720 | Soil | GNRKAQTMKHITGTALRVAACAVVLVTAVALLAGKDDIRKFHRMRSM |
Ga0224549_10001503 | 3300022840 | Soil | MKRIMGTALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0224557_10004829 | 3300023101 | Soil | MKHIKGKALTVVALGICVALLAGKDDIRKFHRMRSM |
Ga0247681_10315592 | 3300024310 | Soil | MKHITGTAPRIAVCVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0207656_105057062 | 3300025321 | Corn Rhizosphere | NRKARTMKHITTGTALRSAACVVLLVTGLALLAGKDDIRKFHRMHSM |
Ga0208848_10245462 | 3300025509 | Arctic Peat Soil | MKHITGTALRIAACVVLAVAGLALLAGQDDIRRFHRMRSM |
Ga0208219_10157052 | 3300025625 | Arctic Peat Soil | MGTVLRTASVVVLVGACLALLAGKDDIRKFRRMRNKRAGGMA |
Ga0208589_10386433 | 3300025634 | Arctic Peat Soil | MKHIKGTALTVLTLGICVALLAGKDDIRKFRYMQSM |
Ga0207692_100148774 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGMAPRIAACVVLAVTGLALLAGQDDIRRFHRMRSM |
Ga0207692_104208591 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGAALRTAACVVLLATGLALLAGKDDIRKFHRMRSM |
Ga0207692_106985642 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHIMGTALRAAGCVVLLCTGVALVAGKDDIRKFNRMRSM |
Ga0207699_100043847 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALRFAACVVLLVTGLALLAGKDDIRKFHRMHSM |
Ga0207684_104052483 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALRIAACAVLLVTGLALLAGKDDIRKFHRMHSM |
Ga0207693_103760591 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LGPMKHITGTALRTAAYAVLLVTGVALLAGKDDIRKFHRMRSM |
Ga0207663_112343142 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHISGTTLRIAACAVLVGTGLALLAGKDDIRRFHRMRSM |
Ga0207646_101514726 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHIAGTALRVTTCLVLAVAGLALLAGKDDIRKFRRMRGM |
Ga0207646_109159502 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTALKIAACAVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0207659_112451632 | 3300025926 | Miscanthus Rhizosphere | MKHITGTALRSAACVVLLATGLALLAGKDDIRRFHRMRSM |
Ga0207700_106363412 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTTPRIAACIVLAGAGLALLAGKDDIRRFYRMRSM |
Ga0207664_104739274 | 3300025929 | Agricultural Soil | NTGTTLRIAACVVLAGTGLALLAGKDDIRRFHRMRSM |
Ga0207664_108297972 | 3300025929 | Agricultural Soil | MKHITGTALRIAACVVLLATGLALLAGKDDIRKFHRMH |
Ga0207664_110411352 | 3300025929 | Agricultural Soil | MKHITGTALRTAACAVLLVTGVALLAGKDDIRKFHRMRSM |
Ga0207690_113219302 | 3300025932 | Corn Rhizosphere | MKHITTGTALRSAACVVLLVTGLALLAGKADIRKFHRMHSM |
Ga0207686_115924412 | 3300025934 | Miscanthus Rhizosphere | MKHITGTALRTAACVVLLVTGLALLAGKDDIRKFHHMRSM |
Ga0207709_105345372 | 3300025935 | Miscanthus Rhizosphere | MKHITGTALRTAACVVLLVTGLALLAGKDDIRKFHRMHSM |
