Basic Information | |
---|---|
Family ID | F003060 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 510 |
Average Sequence Length | 41 residues |
Representative Sequence | PRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Number of Associated Samples | 244 |
Number of Associated Scaffolds | 510 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 11.98 % |
% of genes near scaffold ends (potentially truncated) | 65.88 % |
% of genes from short scaffolds (< 2000 bps) | 91.96 % |
Associated GOLD sequencing projects | 218 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.098 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.039 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.176 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.608 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 510 Family Scaffolds |
---|---|---|
PF02586 | SRAP | 7.45 |
PF01068 | DNA_ligase_A_M | 4.90 |
PF04679 | DNA_ligase_A_C | 1.57 |
PF07690 | MFS_1 | 0.98 |
PF00589 | Phage_integrase | 0.98 |
PF01370 | Epimerase | 0.78 |
PF13671 | AAA_33 | 0.78 |
PF01471 | PG_binding_1 | 0.59 |
PF09278 | MerR-DNA-bind | 0.59 |
PF02796 | HTH_7 | 0.59 |
PF13191 | AAA_16 | 0.59 |
PF07883 | Cupin_2 | 0.59 |
PF00106 | adh_short | 0.59 |
PF00149 | Metallophos | 0.39 |
PF04909 | Amidohydro_2 | 0.39 |
PF12760 | Zn_Tnp_IS1595 | 0.39 |
PF13411 | MerR_1 | 0.39 |
PF05443 | ROS_MUCR | 0.39 |
PF13738 | Pyr_redox_3 | 0.39 |
PF04255 | DUF433 | 0.39 |
PF13614 | AAA_31 | 0.39 |
PF00239 | Resolvase | 0.39 |
PF00817 | IMS | 0.39 |
PF04392 | ABC_sub_bind | 0.39 |
PF01042 | Ribonuc_L-PSP | 0.39 |
PF02826 | 2-Hacid_dh_C | 0.39 |
PF00296 | Bac_luciferase | 0.39 |
PF04471 | Mrr_cat | 0.20 |
PF13432 | TPR_16 | 0.20 |
PF13276 | HTH_21 | 0.20 |
PF05717 | TnpB_IS66 | 0.20 |
PF07859 | Abhydrolase_3 | 0.20 |
PF05977 | MFS_3 | 0.20 |
PF00899 | ThiF | 0.20 |
PF01738 | DLH | 0.20 |
PF07681 | DoxX | 0.20 |
PF08837 | DUF1810 | 0.20 |
PF00982 | Glyco_transf_20 | 0.20 |
PF00528 | BPD_transp_1 | 0.20 |
PF00754 | F5_F8_type_C | 0.20 |
PF01381 | HTH_3 | 0.20 |
PF11800 | RP-C_C | 0.20 |
PF02274 | ADI | 0.20 |
PF13649 | Methyltransf_25 | 0.20 |
PF00753 | Lactamase_B | 0.20 |
PF13245 | AAA_19 | 0.20 |
PF13007 | LZ_Tnp_IS66 | 0.20 |
PF13577 | SnoaL_4 | 0.20 |
PF02219 | MTHFR | 0.20 |
PF02604 | PhdYeFM_antitox | 0.20 |
PF00034 | Cytochrom_C | 0.20 |
PF13580 | SIS_2 | 0.20 |
PF13701 | DDE_Tnp_1_4 | 0.20 |
PF07731 | Cu-oxidase_2 | 0.20 |
PF10049 | DUF2283 | 0.20 |
PF00248 | Aldo_ket_red | 0.20 |
PF01695 | IstB_IS21 | 0.20 |
PF13463 | HTH_27 | 0.20 |
PF13560 | HTH_31 | 0.20 |
PF13751 | DDE_Tnp_1_6 | 0.20 |
PF07813 | LTXXQ | 0.20 |
PF07366 | SnoaL | 0.20 |
PF10544 | T5orf172 | 0.20 |
PF13561 | adh_short_C2 | 0.20 |
PF00030 | Crystall | 0.20 |
PF14022 | DUF4238 | 0.20 |
PF13610 | DDE_Tnp_IS240 | 0.20 |
PF12787 | EcsC | 0.20 |
PF02705 | K_trans | 0.20 |
PF11897 | DUF3417 | 0.20 |
PF02371 | Transposase_20 | 0.20 |
PF13518 | HTH_28 | 0.20 |
PF13643 | DUF4145 | 0.20 |
PF01909 | NTP_transf_2 | 0.20 |
PF00211 | Guanylate_cyc | 0.20 |
PF01850 | PIN | 0.20 |
PF00916 | Sulfate_transp | 0.20 |
PF00893 | Multi_Drug_Res | 0.20 |
PF13358 | DDE_3 | 0.20 |
PF00999 | Na_H_Exchanger | 0.20 |
PF13374 | TPR_10 | 0.20 |
PF13231 | PMT_2 | 0.20 |
PF11294 | DUF3095 | 0.20 |
PF01527 | HTH_Tnp_1 | 0.20 |
PF01545 | Cation_efflux | 0.20 |
PF01425 | Amidase | 0.20 |
PF03050 | DDE_Tnp_IS66 | 0.20 |
PF07386 | DUF1499 | 0.20 |
PF00011 | HSP20 | 0.20 |
PF11249 | DUF3047 | 0.20 |
PF00313 | CSD | 0.20 |
PF13436 | Gly-zipper_OmpA | 0.20 |
PF04828 | GFA | 0.20 |
PF01526 | DDE_Tnp_Tn3 | 0.20 |
PF13700 | DUF4158 | 0.20 |
PF13683 | rve_3 | 0.20 |
PF12840 | HTH_20 | 0.20 |
COG ID | Name | Functional Category | % Frequency in 510 Family Scaffolds |
---|---|---|---|
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 7.45 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 6.47 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 4.90 |
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.59 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.39 |
COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.39 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.39 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.39 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.39 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.39 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.39 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.39 |
COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.39 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.20 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.20 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.20 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.20 |
COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.20 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.20 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.20 |
COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.20 |
COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.20 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.20 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.20 |
COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.20 |
COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.20 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.20 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.20 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.20 |
COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.20 |
COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.20 |
COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.20 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.20 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.20 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.20 |
COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.20 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.20 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.20 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.20 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.20 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.20 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.20 |
COG4446 | Uncharacterized conserved protein, DUF1499 family | Function unknown [S] | 0.20 |
COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.20 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.20 |
COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.20 |
COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 0.20 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.10 % |
Unclassified | root | N/A | 4.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001661|JGI12053J15887_10527695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → unclassified Aestuariivirga → Aestuariivirga sp. YIM B02566 | 563 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101004512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101708557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101878931 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300002568|C688J35102_119544061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
3300003219|JGI26341J46601_10026713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1884 | Open in IMG/M |
3300003223|JGI26343J46809_1000823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1956 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10398031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300004091|Ga0062387_100100186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1556 | Open in IMG/M |
3300004091|Ga0062387_100328403 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300004091|Ga0062387_100417268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 910 | Open in IMG/M |
3300004092|Ga0062389_100230687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1855 | Open in IMG/M |
3300004092|Ga0062389_101745029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 803 | Open in IMG/M |
3300004152|Ga0062386_101250817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
3300004635|Ga0062388_100128019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1882 | Open in IMG/M |
3300004635|Ga0062388_102647058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
3300005167|Ga0066672_10640604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
3300005179|Ga0066684_10149108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1482 | Open in IMG/M |
3300005332|Ga0066388_100415888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1989 | Open in IMG/M |
3300005332|Ga0066388_105799151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300005435|Ga0070714_101246817 | Not Available | 726 | Open in IMG/M |
3300005436|Ga0070713_100299129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1481 | Open in IMG/M |
3300005439|Ga0070711_100943805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
3300005439|Ga0070711_102058398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
3300005471|Ga0070698_101001652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 783 | Open in IMG/M |
3300005536|Ga0070697_101154306 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300005540|Ga0066697_10723241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300005546|Ga0070696_100753290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 798 | Open in IMG/M |
3300005568|Ga0066703_10458414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
3300005602|Ga0070762_10051899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2262 | Open in IMG/M |
3300005602|Ga0070762_10350069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 942 | Open in IMG/M |
3300005602|Ga0070762_10863245 | Not Available | 615 | Open in IMG/M |
3300005602|Ga0070762_11128550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
3300005610|Ga0070763_10606860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
3300005764|Ga0066903_106712433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
3300005921|Ga0070766_10247662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1129 | Open in IMG/M |
3300006028|Ga0070717_10013349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6291 | Open in IMG/M |
3300006163|Ga0070715_10239048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 943 | Open in IMG/M |
3300006175|Ga0070712_100096735 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
3300006175|Ga0070712_100323086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_38_11 | 1255 | Open in IMG/M |
3300006175|Ga0070712_101599911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
3300006175|Ga0070712_101791742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300006175|Ga0070712_101802324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
3300006176|Ga0070765_100287675 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
3300006176|Ga0070765_100688548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 965 | Open in IMG/M |
3300006176|Ga0070765_100893924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 839 | Open in IMG/M |
3300006176|Ga0070765_100933162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 820 | Open in IMG/M |
3300006176|Ga0070765_101175453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
3300006755|Ga0079222_10820347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
3300006796|Ga0066665_10980986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300006800|Ga0066660_11018328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
3300006806|Ga0079220_11784610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
3300006806|Ga0079220_12137357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
3300006844|Ga0075428_101817179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300006854|Ga0075425_102670349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
3300006904|Ga0075424_102605024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
3300007255|Ga0099791_10516866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
3300007258|Ga0099793_10335432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
3300009038|Ga0099829_10478153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1033 | Open in IMG/M |
3300009038|Ga0099829_11094796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
3300009088|Ga0099830_10883724 | Not Available | 739 | Open in IMG/M |
3300009088|Ga0099830_11588884 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300009090|Ga0099827_10432336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1127 | Open in IMG/M |
3300009143|Ga0099792_10517254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
3300009156|Ga0111538_12529049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
3300009162|Ga0075423_12360898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
3300009792|Ga0126374_10584600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 821 | Open in IMG/M |
3300010047|Ga0126382_11233361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 672 | Open in IMG/M |
3300010048|Ga0126373_10206587 | Not Available | 1907 | Open in IMG/M |
3300010048|Ga0126373_10482900 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300010048|Ga0126373_10563384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1188 | Open in IMG/M |
3300010048|Ga0126373_10618969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1136 | Open in IMG/M |
3300010048|Ga0126373_10881492 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 959 | Open in IMG/M |
3300010048|Ga0126373_11013167 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300010048|Ga0126373_11058224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 877 | Open in IMG/M |
3300010048|Ga0126373_11661800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
3300010048|Ga0126373_12484762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
3300010048|Ga0126373_13117303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
3300010048|Ga0126373_13282678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
3300010152|Ga0126318_10869531 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
3300010159|Ga0099796_10421483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 589 | Open in IMG/M |
3300010159|Ga0099796_10545963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
3300010304|Ga0134088_10388190 | Not Available | 680 | Open in IMG/M |
3300010335|Ga0134063_10560704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
3300010339|Ga0074046_10032037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3581 | Open in IMG/M |
3300010339|Ga0074046_10125793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1644 | Open in IMG/M |
3300010343|Ga0074044_10040069 | All Organisms → cellular organisms → Bacteria | 3256 | Open in IMG/M |
3300010343|Ga0074044_10117597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1785 | Open in IMG/M |
3300010343|Ga0074044_10330476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1001 | Open in IMG/M |
3300010343|Ga0074044_11139268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300010358|Ga0126370_12378647 | Not Available | 526 | Open in IMG/M |
3300010360|Ga0126372_11603879 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300010360|Ga0126372_12359285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
3300010361|Ga0126378_10206889 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
3300010361|Ga0126378_10692632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1131 | Open in IMG/M |
3300010361|Ga0126378_11114860 | Not Available | 889 | Open in IMG/M |
3300010361|Ga0126378_11477528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
3300010361|Ga0126378_12034066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
3300010361|Ga0126378_12553398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
3300010361|Ga0126378_12881351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
3300010361|Ga0126378_13043010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
3300010366|Ga0126379_11260892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 845 | Open in IMG/M |
3300010366|Ga0126379_11478774 | Not Available | 785 | Open in IMG/M |
3300010366|Ga0126379_11996641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
3300010366|Ga0126379_13639867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300010376|Ga0126381_100354899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2028 | Open in IMG/M |
3300010376|Ga0126381_100621582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1539 | Open in IMG/M |
3300010376|Ga0126381_101326076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
3300010376|Ga0126381_101428065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1000 | Open in IMG/M |
3300010376|Ga0126381_101694414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 913 | Open in IMG/M |
3300010376|Ga0126381_101804907 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300010376|Ga0126381_102404068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
3300010376|Ga0126381_103111954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
3300010376|Ga0126381_103158895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
3300010376|Ga0126381_103244212 | Not Available | 642 | Open in IMG/M |
3300010376|Ga0126381_103437309 | Not Available | 623 | Open in IMG/M |
3300010376|Ga0126381_104020282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
3300010376|Ga0126381_104061642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
3300010376|Ga0126381_104195511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300010376|Ga0126381_105048890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300010376|Ga0126381_105141051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300010398|Ga0126383_11325068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
3300010398|Ga0126383_11341346 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300010398|Ga0126383_13495807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300010398|Ga0126383_13514708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300011120|Ga0150983_15903186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 654 | Open in IMG/M |
3300011270|Ga0137391_10349705 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300011270|Ga0137391_11118656 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300011271|Ga0137393_10172963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1813 | Open in IMG/M |
3300011271|Ga0137393_11229903 | Not Available | 635 | Open in IMG/M |
3300012096|Ga0137389_10789268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