Ga0207665_102558742 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHITGTSLRSAACVVLLVTGLALLAGKDDIRKFHRMHSM |
Ga0210077_11219051 | 3300025952 | Natural And Restored Wetlands | MKHISGKTLGAAAACTALLAVGVAVLAGKDDIRKFCRMHSM |
Ga0207640_106862442 | 3300025981 | Corn Rhizosphere | MRPRIDRRTALRFAACVVLLVTGLALLAGKDDIRKFHRMHSM |
Ga0207703_113890961 | 3300026035 | Switchgrass Rhizosphere | MKHITGTALRSAACVVLLATGLALLAGKDDIRKFH |
Ga0207703_119609251 | 3300026035 | Switchgrass Rhizosphere | MKHITGTALRIAACVVLLVTGLALLAGKDDIRKFHHMRSM |
Ga0209871_10296162 | 3300026217 | Permafrost Soil | MKHIKGTVLTVLALGICVALLAGKDDIRKFHHMRSM |
Ga0257147_10224742 | 3300026475 | Soil | MKHITGTAPRIAACVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0209648_102708862 | 3300026551 | Grasslands Soil | MKHIAGTALRVTTCVVLAVTGLALLAGKDDIRKFRRMRSM |
Ga0208199_10017412 | 3300027497 | Peatlands Soil | MKHIAGTALAAGLALVGAALLAGQDDIRKFHRMRSM |
Ga0209420_11463471 | 3300027648 | Forest Soil | MKHIVGTALRVAATVVLLAACVLLIAGKDDIRKFRQMRGM |
Ga0209217_11230952 | 3300027651 | Forest Soil | MKYITGTELRFVACLVLLGAGLTLLAGKDDIRKFRRMRSM |
Ga0207826_10118392 | 3300027680 | Tropical Forest Soil | MKHIMGTALRAAMCAAVIGACVALLAGKDDIRKFRRMRVM |
Ga0207826_11217112 | 3300027680 | Tropical Forest Soil | MKHIKGTALALACLTAIGAALLAGQDDIRKFQRMRSM |
Ga0207862_11609761 | 3300027703 | Tropical Forest Soil | MKHIKGTALALACLTAIGAALLAGQDDIRKFRRMRSM |
Ga0209178_11547342 | 3300027725 | Agricultural Soil | MKHITGAALRTATCAVLLVTGIALLAGKDDIRKFHRMRNM |
Ga0209178_11947972 | 3300027725 | Agricultural Soil | MKHITGAALRTAACTALLVAGVALLAGKDDIRKFHRMRSM |
Ga0209073_100702343 | 3300027765 | Agricultural Soil | MKHITGTTLRITACITLAGAALALLAGKDDIRRFHRMRSM |
Ga0209448_102641002 | 3300027783 | Bog Forest Soil | MKHTAGTMLAAGCLALVGVALFAGKDDIRKFHRMRSM |
Ga0209656_1000228811 | 3300027812 | Bog Forest Soil | MKHIMGTALRVGGCLVLAITGVALLVGRDDIRKFRRMRSM |
Ga0209112_102111262 | 3300027817 | Forest Soil | MKHNTGTALRSAACVVLLATGLALLAGKDDIRKFHRMRSM |
Ga0209040_1000659512 | 3300027824 | Bog Forest Soil | MKHIVGTTLRVGACAVLAITGLALLAGKDDIRKFRQMRSM |
Ga0209040_100693423 | 3300027824 | Bog Forest Soil | MKHIVGTALRVGGCLVVGITCVALLAGKDDIRKFRRMRNM |
Ga0209773_103714201 | 3300027829 | Bog Forest Soil | MKHIAGTALAATCLALVAAALFAGKDDIRKFRRMRSM |
Ga0209180_101767382 | 3300027846 | Vadose Zone Soil | MKHIIGTALRGTTLVALLGAGAALLAGKDDIRKFRRMRSM |
Ga0209166_103437852 | 3300027857 | Surface Soil | MKHITGTALAVACLAAIGAALLAGKDDIRKFHRIRSM |
Ga0209166_106105081 | 3300027857 | Surface Soil | RAWTMKHITGTAPRIAACVVLAVTGLALLAGKDDIRRFHRMHSM |
Ga0209590_100102742 | 3300027882 | Vadose Zone Soil | MKHITGTALKIVACLVLLGICVALLAGKDDIRKFRRMRST |
Ga0209590_104489912 | 3300027882 | Vadose Zone Soil | MKHITGTALRAAACVVLLGTGVALLAGKDDIRKLRQMRSM |