3300012096|Ga0137389_10890016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
3300012096|Ga0137389_11148840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
3300012096|Ga0137389_11616404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300012189|Ga0137388_11414187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
3300012202|Ga0137363_10518015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1003 | Open in IMG/M |
3300012202|Ga0137363_11768006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
3300012203|Ga0137399_10861812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
3300012205|Ga0137362_10788740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
3300012205|Ga0137362_11267321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
3300012208|Ga0137376_11040233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
3300012285|Ga0137370_10113040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1540 | Open in IMG/M |
3300012355|Ga0137369_10929149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
3300012361|Ga0137360_10867914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 777 | Open in IMG/M |
3300012361|Ga0137360_11315717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300012361|Ga0137360_11482002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
3300012362|Ga0137361_11543836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
3300012363|Ga0137390_10105890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2781 | Open in IMG/M |
3300012363|Ga0137390_10255333 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
3300012363|Ga0137390_10473229 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300012582|Ga0137358_10207795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1336 | Open in IMG/M |
3300012582|Ga0137358_10486039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 832 | Open in IMG/M |
3300012582|Ga0137358_10548147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 778 | Open in IMG/M |
3300012683|Ga0137398_10264316 | Not Available | 1149 | Open in IMG/M |
3300012683|Ga0137398_10947810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
3300012685|Ga0137397_10559102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 851 | Open in IMG/M |
3300012897|Ga0157285_10264623 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300012918|Ga0137396_10322597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1143 | Open in IMG/M |
3300012922|Ga0137394_10186834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1768 | Open in IMG/M |
3300012922|Ga0137394_10999123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
3300012923|Ga0137359_10379239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1256 | Open in IMG/M |
3300012923|Ga0137359_10490824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1084 | Open in IMG/M |
3300012923|Ga0137359_11795663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
3300012924|Ga0137413_11305984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
3300012924|Ga0137413_11541947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
3300012925|Ga0137419_11236808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
3300012929|Ga0137404_10489827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
3300012944|Ga0137410_10858802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
3300012944|Ga0137410_10941288 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300012944|Ga0137410_12081826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300012948|Ga0126375_11021043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
3300012958|Ga0164299_11543401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300012971|Ga0126369_10203267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1912 | Open in IMG/M |
3300012971|Ga0126369_11105945 | Not Available | 881 | Open in IMG/M |
3300012971|Ga0126369_13489532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
3300012984|Ga0164309_10790005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
3300012984|Ga0164309_11390943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 598 | Open in IMG/M |
3300012989|Ga0164305_10323321 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300012989|Ga0164305_11812699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300015052|Ga0137411_1307740 | All Organisms → cellular organisms → Bacteria | 5032 | Open in IMG/M |
3300015054|Ga0137420_1477998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1900 | Open in IMG/M |
3300015241|Ga0137418_10423648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1081 | Open in IMG/M |
3300015242|Ga0137412_10145541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1912 | Open in IMG/M |
3300015245|Ga0137409_11332033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
3300015357|Ga0134072_10054297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1123 | Open in IMG/M |
3300015372|Ga0132256_101762284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
3300015372|Ga0132256_102099720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
3300016270|Ga0182036_10052126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2575 | Open in IMG/M |
3300016270|Ga0182036_10913364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
3300016270|Ga0182036_11812294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
3300016294|Ga0182041_10759269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
3300016319|Ga0182033_10417139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1138 | Open in IMG/M |
3300016319|Ga0182033_10427102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. S-NIH.Pt15_0812 | 1125 | Open in IMG/M |
3300016319|Ga0182033_11210039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
3300016319|Ga0182033_11857940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
3300016341|Ga0182035_10302614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1312 | Open in IMG/M |
3300016341|Ga0182035_10622438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 934 | Open in IMG/M |
3300016371|Ga0182034_10395394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
3300016371|Ga0182034_11505802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
3300016371|Ga0182034_11530653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
3300016387|Ga0182040_10147285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1673 | Open in IMG/M |
3300016387|Ga0182040_10783595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
3300016387|Ga0182040_10954271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
3300016404|Ga0182037_10432604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
3300016404|Ga0182037_10720802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 855 | Open in IMG/M |
3300016422|Ga0182039_10422817 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300016422|Ga0182039_10715800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
3300016422|Ga0182039_11367941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
3300016422|Ga0182039_11867813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300016445|Ga0182038_11484274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
3300016445|Ga0182038_12130311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300017955|Ga0187817_10726194 | Not Available | 634 | Open in IMG/M |
3300017975|Ga0187782_11190278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
3300020579|Ga0210407_10021140 | All Organisms → cellular organisms → Bacteria | 4831 | Open in IMG/M |
3300020579|Ga0210407_10189596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1595 | Open in IMG/M |
3300020579|Ga0210407_10247840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1387 | Open in IMG/M |
3300020579|Ga0210407_10850761 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300020579|Ga0210407_10852615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
3300020579|Ga0210407_11034118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
3300020579|Ga0210407_11173655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
3300020579|Ga0210407_11343818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
3300020580|Ga0210403_10010256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7644 | Open in IMG/M |
3300020580|Ga0210403_10102725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2318 | Open in IMG/M |
3300020580|Ga0210403_10439043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1064 | Open in IMG/M |
3300020580|Ga0210403_10679337 | Not Available | 826 | Open in IMG/M |
3300020580|Ga0210403_11020223 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300020581|Ga0210399_10439815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1086 | Open in IMG/M |
3300020581|Ga0210399_10798733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
3300020581|Ga0210399_11372104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
3300020581|Ga0210399_11527524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 517 | Open in IMG/M |
3300020582|Ga0210395_10000873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 23201 | Open in IMG/M |
3300020582|Ga0210395_10390225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_38_11 | 1047 | Open in IMG/M |
3300020582|Ga0210395_10857551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
3300020582|Ga0210395_11021552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 612 | Open in IMG/M |
3300020583|Ga0210401_10014325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7678 | Open in IMG/M |
3300020583|Ga0210401_10435482 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
3300020583|Ga0210401_10451313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1148 | Open in IMG/M |
3300020583|Ga0210401_10612874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 950 | Open in IMG/M |
3300020583|Ga0210401_11018447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
3300020583|Ga0210401_11222038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
3300020583|Ga0210401_11314079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
3300020583|Ga0210401_11473428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
3300021168|Ga0210406_10089263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2629 | Open in IMG/M |
3300021168|Ga0210406_10358155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1176 | Open in IMG/M |
3300021168|Ga0210406_10405972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1091 | Open in IMG/M |
3300021168|Ga0210406_10461564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
3300021168|Ga0210406_10578475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
3300021168|Ga0210406_10766539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 737 | Open in IMG/M |
3300021168|Ga0210406_10932658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
3300021170|Ga0210400_11355663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
3300021171|Ga0210405_10621321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 840 | Open in IMG/M |
3300021171|Ga0210405_10680042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
3300021171|Ga0210405_10747541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
3300021171|Ga0210405_11123215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
3300021171|Ga0210405_11267084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
3300021171|Ga0210405_11296265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
3300021178|Ga0210408_10073358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2678 | Open in IMG/M |
3300021178|Ga0210408_10085148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2481 | Open in IMG/M |
3300021178|Ga0210408_10097134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2315 | Open in IMG/M |
3300021178|Ga0210408_10328870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1219 | Open in IMG/M |
3300021178|Ga0210408_10379451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1126 | Open in IMG/M |
3300021178|Ga0210408_10672099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
3300021178|Ga0210408_10674620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
3300021178|Ga0210408_10826569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
3300021178|Ga0210408_10832200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
3300021178|Ga0210408_10852179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 711 | Open in IMG/M |
3300021178|Ga0210408_10868776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
3300021178|Ga0210408_11125418 | Not Available | 603 | Open in IMG/M |
3300021180|Ga0210396_10224819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1672 | Open in IMG/M |
3300021180|Ga0210396_10263835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae | 1529 | Open in IMG/M |
3300021180|Ga0210396_10310781 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
3300021180|Ga0210396_10646626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 917 | Open in IMG/M |
3300021358|Ga0213873_10086129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 886 | Open in IMG/M |
3300021402|Ga0210385_10918655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
3300021403|Ga0210397_10989520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
3300021403|Ga0210397_11050548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
3300021404|Ga0210389_10437933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae | 1028 | Open in IMG/M |
3300021405|Ga0210387_10396627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidocella → Acidocella facilis | 1222 | Open in IMG/M |
3300021405|Ga0210387_10695248 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300021405|Ga0210387_11484392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
3300021406|Ga0210386_10763390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 832 | Open in IMG/M |
3300021406|Ga0210386_10906338 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300021406|Ga0210386_11136379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
3300021406|Ga0210386_11175508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
3300021407|Ga0210383_11272190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
3300021407|Ga0210383_11348250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
3300021407|Ga0210383_11665106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300021420|Ga0210394_10845953 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300021420|Ga0210394_11695462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
3300021432|Ga0210384_10133122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidocella → Acidocella facilis | 2231 | Open in IMG/M |
3300021432|Ga0210384_10827263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 824 | Open in IMG/M |
3300021432|Ga0210384_11322711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
3300021444|Ga0213878_10025473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2207 | Open in IMG/M |
3300021444|Ga0213878_10255960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
3300021444|Ga0213878_10454610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
3300021474|Ga0210390_10255271 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
3300021474|Ga0210390_10992388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
3300021475|Ga0210392_10742483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
3300021475|Ga0210392_11319055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
3300021476|Ga0187846_10107058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Propionivibrio → Propionivibrio dicarboxylicus | 1200 | Open in IMG/M |
3300021478|Ga0210402_10382919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1306 | Open in IMG/M |
3300021478|Ga0210402_11235582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
3300021478|Ga0210402_11290299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
3300021478|Ga0210402_11467017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
3300021478|Ga0210402_11912206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
3300021479|Ga0210410_10626880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 954 | Open in IMG/M |
3300021479|Ga0210410_10666818 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300021479|Ga0210410_10723718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 878 | Open in IMG/M |
3300021479|Ga0210410_11330139 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300021559|Ga0210409_11478184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
3300021559|Ga0210409_11658788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
3300021560|Ga0126371_10969646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 993 | Open in IMG/M |
3300021560|Ga0126371_10989853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 983 | Open in IMG/M |
3300021560|Ga0126371_11288886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
3300021560|Ga0126371_12439177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
3300021560|Ga0126371_12509300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300021560|Ga0126371_12592154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
3300021560|Ga0126371_13041153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
3300021560|Ga0126371_13113725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
3300021560|Ga0126371_13308032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
3300021560|Ga0126371_13543959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
3300022506|Ga0242648_1059755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
3300022726|Ga0242654_10159312 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300024227|Ga0228598_1119589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
3300025906|Ga0207699_11332108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300025910|Ga0207684_10489279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1055 | Open in IMG/M |
3300025910|Ga0207684_11272494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
3300025915|Ga0207693_10934275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
3300025916|Ga0207663_10939013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
3300025922|Ga0207646_10451054 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300025922|Ga0207646_10548964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
3300025928|Ga0207700_10580905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 996 | Open in IMG/M |
3300025929|Ga0207664_10177906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1825 | Open in IMG/M |