Ga0209415_106047332 | 3300027905 | Peatlands Soil | MKHIVGTTLRVGACVVVGITGVALLAGKDDIRKFRRMRNM |
Ga0209415_106801352 | 3300027905 | Peatlands Soil | MKHIAGTALRVAGCTVVAITGVALLAGKDDIRKFRRMRSM |
Ga0209006_113876951 | 3300027908 | Forest Soil | MKHIMGTALRVAGCLVLLGAGVALVAGKDDIRKFNRMRSM |
Ga0209069_104679652 | 3300027915 | Watersheds | MKHITGTAPRFAACAALLVTGLALLAGKDDIRKFHRMHNM |
Ga0209069_107444702 | 3300027915 | Watersheds | MKHITGVTLRVASCVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0209168_100034763 | 3300027986 | Surface Soil | MKHITGTTLAVACLAAVGAALLAGKDDIRKFHRMRSM |
Ga0189899_1053882 | 3300028445 | Peatlands Soil | RARRRRRAQEMKHIIGTVLRVAGCLVLLFVGLALLAGKDDIRKFRRMRRM |
Ga0307313_101303212 | 3300028715 | Soil | MKHITGTALKIAACVVLLVTGLALLAGKDDIRKFHHMRSM |
Ga0307280_103205421 | 3300028768 | Soil | KHITGTALKIAACVVLLVTGLALLAGKDDIRKFHHMRSM |
Ga0302228_100140012 | 3300028808 | Palsa | MKLIIGTALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0308309_102465552 | 3300028906 | Soil | MKHITGAILRVASCVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0308309_104756911 | 3300028906 | Soil | MKHITGTALRTVACLVLLSTGVALLAGRDDIRKFRRMHKM |
Ga0308309_113327471 | 3300028906 | Soil | MKHITGTALKIAAGVALLVTGLVLLAGKDDIRKFHRMRSM |
Ga0311339_101383424 | 3300029999 | Palsa | MKHIVATALGVVALGVGMALLAGQDDIRKFHRMRSM |
Ga0311339_103628782 | 3300029999 | Palsa | MNHIVATALGVVALGVGVALLAGKNDIRKFHRMRNM |
Ga0311338_100580641 | 3300030007 | Palsa | ALPGRYGKARTMKHIVATALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0302306_101395741 | 3300030043 | Palsa | ARTMKRIMGTALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0302177_102891542 | 3300030053 | Palsa | MKHIAGMALAAGCLALIGAALLAGKDDIRKLHRIRSM |
Ga0302176_102068091 | 3300030057 | Palsa | APTMKLIIGTALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0310037_100828742 | 3300030494 | Peatlands Soil | MKHIVGTALRVAGCIVLAITGVALLAGKDDIRKFRRMRSM |
Ga0310038_101163332 | 3300030707 | Peatlands Soil | MKHIVGTALRVAGCIVLAITAAALLAGKNDIRKFRRMRSM |
Ga0265461_126554633 | 3300030743 | Soil | RTMKHIMGTALRVAGCVVLLGVGVALVAGKDDIRKFNRMHRM |
Ga0265763_10121242 | 3300030763 | Soil | MRHITGTTLGVTSCVVLLVTAAALLAGKDDVRKFHRMRSM |
Ga0265776_1051422 | 3300030880 | Soil | MKHITGSTLGVASCAVLLVAAAALLAGKDDIRKFHRMRSM |
Ga0265764_1171262 | 3300030882 | Soil | MKHIAGTMLAAGCLALVGVALFAGKDDIRKFHRMRSM |
Ga0265743_1016863 | 3300030885 | Soil | MKHIMGTTLRVGACLVLLITGVALLAGKDDIRKFRRMRSM |
Ga0265743_1069491 | 3300030885 | Soil | HIMGTALRVAGCVVLLGAGVALVAGKDDIRKFNRMRSM |
Ga0265743_1158602 | 3300030885 | Soil | MKHITGATLRVASCVVLLVTAAALLAGKDDVRKFHRMRSM |
Ga0074027_109213661 | 3300030980 | Soil | KARTMKHIKGTALTVLTLGICVALLAGKDDIRKFRRMHSM |
Ga0308178_10858762 | 3300030990 | Soil | MKHITGTALRSAACVVLLVTGLALLAGKDDIRKFHRMHSM |
Ga0265744_1041892 | 3300031017 | Soil | MRHITGTTLGVASCVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0265744_1082712 | 3300031017 | Soil | MKHITGTALRVAACVVLLGAGAALLAGKDDIRKFRQMRNM |
Ga0170824_1179068821 | 3300031231 | Forest Soil | MKHITGKALRSAACVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0170819_118692311 | 3300031469 | Forest Soil | LGPMKHITGTALKTAACVVLLVTGLALLAGKDDIRKFHRMRSM |
Ga0318516_100079627 | 3300031543 | Soil | MKHITGTALRVAACVVLLVTAAALLAGQDDIRKFHRIRSM |
Ga0318516_100541482 | 3300031543 | Soil | MKHIVGTALRVGMCATVIGACVALLAGKDDIRKFRRMRNM |
Ga0318516_101093962 | 3300031543 | Soil | MKHITGTALRVAGCAVLLVAAVALLAGQDDIRKFHRMRSM |
Ga0318516_103430392 | 3300031543 | Soil | MKHIAGTALAVGCLALLGAALFAGKDDIRKFHRMRSM |
Ga0318516_104403822 | 3300031543 | Soil | MTEGFETMKHITRTALRVGACLVLLGAGVALLAGRDDIRKFRRMRSM |
Ga0318534_101122631 | 3300031544 | Soil | MKHIAGTALAAGCLALVGAALFAGKDDIRKFHRMRSM |
Ga0318534_101782492 | 3300031544 | Soil | MKHITGTALRVTACAVLLVAAVALLAGKDDIRKFHRMRSM |
Ga0318534_105434462 | 3300031544 | Soil | MKHITGTTLKIAACVVLLVTAAALLAGQDDIRKFHRMRSM |
Ga0318541_103149462 | 3300031545 | Soil | MKHITRTALRVGACLVLLGAGVALLAGRDDIRKFRRMRSM |
Ga0318528_100721812 | 3300031561 | Soil | MKHIAGTALAAGCLALVGAALFAGNDDIRKFHRMRSM |
Ga0318528_102059832 | 3300031561 | Soil | MKQMTGTALRGAACVVLLATAVALLAGRDDIRKFHRMRGM |
Ga0318573_100915223 | 3300031564 | Soil | ARAMKHIVGTALRVGMCATVIGACVALLAGKDDIRKFRRMRSM |
Ga0318573_107200311 | 3300031564 | Soil | MKHTTGTAVRVAGCVVLLAAGLALLAGKDDIRRFRRMRNM |
Ga0318515_100221094 | 3300031572 | Soil | MKHITGTALRVTACAVLLVAAVALLAGQDDIRKFHRMRSM |
Ga0318555_106507661 | 3300031640 | Soil | MEMRHSSRKALKAAAFMVLLGTGAALLAGKDDIRKFRRMRSM |
Ga0318574_102340473 | 3300031680 | Soil | MKHIVGTALRVGMCATVIGACVALLAGKDDIRKFRRMRSM |
Ga0318572_101405892 | 3300031681 | Soil | MKHIAGTALAVGCLALVGAALFAGKDDIRKFHRMRSM |
Ga0318560_102308511 | 3300031682 | Soil | AMKHIVGTALRVGMCATVIGACVALLAGKDDIRKFRRMRSM |
Ga0318560_105410843 | 3300031682 | Soil | NRKARTMKHITGTTLKIAACVVLLVTAAALLAGQDDIRKFHRMRSM |
Ga0310686_1002797056 | 3300031708 | Soil | MKHIMGMALRVAGCVVLLGAGVALVAGKDDIRKFNRMRRM |
Ga0310686_10355063810 | 3300031708 | Soil | MKHIVATALGVVALGVGVALLAGKDDIRKLHRMRSM |
Ga0310686_1056358693 | 3300031708 | Soil | MKHITGTALRVASCVALLVTAAALLAGKDDIRKFHRMRSM |
Ga0310686_1067338752 | 3300031708 | Soil | MKHIAGTTLAAGCLALVGVALFAGKDDIRKFHRMRSM |
Ga0310686_1163406274 | 3300031708 | Soil | MKHIAGTVLAAGCLALVGAALFAGKDDIRRFHRMRSM |
Ga0318496_105635411 | 3300031713 | Soil | MKHTAGTALKVAGCVVLLGVGAALLAGKDDIRRFRRMRSM |