3300025939|Ga0207665_10304634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1192 | Open in IMG/M |
3300026142|Ga0207698_12227194 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300026551|Ga0209648_10213517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1461 | Open in IMG/M |
3300026551|Ga0209648_10273971 | Not Available | 1231 | Open in IMG/M |
3300026551|Ga0209648_10289003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1183 | Open in IMG/M |
3300026551|Ga0209648_10845382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
3300026555|Ga0179593_1165074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2439 | Open in IMG/M |
3300026557|Ga0179587_11191528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300027065|Ga0208489_1000141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2363 | Open in IMG/M |
3300027109|Ga0208603_1061525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
3300027174|Ga0207948_1005116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1492 | Open in IMG/M |
3300027521|Ga0209524_1010642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1835 | Open in IMG/M |
3300027545|Ga0209008_1022025 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300027565|Ga0209219_1019221 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
3300027583|Ga0209527_1026933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1283 | Open in IMG/M |
3300027605|Ga0209329_1119007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
3300027610|Ga0209528_1021354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1426 | Open in IMG/M |
3300027729|Ga0209248_10006811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3615 | Open in IMG/M |
3300027783|Ga0209448_10007848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3371 | Open in IMG/M |
3300027783|Ga0209448_10207054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
3300027824|Ga0209040_10050944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2495 | Open in IMG/M |
3300027824|Ga0209040_10074433 | Not Available | 1980 | Open in IMG/M |
3300027824|Ga0209040_10075610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1961 | Open in IMG/M |
3300027829|Ga0209773_10179778 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300027846|Ga0209180_10459870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
3300027855|Ga0209693_10238474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
3300027889|Ga0209380_10046961 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
3300027889|Ga0209380_10409924 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300028047|Ga0209526_10199142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1388 | Open in IMG/M |
3300028047|Ga0209526_10746837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
3300028536|Ga0137415_10829643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
3300028906|Ga0308309_10397452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1182 | Open in IMG/M |
3300028906|Ga0308309_10554350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 996 | Open in IMG/M |
3300028906|Ga0308309_11895856 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300029636|Ga0222749_10095027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1392 | Open in IMG/M |
3300029636|Ga0222749_10150018 | Not Available | 1135 | Open in IMG/M |
3300029636|Ga0222749_10456340 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300029636|Ga0222749_10582764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
3300029636|Ga0222749_10838365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
3300031122|Ga0170822_14919256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
3300031128|Ga0170823_11518348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
3300031231|Ga0170824_109364106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300031231|Ga0170824_120754068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
3300031543|Ga0318516_10078958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1835 | Open in IMG/M |
3300031543|Ga0318516_10436031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
3300031544|Ga0318534_10154385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1325 | Open in IMG/M |
3300031545|Ga0318541_10006098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5123 | Open in IMG/M |
3300031545|Ga0318541_10079332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1734 | Open in IMG/M |
3300031545|Ga0318541_10192394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1128 | Open in IMG/M |
3300031545|Ga0318541_10681196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 574 | Open in IMG/M |
3300031546|Ga0318538_10113465 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
3300031546|Ga0318538_10406753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
3300031546|Ga0318538_10448310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
3300031564|Ga0318573_10010634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3870 | Open in IMG/M |
3300031564|Ga0318573_10068691 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
3300031564|Ga0318573_10139479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1267 | Open in IMG/M |
3300031572|Ga0318515_10205162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1057 | Open in IMG/M |
3300031573|Ga0310915_10045167 | All Organisms → cellular organisms → Bacteria | 2823 | Open in IMG/M |
3300031573|Ga0310915_10745152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
3300031573|Ga0310915_10831279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
3300031573|Ga0310915_11030658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
3300031668|Ga0318542_10013366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3187 | Open in IMG/M |
3300031668|Ga0318542_10055679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1810 | Open in IMG/M |
3300031679|Ga0318561_10055919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1988 | Open in IMG/M |
3300031679|Ga0318561_10556774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
3300031680|Ga0318574_10516335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
3300031708|Ga0310686_104823569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1332 | Open in IMG/M |
3300031708|Ga0310686_115515157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1634 | Open in IMG/M |
3300031715|Ga0307476_10616285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 805 | Open in IMG/M |
3300031719|Ga0306917_10054017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2716 | Open in IMG/M |
3300031723|Ga0318493_10840885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
3300031736|Ga0318501_10871638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
3300031744|Ga0306918_10490539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
3300031744|Ga0306918_10987605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 654 | Open in IMG/M |
3300031747|Ga0318502_10050327 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
3300031747|Ga0318502_10193823 | Not Available | 1173 | Open in IMG/M |
3300031751|Ga0318494_10233199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1053 | Open in IMG/M |
3300031751|Ga0318494_10957875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
3300031753|Ga0307477_10534963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 794 | Open in IMG/M |
3300031754|Ga0307475_11273720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
3300031754|Ga0307475_11278830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
3300031763|Ga0318537_10103528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 1055 | Open in IMG/M |
3300031763|Ga0318537_10294125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
3300031763|Ga0318537_10370465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 528 | Open in IMG/M |
3300031768|Ga0318509_10044759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2232 | Open in IMG/M |
3300031768|Ga0318509_10724205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
3300031771|Ga0318546_10427663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 926 | Open in IMG/M |
3300031771|Ga0318546_10448460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
3300031771|Ga0318546_10851765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 642 | Open in IMG/M |
3300031771|Ga0318546_11332220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300031771|Ga0318546_11346594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300031778|Ga0318498_10045350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1941 | Open in IMG/M |
3300031778|Ga0318498_10455305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
3300031782|Ga0318552_10195442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1023 | Open in IMG/M |
3300031782|Ga0318552_10703520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
3300031795|Ga0318557_10509780 | Not Available | 552 | Open in IMG/M |
3300031796|Ga0318576_10485620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
3300031797|Ga0318550_10015768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3026 | Open in IMG/M |
3300031797|Ga0318550_10177361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1028 | Open in IMG/M |
3300031797|Ga0318550_10617309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
3300031798|Ga0318523_10033251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2351 | Open in IMG/M |
3300031805|Ga0318497_10130848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1364 | Open in IMG/M |
3300031805|Ga0318497_10131033 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300031819|Ga0318568_10353658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 914 | Open in IMG/M |
3300031820|Ga0307473_10475986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 838 | Open in IMG/M |
3300031820|Ga0307473_11195776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
3300031820|Ga0307473_11385077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
3300031821|Ga0318567_10080127 | Not Available | 1739 | Open in IMG/M |
3300031831|Ga0318564_10538288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300031833|Ga0310917_11212982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae | 501 | Open in IMG/M |
3300031835|Ga0318517_10008017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3659 | Open in IMG/M |
3300031835|Ga0318517_10176661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 959 | Open in IMG/M |
3300031879|Ga0306919_10540283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 899 | Open in IMG/M |
3300031879|Ga0306919_11104621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
3300031890|Ga0306925_11124529 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300031890|Ga0306925_11205221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
3300031890|Ga0306925_12058608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
3300031894|Ga0318522_10197131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
3300031896|Ga0318551_10919230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
3300031897|Ga0318520_10805416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
3300031897|Ga0318520_11046617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300031897|Ga0318520_11078914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
3300031910|Ga0306923_11621377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
3300031910|Ga0306923_12446724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
3300031912|Ga0306921_10811271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1068 | Open in IMG/M |
3300031912|Ga0306921_10838945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1047 | Open in IMG/M |
3300031912|Ga0306921_11106848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 887 | Open in IMG/M |
3300031941|Ga0310912_10977139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
3300031941|Ga0310912_10996952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
3300031942|Ga0310916_10466235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1076 | Open in IMG/M |
3300031945|Ga0310913_10552944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 817 | Open in IMG/M |
3300031945|Ga0310913_11088968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
3300031945|Ga0310913_11216128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
3300031946|Ga0310910_11170848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
3300031946|Ga0310910_11358144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
3300031946|Ga0310910_11418430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
3300031946|Ga0310910_11504129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
3300031947|Ga0310909_10648951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
3300031954|Ga0306926_10095242 | All Organisms → cellular organisms → Bacteria | 3644 | Open in IMG/M |
3300031954|Ga0306926_11198964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
3300031954|Ga0306926_12451482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
3300031959|Ga0318530_10172156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 884 | Open in IMG/M |
3300031962|Ga0307479_10895802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
3300031981|Ga0318531_10157103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
3300032001|Ga0306922_10320530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1664 | Open in IMG/M |
3300032001|Ga0306922_11603023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
3300032001|Ga0306922_12208597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
3300032025|Ga0318507_10412720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
3300032035|Ga0310911_10027514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2807 | Open in IMG/M |
3300032035|Ga0310911_10099538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1593 | Open in IMG/M |
3300032035|Ga0310911_10680882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
3300032039|Ga0318559_10506606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
3300032042|Ga0318545_10228358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
3300032043|Ga0318556_10154448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1185 | Open in IMG/M |
3300032052|Ga0318506_10128686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1099 | Open in IMG/M |
3300032055|Ga0318575_10504152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 614 | Open in IMG/M |
3300032059|Ga0318533_11181336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
3300032063|Ga0318504_10156613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1051 | Open in IMG/M |
3300032063|Ga0318504_10201446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 929 | Open in IMG/M |
3300032064|Ga0318510_10070476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1281 | Open in IMG/M |
3300032066|Ga0318514_10746742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300032076|Ga0306924_10357195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1675 | Open in IMG/M |
3300032076|Ga0306924_11276152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
3300032076|Ga0306924_11802200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
3300032076|Ga0306924_12077658 | Not Available | 583 | Open in IMG/M |
3300032090|Ga0318518_10081301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1594 | Open in IMG/M |
3300032091|Ga0318577_10405175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
3300032094|Ga0318540_10511795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
3300032261|Ga0306920_100523429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 1759 | Open in IMG/M |
3300032261|Ga0306920_100848332 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
3300032261|Ga0306920_101088995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1159 | Open in IMG/M |
3300032261|Ga0306920_101150354 | Not Available | 1123 | Open in IMG/M |
3300032261|Ga0306920_103708863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
3300032515|Ga0348332_10468350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 671 | Open in IMG/M |
3300032955|Ga0335076_10671428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
3300033289|Ga0310914_10237558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 1635 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.04% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.16% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.31% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.33% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.57% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.18% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.18% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.39% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.39% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.39% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.20% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.20% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.20% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.20% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.20% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.20% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.20% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.20% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027065 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF006 (SPAdes) | Environmental | Open in IMG/M |
3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12053J15887_105276953 | 3300001661 | Forest Soil | PVSGQWHPRMPERLDEEELADWRAGRSAVYQLAALTIGARLAVADA* |
JGIcombinedJ26739_1010045121 | 3300002245 | Forest Soil | QIPERLDEEELADWQAGRNAVYQLAALTIGARLAVADA* |
JGIcombinedJ26739_1017085571 | 3300002245 | Forest Soil | RPVPGEWQPHIPERLDEEELADWRAGRNALYQLAALTIGVRLAVADL* |
JGIcombinedJ26739_1018789312 | 3300002245 | Forest Soil | VPGEWHPRMPERLDEEELADWRAARNAVYRLAALTIGARLAVADV* |
C688J35102_1195440613 | 3300002568 | Soil | GEWRPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
JGI26341J46601_100267132 | 3300003219 | Bog Forest Soil | MDGHPRMPERLDEEELADWHAGRNAVYQLAALTIGARLAVAHA* |
JGI26343J46809_10008231 | 3300003223 | Bog Forest Soil | MEGHPRMPERLDEEELADWHAGRNAVHQLAALTIGARLAVAHA* |
JGIcombinedJ51221_103980311 | 3300003505 | Forest Soil | EPGKWYLLMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADS* |
Ga0062387_1001001864 | 3300004091 | Bog Forest Soil | VIRPVAGEWHPRMPESLDEEELADWRAGRNALYQLAALTIGARLAVADG* |
Ga0062387_1003284032 | 3300004091 | Bog Forest Soil | VIRPIPGEWHPRIPERLDDAELADWRAGRNAVYQLAALTIGARLAVADL* |