Ga0310813_102165953 | 3300031716 | Soil | MKHITGTALRSAVCVVLLATGLALLAGKDDIRKLHRMHSM |
Ga0306918_108188052 | 3300031744 | Soil | MKHITGTALRVTACAVLLVAAVALLAGRDDIRKFHRMRSM |
Ga0318492_101612184 | 3300031748 | Soil | MKHITGTALRVAGCVVLLLAAVALLAGQDDIRRFHRMRSM |
Ga0318492_105333241 | 3300031748 | Soil | MKHISGTALRVAACAVLLVTAVALLAGQDDIRKFHRMRSM |
Ga0318492_107333671 | 3300031748 | Soil | PGHSRKVRTMKHTAGTALKVAGCVVLLGVGAALLAGKDDIRRFRRMRSM |
Ga0318494_101251411 | 3300031751 | Soil | GVGEKARAMKHIVGTALRVGMCATVIGACVALLAGKDDIRKFRRMRSM |
Ga0307475_106761713 | 3300031754 | Hardwood Forest Soil | MKHIAGTTLAAGCLALVGVALFAGKDDLRKFHRMRSM |
Ga0318509_106235271 | 3300031768 | Soil | ITGTALRVAGCAVLLVAAVALLAGQDDIRKFHRMRSM |
Ga0318529_103404682 | 3300031792 | Soil | MKHITGTTLGVTSCVVLLVTASALLAGKDDIRKFHRMRSM |
Ga0318565_100211451 | 3300031799 | Soil | ARTMKHITGTALRVAACVVLLVTAAALLAGQDDIRKFHRIRSM |
Ga0318497_107054102 | 3300031805 | Soil | MKHTTGTALAVACFAAIGAALLAGKDDIRKFRRMRSM |
Ga0318568_109860051 | 3300031819 | Soil | MKHIVETALRVGMCATVIGACVALLAGKDDIRKFRRMRSM |
Ga0318511_101400792 | 3300031845 | Soil | MKHITGTTLKIAACAVLLVTAAALLAGQDDIRKFHRIRSM |
Ga0318527_101057043 | 3300031859 | Soil | MKHIAGAALAAGCIALTGVALFAGKDDIRKFHRMRSM |
Ga0306919_106099002 | 3300031879 | Soil | MKHIAGTALAAGCLALVGAALFAGKDDIRKLHRMRSM |
Ga0318544_103433541 | 3300031880 | Soil | MKHMTGTALRVAACAVLLVTVVALLAGKDDIRKFHRMRSM |
Ga0318544_104089341 | 3300031880 | Soil | MKHITGTALRVTACAVLLVAAVALLAGQDDIRKFHRMR |
Ga0306925_102188765 | 3300031890 | Soil | GTAPRVAVCVALLVTAAALLAGQDDIRRFHRMRSM |
Ga0306925_107354544 | 3300031890 | Soil | HITGTAPRVAACAVLLVAAVALLAGKDDIRKFHRMRSM |
Ga0318520_104322951 | 3300031897 | Soil | ARAMKHIVGTALRVGMCATVIGACVALLAGKDDIRKFRRMRNM |
Ga0318520_107996591 | 3300031897 | Soil | MKHITRTALRVGACLVLLGAGVALLAGRDDIRKFRR |
Ga0306923_124922201 | 3300031910 | Soil | MKHIAGMALAGGCLALVGAALFAGKDDIRKFHRMRSM |
Ga0306926_125399492 | 3300031954 | Soil | MKHITGTAVRVAACAVLLAAAVALLAGQDDIRRFRRMRSM |
Ga0318530_104057521 | 3300031959 | Soil | MKHITGTAVRVAACAVLLAAAVALLAGQDDIRRFRRMR |
Ga0308176_115075173 | 3300031996 | Soil | MKHITGTTLRIAACTVLAVTGLALLTGKDDIRRFRRMRSM |
Ga0318563_101273731 | 3300032009 | Soil | NRKARTMKHFTGTAPRVAVCVALLVTAAALLAGQDDIRRFHRMRSM |
Ga0318563_102493213 | 3300032009 | Soil | QHITGTALRVTACAVLLVAAVALLAGKDDIRKFHRMRSM |
Ga0318507_103745671 | 3300032025 | Soil | VETALRVGMCATVIGACVALLAGKDDIRKFRRMRSM |
Ga0318559_101832011 | 3300032039 | Soil | RKARTMKHITGTTLKIAACVVLLVTAAALLAGQDDIRKFHRIRSM |
Ga0318575_105236892 | 3300032055 | Soil | KHFTGTAPRVAVCVALLVTAAALLAGQDDIRRFHRMRSM |