Ga0062387_1004172682 | 3300004091 | Bog Forest Soil | PRMPEQLDEEELADWRAGRDAVYQLAALTIGARLAVADA* |
Ga0062389_1002306872 | 3300004092 | Bog Forest Soil | VIRPEPGEWHPRMPERLDEEELADWRAGRNAVYQLAALMIGARLAVADG* |
Ga0062389_1017450291 | 3300004092 | Bog Forest Soil | VIRPVPGEWHPRMPEQLDEEELADWRAGRDAVYQLAALTIGARLAVADA* |
Ga0062386_1012508171 | 3300004152 | Bog Forest Soil | VIRPEPGEWHPRMPERLDGEELADWRAGRDAVYQLAALTVGARLAVARIAAREAAG* |
Ga0062388_1001280193 | 3300004635 | Bog Forest Soil | VAGEWHPRMPESLDEEELADWRAGRNALYQLAALTIGARLAVADG* |
Ga0062388_1026470582 | 3300004635 | Bog Forest Soil | WHPCMPERLDDEELADWRAGRDAVYQLAALTVGARLAVADA* |
Ga0066672_106406042 | 3300005167 | Soil | PRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADG* |
Ga0066684_101491083 | 3300005179 | Soil | VIRPDPREWHPRMPDRLDQEELADWRAGRDAVYQLAALTAGARLGVS* |
Ga0066388_1004158882 | 3300005332 | Tropical Forest Soil | WYPRMPERLDMQELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0066388_1057991512 | 3300005332 | Tropical Forest Soil | VMGEWQPHMPKSLDEEELADWRAGRNAVYQLAALTIGARLAVADG* |
Ga0070714_1012468171 | 3300005435 | Agricultural Soil | VIRPDPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADE* |
Ga0070713_1002991291 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GEWQPRMPERLDEEELADWRTGRNAIYQLAALTIGARLAVADA* |
Ga0070711_1009438052 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRPDPGEWHPRMPERLDEEELADLRAGRDAIYQLAALMVGGRLVVADG* |
Ga0070711_1020583982 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRPDPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADA* |
Ga0070698_1010016523 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PRMPERLDEEELADWRTGRNAVYQLAALTIGARLAVADA* |
Ga0070697_1011543061 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PRMPEQLDEEELADWRAGRNAVYQLAALTVGARLAVADG* |
Ga0066697_107232411 | 3300005540 | Soil | MPERLDDEELADWRASRNAIYQLTALTIGARLAVADA* |
Ga0070696_1007532902 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PGEWHPHMPAQLDEEELADWRAGRAAVYQLAALTIGARLAVAEA* |
Ga0066703_104584142 | 3300005568 | Soil | MPERLDEAELADWRAGRNAVYQLVALTLGARLAVADA* |
Ga0070762_100518993 | 3300005602 | Soil | MARMPERLDEEELADWRAGRNAVYQLAALTVGSRLAVADA* |
Ga0070762_103500693 | 3300005602 | Soil | RMPERLDEEELADWRAGRNAIYQLAALTIGTRLAVADA* |
Ga0070762_108632452 | 3300005602 | Soil | RMPERLDEDELADWRAGRNAVYQLAALTIGARLAVADG* |
Ga0070762_111285502 | 3300005602 | Soil | MPERLDEEELADRRAGRDAVYQLAALAIGARLAVADA* |
Ga0070763_106068602 | 3300005610 | Soil | MARMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADA* |
Ga0066903_1067124332 | 3300005764 | Tropical Forest Soil | RLDEEELADWRAGRNAVYQLAALTIGARLAVADS* |
Ga0070766_102476623 | 3300005921 | Soil | MPERLDEEELADWRAGRNAVYQLAARTVGARLAVADA* |
Ga0070717_100133495 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPPVPGEWHPRTPERVDEKELADWRGGRNAVYQLATLTVGARLANA* |
Ga0070715_102390481 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRPVPGEWYPRMPEHLDEEDLADWRAGRDAVYQLAALTIGARLALAEA* |
Ga0070712_1000967351 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QLDEEELADWRAGRNTIYQLAALAVGARLAVADA* |
Ga0070712_1003230861 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRPDPGEWHPRMPERLDEEELADLRAGRDAIYQLAALTVGGRLVVADG* |
Ga0070712_1015999111 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PDPGEWHPRMPERLDEAELADWRAGRDAIYQLAALTVGARLAVAD* |
Ga0070712_1017917421 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRPDPGEWHPRMPERLDEEELADWRAGRNAVYQLAARTVGARLAVADA* |
Ga0070712_1018023242 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ERLDEDELADWQAGRNGVYQLAALTIGARLAVADA* |
Ga0070765_1002876752 | 3300006176 | Soil | MAPRMPERLDEEELADWRAGRNAVYQLAALTMGARLVVADA* |
Ga0070765_1006885482 | 3300006176 | Soil | MSQSLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0070765_1008939242 | 3300006176 | Soil | MPERLDEEELADRRAGRNSVYQLAALTVDAPLAVAELISRA* |
Ga0070765_1009331622 | 3300006176 | Soil | MPERLDEEELADWRAGRNAVYQIAALTIGAPVAVADG* |
Ga0070765_1011754532 | 3300006176 | Soil | MPARLDEEELADWRAGRNAVYQLAALTIDTRLAVADA* |
Ga0079222_108203473 | 3300006755 | Agricultural Soil | DPGAVIRPDPGEWHPRMPERLDEEELADWRGGRNAVYQFAALTVGARLAAADA* |
Ga0066665_109809862 | 3300006796 | Soil | ACVSRMPERLDDEELADWRVGLNAVYQLAALTVSARLAVADA* |
Ga0066660_110183281 | 3300006800 | Soil | MASRMPERLDEEELADWRADRNPVYQLAALTVGARLGGLGR |
Ga0079220_117846101 | 3300006806 | Agricultural Soil | PERLDEEELADWRAGRNAVYQLAALTVGARLAVADA* |
Ga0079220_121373572 | 3300006806 | Agricultural Soil | SEPGEWHPYMPKRLDDQELADWRTGRNAVYQLAALTVGARLAVADG* |
Ga0075428_1018171791 | 3300006844 | Populus Rhizosphere | TVIRPIPGEWHPHMPAQLDEEELADWRAGRAAVYQLAALTIGARLAVAEA* |
Ga0075425_1026703492 | 3300006854 | Populus Rhizosphere | RLDDEELADWRAGRNAIYQLAALTIGARLAVADG* |
Ga0075424_1026050242 | 3300006904 | Populus Rhizosphere | VIQAVPGEWHPRMPEQLSEDELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0099791_105168661 | 3300007255 | Vadose Zone Soil | MPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0099793_103354321 | 3300007258 | Vadose Zone Soil | RMPKRLEEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0099829_104781531 | 3300009038 | Vadose Zone Soil | EWRPRMPERLDEDELADWRAGRNAVYQLAALTIGARLAIADA* |
Ga0099829_110947961 | 3300009038 | Vadose Zone Soil | EWDPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADV* |
Ga0099830_108837242 | 3300009088 | Vadose Zone Soil | RSEVTNKKGDIPGKWQPRTPERLEEEELADWHAGRDALYQLAALTIGARLAIADA* |
Ga0099830_115888842 | 3300009088 | Vadose Zone Soil | MPERLDEEELADWRAGRNAVYQLAALTIGARLVVADA* |
Ga0099827_104323362 | 3300009090 | Vadose Zone Soil | MPERRDEEELADWQAGRDAVYQLAALTIGARLAVADA* |
Ga0099792_105172541 | 3300009143 | Vadose Zone Soil | EWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0111538_125290491 | 3300009156 | Populus Rhizosphere | PGEWQPHMPARLDEEELADWRAGRATVYHLAALTVNARLAVADG* |
Ga0075423_123608981 | 3300009162 | Populus Rhizosphere | RLDDDELADWRVGRNALYQLAALTIGARLGVADG* |
Ga0126374_105846001 | 3300009792 | Tropical Forest Soil | MPDRLDEEELADWRAGRDAVYQLAALTVGARLAVADG* |
Ga0126382_112333612 | 3300010047 | Tropical Forest Soil | MPKRLDEEELADWRAGRNAVYQLAAHTIGARLAVADG* |
Ga0126373_102065872 | 3300010048 | Tropical Forest Soil | MPKRLDEEELADWRAGRNAVYQLAALTIGARLAVADS* |
Ga0126373_104829001 | 3300010048 | Tropical Forest Soil | LLVGLDENELADWRAGRNAVYQLAAPTLAPASRVADA* |
Ga0126373_105633841 | 3300010048 | Tropical Forest Soil | MPERLDEIELADWLAGRNAVYQLAALTIGARLAIADA* |
Ga0126373_106189692 | 3300010048 | Tropical Forest Soil | QPHVPGYLDEEELSNWLAGRNAVYQLAAITIGARLVVADG* |
Ga0126373_108814922 | 3300010048 | Tropical Forest Soil | WHPRMPERLDEKELADWRAGRDAVYQLAALTIGARLAVADG* |
Ga0126373_110131672 | 3300010048 | Tropical Forest Soil | RGEWHPHMPDRLDEKELADWRAGRDAVYQLAAHTIGARLAVATA* |
Ga0126373_110582244 | 3300010048 | Tropical Forest Soil | VIRPEPGDWHPYMPKRLEENELADWRAGRNAVYQLAALTVGARLAVADG* |
Ga0126373_116618001 | 3300010048 | Tropical Forest Soil | PRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0126373_124847621 | 3300010048 | Tropical Forest Soil | PHMPTSLDEEELADWRAGRNAVYQLAAHTIGARLAVADG* |
Ga0126373_131173032 | 3300010048 | Tropical Forest Soil | GAVIRPTLGKWQPHIPERLEKEELADWLAGRNAVYQLAAMTIGARLAVADA* |
Ga0126373_132826782 | 3300010048 | Tropical Forest Soil | VIRPVLGEWHPRMPERLDDDEELADWRAGRDAVYQLAALTIGTRLAVADE* |
Ga0126318_108695313 | 3300010152 | Soil | MRRPALPIPERLEEEELTDWRVGRNAIYQLAALMIGARLAVTDA* |
Ga0099796_104214831 | 3300010159 | Vadose Zone Soil | MPEQLDEEELADWRAGRNAVYQLAALTVGARLAVADG* |
Ga0099796_105459631 | 3300010159 | Vadose Zone Soil | MPERLDEEELADWRAGRNAVYQLAALTVGARLAVADA* |
Ga0134088_103881902 | 3300010304 | Grasslands Soil | MPTRLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0134063_105607043 | 3300010335 | Grasslands Soil | RMPERLDEDELADWRAGRDAVYQLAALTVGARLAVADG* |
Ga0074046_100320379 | 3300010339 | Bog Forest Soil | MPERLDEEELADWHAGRNAVYQLAALTIGARLAVAHA* |
Ga0074046_101257934 | 3300010339 | Bog Forest Soil | PERLDEEELADWRAGRNAVYQLAALTIGARLTVADA* |
Ga0074044_100400693 | 3300010343 | Bog Forest Soil | MPERLDEEELEDWQAGRNAVYQLAALTIGARLAVADA* |
Ga0074044_101175971 | 3300010343 | Bog Forest Soil | IRPVPGEWHPRLPERLDEEELADWRAGRNAVYQLAALTIGARLAVADG* |
Ga0074044_103304762 | 3300010343 | Bog Forest Soil | RIPERLDEEELADWRAGRNAVYQLAALTIGARLTVADA* |
Ga0074044_111392681 | 3300010343 | Bog Forest Soil | MEGHPRMPERLDEEELADWHAGRNAVYQAAALTIGARLAVAHA* |
Ga0126370_123786471 | 3300010358 | Tropical Forest Soil | KSLDEEELADSRAGRNAVYQLAAHTIGARLAVADG* |
Ga0126372_116038793 | 3300010360 | Tropical Forest Soil | MPERLDEEELADWRAGRDALYQLVAVTIGARLAVADG* |
Ga0126372_123592851 | 3300010360 | Tropical Forest Soil | ERLDEEELADWRAGCDAVYQLAALTVGARLAVADG* |
Ga0126378_102068892 | 3300010361 | Tropical Forest Soil | MTDPPQEELGDWRAGRDAIYQLAALTIGARLGVADG* |
Ga0126378_106926322 | 3300010361 | Tropical Forest Soil | MPERLDENELSDWRAGRNAVYQLVALTSGARLAVADA* |
Ga0126378_111148602 | 3300010361 | Tropical Forest Soil | MPKRLDEEELADWRAGRNAIYQLAALTIGSRLAVADA* |
Ga0126378_114775281 | 3300010361 | Tropical Forest Soil | PVPGECHPRMPERLDENELADWHAGRNAVYQLAALTIGTRLAVADA* |
Ga0126378_120340662 | 3300010361 | Tropical Forest Soil | NIPERLDERELADWRAGRNAIYQLAALTVGARLAVADV* |
Ga0126378_125533983 | 3300010361 | Tropical Forest Soil | GEWQPHMPKSLDEEELADSRAGRNAVYQLAAHTIGVRLAVADG* |