Ga0318575_106614451 | 3300032055 | Soil | SRKDRTMKHTTGTAVRVAGCVVLLAAGLALLAGKDDIRRFRRMRNM |
Ga0318505_103210562 | 3300032060 | Soil | MKHITGTTLKIAACVVLLVTAAALLAGQDDIRKFHRIRSM |
Ga0318504_100905321 | 3300032063 | Soil | FTGTAPRVAVCVALLVTAAALLAGQDDIRRFHRMRSM |
Ga0318514_103734373 | 3300032066 | Soil | RKARTMKHITGTALRVTACAVLLVAAVALLAGKDDIRKFHRMRSM |
Ga0318524_100019003 | 3300032067 | Soil | MKHVAGTALRVAVCLVLAVVGLALLAGQADIRKFRRMRSM |
Ga0318524_100249031 | 3300032067 | Soil | HIVGTALRVGMCATVIGACVALLAGKDDIRKFRRMRSM |
Ga0318524_103598183 | 3300032067 | Soil | GRNRKARTMKHFTGTAPRVAVCVALLVTAAALLAGQDDIRRFHRMRSM |
Ga0318553_100355051 | 3300032068 | Soil | NRKARTMKHITGTALRVAGCAVLLVAAVALLAGQDDIRKFHRMRSM |
Ga0311301_100316208 | 3300032160 | Peatlands Soil | MKHIVGTTLRVAGCLVVGIIGVALLAGKDDIRKFRRMRSM |
Ga0311301_100557465 | 3300032160 | Peatlands Soil | MKHIVGTTLRVAACLVAGIAGVALLAGKDDIRKFRRMRNM |
Ga0311301_100667645 | 3300032160 | Peatlands Soil | MKHIAGTALRVGGCLVVLITGVALLAGKDDIRKFRRMRKM |
Ga0311301_100747816 | 3300032160 | Peatlands Soil | MKHIVGTTLRVGACAVLAITGLALLAGKDDIRRFRRMRNM |
Ga0311301_100789754 | 3300032160 | Peatlands Soil | MKHVLGVTLGVGGCLAVGITGVALLAGKDDIRKFRRMRNM |
Ga0311301_100863127 | 3300032160 | Peatlands Soil | MKHIVGTTLRVGGCLVVAIAGLALLAGKDDIRKFRQMRRM |
Ga0311301_106423802 | 3300032160 | Peatlands Soil | MRHIAGTALAVGCVALVGAALLAGMDDIRRFHRMRSM |
Ga0307472_1006035962 | 3300032205 | Hardwood Forest Soil | MKHITGTTLKVAACGVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0307472_1015004781 | 3300032205 | Hardwood Forest Soil | MMHITGTALRVAALSVLVVAGLALLAGKDDIRKFRRMRSM |
Ga0306920_1005220113 | 3300032261 | Soil | MKHFTGTAPRVAVCVALLVTAAALLAGQDDIRRFHRMRSM |
Ga0306920_1005703594 | 3300032261 | Soil | MKHLTGTALAVACLAAIGAALLAGKDDIRKFHRMRSM |
Ga0306920_1007259401 | 3300032261 | Soil | MKHLTGTALAVACLAAIGGALLAGKDDIRKFHRMRSM |
Ga0306920_1013357001 | 3300032261 | Soil | MKHITGTALAVACFAAIGAALLAGKDDIRKFRRMRSM |
Ga0306920_1015481342 | 3300032261 | Soil | MKHITGTALAVACLAAIGAALLAGKDDIRKFHRMRSM |
Ga0306920_1017338361 | 3300032261 | Soil | MKQITGTALAVACLVAVGAALLAGKDDIRKFHRMRSM |
Ga0348332_137977471 | 3300032515 | Plant Litter | MKHITGTALRVASCVVLLVTAAALLAGKDDVRKFHRMRSM |
Ga0335085_1002009412 | 3300032770 | Soil | MKHITGTALRVAACAVVLVTAVALLAGQDDIRKFHRMRSM |
Ga0335085_100222093 | 3300032770 | Soil | MKKITGTALRVAACAVVLVTAVALLAGQDDIRKFHRMRSM |
Ga0335085_100253719 | 3300032770 | Soil | MKHITGTALKVAACVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0335085_1002638211 | 3300032770 | Soil | MKHITGTALRVGACVVLLVTAAALLAGQDDIRRFHRMRSM |
Ga0335085_100342632 | 3300032770 | Soil | MKHITGTALRVAACAVLLVAAVALLAGKDDIRRFRRMRRM |
Ga0335085_101176111 | 3300032770 | Soil | MKHITGTALRAAACAVLLVTGLALLAGMDDIRKFHRMRSM |
Ga0335085_102008973 | 3300032770 | Soil | MKHITGTALRIAACAVLLVTGVALLAGKDDIRKFYRMHSM |
Ga0335085_103670063 | 3300032770 | Soil | MKHITGTALRVAALAVLAVTGLALLAGKDDIRRFHRMRSM |
Ga0335085_105865042 | 3300032770 | Soil | MKHIAGTALKVATCVVLLGAVLALLAGQDDIRKFRRMRRM |
Ga0335085_105867343 | 3300032770 | Soil | MKHIIGIALRVTGCVVLLGVGAALLAGKDDIRKFRRMRSM |
Ga0335085_107297432 | 3300032770 | Soil | MNYTTGTALKVAACVVLLVTAAALLAGQDDIRKFHRMRSM |
Ga0335085_107784913 | 3300032770 | Soil | MKHITGTALTVAVCAVLLVTAAALLAGQDDIRRFHRMRSM |
Ga0335085_111191683 | 3300032770 | Soil | MKHIIGTALKAGACLVLLGVGLALLAGKDDIRKFRRMRRM |
Ga0335085_113627662 | 3300032770 | Soil | MKHITGTALKVAACAVVLVTAAALLAGQDDIRRFHRMRSM |
Ga0335085_119446863 | 3300032770 | Soil | RKARTMKKITGTALRVAACAVVLVTAVALLAGKDDIRKFNRMRSM |
Ga0335085_119817142 | 3300032770 | Soil | MKHITGTALRVAACAVLLVAAVALLAGKDDIRKFHRMRRM |
Ga0335085_120100661 | 3300032770 | Soil | MKHITGTALRVAACAVLLAAAVALLAGKDDIRKFHRMRSM |
Ga0335085_120665682 | 3300032770 | Soil | MKHITGTALRVAACAVLLVTAAALLAGKDDIRRFHRMRSM |
Ga0335079_100469243 | 3300032783 | Soil | MKHITGRTLGAASCVVLLVTAAALLAGKDDIRKFHRMRSM |
Ga0335079_101120503 | 3300032783 | Soil | MKHITGTALRVTACAVLLVTAAALLAGKDDIRRFHRMRSM |
Ga0335079_107575172 | 3300032783 | Soil | MKHVIGTALRVAACVVVLGVGVALLAGKDDIRKFRRMRSM |
Ga0335079_115346882 | 3300032783 | Soil | MKHIAGTALKVATCVVVLAAGLALLAGKDDIRKFRRMRRM |
Ga0335078_100279553 | 3300032805 | Soil | MKHIAGTALRAAATVVLLVACVLLIAGRDDIRKFRRMRGM |
Ga0335078_102633842 | 3300032805 | Soil | MKHITGTALRVAACAVLLVVAVALLAGQDDIRKFHRMRSM |
Ga0335078_103643911 | 3300032805 | Soil | MKHFTGTALRVAACVALLVTAAALLAGQDDIRRFHRMRSM |
Ga0335078_106109082 | 3300032805 | Soil | MKHISGKTLGIAACTVLAGTGLALLAGKDDIRRFHRMRSM |
Ga0335078_106495653 | 3300032805 | Soil | MKYITGRTLGGASCLVLLVTAAALLAGKDDIRRFHRMRSM |
Ga0335078_107976492 | 3300032805 | Soil | MNHIAGTALGAVVIVLLGVGVAALAGKDDIRKFHRMRSM |
Ga0335080_108014492 | 3300032828 | Soil | MKHITGTALRVAVCAVLLVTAVALLAGKDDIRRFRRMRSM |
Ga0335080_108743872 | 3300032828 | Soil | MKHFIGVTFRVAGCVVLLAAGAALLAGKDDIRRFRRMRSM |
Ga0335080_117876252 | 3300032828 | Soil | MKHIIGTALKAGACLVLLGAGLALLAGKDDIRKFRRMRRM |
Ga0335070_101302553 | 3300032829 | Soil | VKHITGTTLRIAACVVLAVTGLALLAGKDDIRRFHHMRSM |
Ga0335081_1000599210 | 3300032892 | Soil | MKHVAGTALAVGCLAAVGAALFAGKDDIRKFHRMRSM |
Ga0335081_103936851 | 3300032892 | Soil | MKHFTGTALRVAACVALLVTAAALLAGQDDIRRFH |
Ga0335081_105515044 | 3300032892 | Soil | MKHTTGTTLKVAACVVLLVTAAALLAGQDDIRKFHRMRSM |
Ga0335081_110721082 | 3300032892 | Soil | MKHIIGTALRVAACVALAVAGLALLAGRNDIRRFRRMRGM |
Ga0335081_116228832 | 3300032892 | Soil | MKHITGTALRVAACAVLLVTVAALLAGKDDIRKFYRMRSM |
Ga0335069_100136568 | 3300032893 | Soil | MKHIIGTALRVAGCAVLLGAGVALLAGKDDIRKFLRMRRM |
Ga0335069_100668882 | 3300032893 | Soil | MKHITGTALRVTACAVLLVTAVALLAGKDDIRRFHRMRSM |
Ga0335069_124331692 | 3300032893 | Soil | MKHIAGTALKVATCVVVLAAGLVLLAGQDDIRKFRRMR |
Ga0335074_100243122 | 3300032895 | Soil | MKHIIGTALRITTTAVLLIACALLVAGKDDIRKFRRMRSM |
Ga0335074_100328683 | 3300032895 | Soil | MKHIAGTALRAAATVVLLAACVLLIAGKDDIRKFRRMRSM |
Ga0335074_100600837 | 3300032895 | Soil | MKHVTGTALAAGCLALVGAALFAGKDDIRKFRRMRSM |
Ga0335074_100733175 | 3300032895 | Soil | MKRITGTALAVACLAAIGAALLAGKDDIRKFGRMRSM |
Ga0335074_101230021 | 3300032895 | Soil | MKHITGTTLAVACLAAIGAALLAGKDDIRKFRRMRSM |
Ga0335074_107895232 | 3300032895 | Soil | MKHITGTALAVGCLAAIGAALLAGKDDIRKFHRMRSM |
Ga0335074_113337892 | 3300032895 | Soil | MKHIAGKALAAGCLALAGAALLAGKDDIRRFHRMRS |
Ga0335075_103788391 | 3300032896 | Soil | MKKTTGKALGIAACFGAVVACAALLAGKDDIRKFHRMRSM |
Ga0335075_114060022 | 3300032896 | Soil | MKHIAGTALAAGCIALVGAALIAGKDDIRKFHRMRSM |
Ga0335071_100843421 | 3300032897 | Soil | MKHIAGTALKVATCVVVLAAGLVLLAGQDDIRKFRRMRRM |
Ga0335072_107669732 | 3300032898 | Soil | MKHITGTALRIAACTVLLVTGVALLAGKDDIRKFRRMRSM |
Ga0335072_109227232 | 3300032898 | Soil | MKHITGTALRVTACAVVLVTAVALLAGQDDIRKFHRMRSM |
Ga0335072_115548431 | 3300032898 | Soil | MKHIACARHAGTALAAACVALVGAALLVGKDDIRKFRRMQNM |
Ga0335083_101001943 | 3300032954 | Soil | MKHITGKTLRTAACIGLAGTALALLAGKDDIRRFHRMRSM |
Ga0335083_101544183 | 3300032954 | Soil | MKHTTGTALRVAACAVLLVTAAALLAGQDDIRKFHRMRSM |
Ga0335076_100519547 | 3300032955 | Soil | MKHIAGTALKVATCVVVLAAGLVLLAGHDDIRKFRRMRRM |
Ga0335073_100472416 | 3300033134 | Soil | MKHITGTTPRVAACVALTAVGLALLAGWDDIRRFNRMRSM |
Ga0335073_103320792 | 3300033134 | Soil | MKHITGTAPRIAACVALAVAGLALLAGKDDIRRFHRMHSM |
Ga0335073_110082222 | 3300033134 | Soil | MKHITGTALAVACLAAIGAALLAGQDDIRKFHRMRSM |
Ga0335073_112268692 | 3300033134 | Soil | MKHSTGTAPRVAACVALVAIGLALLAGKDDIRRFRRMQSM |
Ga0335073_116164673 | 3300033134 | Soil | RNRKARTMKHITGTALRVAACAVVLVTAAALLAGQDDIRRFHRMRSM |
Ga0335077_1000618715 | 3300033158 | Soil | MKHFAGKVLAVGCLALVGAALLAGKDDIRRFQRMRSMLCRGA |
Ga0335077_107933033 | 3300033158 | Soil | MKHITGRALRAAALAVLAVTGLALLAGQDDIRRFHRMRSM |
Ga0334804_009680_136_246 | 3300033818 | Soil | MKHIKGVALTVFALGIGVALLAGKDDIRKFHRMRSM |
Ga0370483_0080915_108_218 | 3300034124 | Untreated Peat Soil | MKHIVAKALGVVALGVGVALLAGKDDIRKFHRMRSM |
Ga0370515_0125616_809_919 | 3300034163 | Untreated Peat Soil | MKHIVATALGVVALGVGVALLAGKNDIRKFHRMRNM |
Ga0373948_0126423_341_463 | 3300034817 | Rhizosphere Soil | MKHITGTALRVAACAVLLVAGLALLAGKDDIRKFHRMHSM |
⦗Top⦘ |