Ga0126378_128813512 | 3300010361 | Tropical Forest Soil | MPQRLDEEELADWCAGRNAVYQLAALTIGARIAVVDA* |
Ga0126378_130430101 | 3300010361 | Tropical Forest Soil | HLDKEELADWLAGRNAVYQLAAMTIGTRLAVADA* |
Ga0126379_112608921 | 3300010366 | Tropical Forest Soil | MPWHLDEGELADWRAGRNAVYQLAALTIGARLAVADG* |
Ga0126379_114787741 | 3300010366 | Tropical Forest Soil | ERLDEAELADSRAGRNAVYQLAALTIGARLAVADG* |
Ga0126379_119966411 | 3300010366 | Tropical Forest Soil | KRLAEEELADWRAGRNAIYQLAALTIGARLAVADA* |
Ga0126379_136398671 | 3300010366 | Tropical Forest Soil | MPQRLDEEELADWRTGRNAVYQLAALTIGTRLAVADA* |
Ga0126381_1003548992 | 3300010376 | Tropical Forest Soil | MPKRLDEEELADWRAGRNAIYQLAALTVGARLAVADA* |
Ga0126381_1006215821 | 3300010376 | Tropical Forest Soil | WHPRIPERLDEEGLADWRAGRDAVYQLAALTVGARLAVADR* |
Ga0126381_1013260761 | 3300010376 | Tropical Forest Soil | MPERLDKNELADWRAGRNAVYQLAALTIGARLAVADT* |
Ga0126381_1014280652 | 3300010376 | Tropical Forest Soil | MPERLDEQELADWRDGRDAVYQLAALTIGARLAVAEA* |
Ga0126381_1016944142 | 3300010376 | Tropical Forest Soil | NCLPDRLDEEELADWRAGRDAIYQLAALTVGALLAVADG* |
Ga0126381_1018049072 | 3300010376 | Tropical Forest Soil | ERLDEQELADWRAGRDALYQLAALTIGARLAVVDA* |
Ga0126381_1024040682 | 3300010376 | Tropical Forest Soil | SRYRHPGWHPRMPERLAEQELADWRAGRSAVYQLAALTIGARFVVA* |
Ga0126381_1031119541 | 3300010376 | Tropical Forest Soil | MPERLDEEELADWRAGRAAVYQLAALTIGARLAVADG* |
Ga0126381_1031588951 | 3300010376 | Tropical Forest Soil | MPERLDDEELADWLAGRNAVYQLAALTIGTRLAIADA* |
Ga0126381_1032442122 | 3300010376 | Tropical Forest Soil | MPERLNEKELADLCACRNAVYQLAELPIGARLAVA* |
Ga0126381_1034373091 | 3300010376 | Tropical Forest Soil | RLDEEELADWRAGRDAVYQLAALTVGTRLAVADG* |
Ga0126381_1040202821 | 3300010376 | Tropical Forest Soil | MIIRPEPGEWHPRMPERLDEEELADWRAGRNAIYQLAALTICARVAVADA* |
Ga0126381_1040616421 | 3300010376 | Tropical Forest Soil | VIGPVMGEWQPHMPKSLDEEELADSRAGRNAVYQLAAHTIGARLTVADG* |
Ga0126381_1041955111 | 3300010376 | Tropical Forest Soil | QPRIPDRLDEGELADWRVGRDAVYQLAALTIGVRLAVADG* |
Ga0126381_1050488901 | 3300010376 | Tropical Forest Soil | PGAVIRPAAGEWHPRMPERLDREELADWRAGRNAVYQLAALTIGARLAVADT* |
Ga0126381_1051410512 | 3300010376 | Tropical Forest Soil | MPERLDELELADWRAARDAIYQLAAMTVGARLAVADS* |
Ga0126383_113250683 | 3300010398 | Tropical Forest Soil | AGEWQLHLPERLDEEELSDWRAGRNAVYQLAALTIGARLAVADG* |
Ga0126383_113413462 | 3300010398 | Tropical Forest Soil | LRAQGGQNPKRLDEEELADWRAGRNAIYQLAALTIGARLAVADA* |
Ga0126383_134958072 | 3300010398 | Tropical Forest Soil | WQPHMPKSLDEEELADWRTGRNAVYQLAAHTIGARLAVADG* |
Ga0126383_135147081 | 3300010398 | Tropical Forest Soil | SLDEEELADWRAGRNAVYQLVAHTIGARLAVADG* |
Ga0150983_159031862 | 3300011120 | Forest Soil | WHPRMPERLDEEELADWRPGRDAVYQLAALTIGARLAVADA* |
Ga0137391_103497052 | 3300011270 | Vadose Zone Soil | MPERLDEEELADWRTGRNAVYQLAALTIGARLAVADA* |
Ga0137391_111186562 | 3300011270 | Vadose Zone Soil | MRFHCEIKASDVDGEWQPRMSERLDEEELADWRAGRDAVYQLAALKIGARLGVADA* |
Ga0137393_101729631 | 3300011271 | Vadose Zone Soil | PGQWRPRMPERLDEEELADWHAGRNAVYQLAALTIGARLAVADA* |
Ga0137393_112299032 | 3300011271 | Vadose Zone Soil | PGEWQPRMPERLDEDELADWRAGRDAVYQLAALTIGARLAVADA* |
Ga0137389_107892682 | 3300012096 | Vadose Zone Soil | IRPVPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0137389_108900161 | 3300012096 | Vadose Zone Soil | AVIRPIRGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADG* |
Ga0137389_111488401 | 3300012096 | Vadose Zone Soil | PGEWHPRMPERLDEEELADWRSGRNAVYQLAALAIGARLAVADA* |
Ga0137389_116164041 | 3300012096 | Vadose Zone Soil | RARSGDELADWRSGRDAVYQLAALTIGARLAAAEA* |
Ga0137388_114141872 | 3300012189 | Vadose Zone Soil | MPERLDEEELADWRSGRNAFYQLAALAIGARLAVADA* |
Ga0137363_105180153 | 3300012202 | Vadose Zone Soil | LEYLDEEELADWRAGRNAVYQLAALTIGARLAVAEA* |
Ga0137363_117680061 | 3300012202 | Vadose Zone Soil | EWHRRMPERLDEEELADWHAGRNAVYQLAALTIGARLAVAGA* |
Ga0137399_108618122 | 3300012203 | Vadose Zone Soil | VVIQPESGQWHPRMPERLDEEERADWRAGRSAVYQLAALTIGARLAVAEA* |
Ga0137362_107887402 | 3300012205 | Vadose Zone Soil | WHPRMPERLDEEELADWRTGRNAVYQLAALTIGARLAVADA* |
Ga0137362_112673211 | 3300012205 | Vadose Zone Soil | AGEWHPRMPERLDDEELADWRAGRNAVYQLAPLTIGARLAVADV* |
Ga0137376_110402331 | 3300012208 | Vadose Zone Soil | MRLPVAGVWQPRMPERLDEEELADWRSGRNAVYQLAALTIGARIAVA |
Ga0137370_101130402 | 3300012285 | Vadose Zone Soil | MPERLDEEELADWRVDRDAIYQLAALTVGARLAVADG* |
Ga0137369_109291491 | 3300012355 | Vadose Zone Soil | VHAERLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0137360_108679142 | 3300012361 | Vadose Zone Soil | EWQPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0137360_113157171 | 3300012361 | Vadose Zone Soil | PVPGEWHPRMPERLDEEELADWRSGRNAVYQLAALTIGARFAVADA* |
Ga0137360_114820021 | 3300012361 | Vadose Zone Soil | MPERLDDEELADWRASRNAIYQLTALTISARLAVADA* |
Ga0137361_115438362 | 3300012362 | Vadose Zone Soil | MPEQVDEEEVADSRAGRNAIYQLAALTIGARLAVAEA* |
Ga0137390_101058904 | 3300012363 | Vadose Zone Soil | VIRPVPGQWHPRMPERLDEEELADWRAGRDAVYQLAALTIGARLAVADA* |
Ga0137390_102553332 | 3300012363 | Vadose Zone Soil | LPEQLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0137390_104732291 | 3300012363 | Vadose Zone Soil | PGEWHPRMPERLDEEELADWRAGRDAVYQLAALKIGARLGVADA* |
Ga0137358_102077951 | 3300012582 | Vadose Zone Soil | MPKRVPERLDEEELADWRAGRDAVYQLAALTIGARLAVADA* |
Ga0137358_104860392 | 3300012582 | Vadose Zone Soil | EWQPRRPERLDEEELADWRTGRNAVYQLAALTIGARLVVADA* |
Ga0137358_105481471 | 3300012582 | Vadose Zone Soil | EQLDEEELADWRAGRNTVYQLAALTIGARLAVADA* |
Ga0137398_102643162 | 3300012683 | Vadose Zone Soil | GEWQPRMPEQLDEEELADWRAGRDAVYQLAALTVGARLAVADG* |
Ga0137398_109478101 | 3300012683 | Vadose Zone Soil | MPERLDEDELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0137397_105591023 | 3300012685 | Vadose Zone Soil | MPEHLDEEELADWRAGRNAVYQLAALTIGARLAVA |
Ga0157285_102646232 | 3300012897 | Soil | MPAQLDEEELADWRAGRAAVYQLAALTIGARIAVAE |
Ga0137396_103225971 | 3300012918 | Vadose Zone Soil | PRMPERLDELADWRSGRNAVYQLAALTIGARLAVADA* |
Ga0137394_101868342 | 3300012922 | Vadose Zone Soil | PVPGEWHPRMPERLDEEELTDWRAGRNAVYQLAALTIGARLAGRVSH* |
Ga0137394_109991232 | 3300012922 | Vadose Zone Soil | PRMPERLDEEELADWRAGRNAVYQLAVLTIGARLAVADA* |
Ga0137359_103792391 | 3300012923 | Vadose Zone Soil | MPEQLDEEEVADWRAGRNAIYQLAALTIGARLAVAEA* |
Ga0137359_104908242 | 3300012923 | Vadose Zone Soil | MPERLDEEELADWRSGRDAVYQLAALTIGARLAVADA* |
Ga0137359_117956632 | 3300012923 | Vadose Zone Soil | RPVAGEWHPRMPQQLDEEELADWRAGRDAVYQLAALTVGARLAVADA* |
Ga0137413_113059842 | 3300012924 | Vadose Zone Soil | ARMPERLDEEELADWRAGCNAVYQLAALTVGARLAGGRMSRA* |
Ga0137413_115419472 | 3300012924 | Vadose Zone Soil | RLDEEELADWRAGRDAVYQLAALTIGARLAVADG* |
Ga0137419_112368082 | 3300012925 | Vadose Zone Soil | VIRPVAGEWDPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADG* |
Ga0137404_104898271 | 3300012929 | Vadose Zone Soil | AQLDEDELADWRAGRAAVYQFAALTIGSRIAVAEA* |
Ga0137410_108588022 | 3300012944 | Vadose Zone Soil | PGEWHPRMPERLDEEELADWQAGRNAVYQLAALTIGARLAVADA* |
Ga0137410_109412881 | 3300012944 | Vadose Zone Soil | RPHMPERLDEEELADWRAGRNAVYQLAALTLGTRLAVADA* |
Ga0137410_120818262 | 3300012944 | Vadose Zone Soil | EWRPHMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0126375_110210432 | 3300012948 | Tropical Forest Soil | MPESLDKNELADWRAGRNAVYQLAALTIGARLAVADT* |
Ga0164299_115434011 | 3300012958 | Soil | MPEHLDEEDLADWRAGRDAVYQLAALTIGARLALAEA* |
Ga0126369_102032673 | 3300012971 | Tropical Forest Soil | VIRPERGEWHPRMPERLDEEELADWREGRNAVYQLAALTIGARLGVADG* |
Ga0126369_111059451 | 3300012971 | Tropical Forest Soil | MPKRLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0126369_134895321 | 3300012971 | Tropical Forest Soil | AVIRAIPGEWHPRMPEQLDREELADWRAGRNAFYQLAALTIGARLAVADG* |
Ga0164309_107900052 | 3300012984 | Soil | VIRPDSGEWHPRMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADS* |
Ga0164309_113909431 | 3300012984 | Soil | HLDEEDLADWRAGRDAVYQLAALTIGARLALAEA* |
Ga0164305_103233212 | 3300012989 | Soil | MPERLDEEELADWRAGRNAVYQLAALTIGAPVAVADG* |
Ga0164305_118126991 | 3300012989 | Soil | VKYATTTAALLPERLDEEELADWRAGRNAVYQLAALTVGARLAVADA* |
Ga0137411_130774010 | 3300015052 | Vadose Zone Soil | MPERLDEAELADWRAGRNAVYQLAALTLGSRLAVADA* |
Ga0137420_14779985 | 3300015054 | Vadose Zone Soil | VIRPIRGEWQPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADG* |
Ga0137418_104236481 | 3300015241 | Vadose Zone Soil | MPERLDEEELADWRAGRNAVYQLAALTIGVRLAVADA* |
Ga0137412_101455415 | 3300015242 | Vadose Zone Soil | RLDEEELADWRAGRDAVYQLAALTIGARLAVADA* |
Ga0137409_113320331 | 3300015245 | Vadose Zone Soil | MPERLDKEELADWRAGRNAVYQLAALTLGTRLAVADA* |
Ga0134072_100542971 | 3300015357 | Grasslands Soil | HLDEEELADWRAGRNAVYQLAALTIGARLAVADA* |
Ga0132256_1017622841 | 3300015372 | Arabidopsis Rhizosphere | CISRMRERLDGEELADWHAGRNAVYQLAALTVGARLAVADT* |
Ga0132256_1020997202 | 3300015372 | Arabidopsis Rhizosphere | PDPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTVGARLTVADA* |
Ga0182036_100521265 | 3300016270 | Soil | RIPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0182036_109133641 | 3300016270 | Soil | HMPKSLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0182036_118122942 | 3300016270 | Soil | KRLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0182041_107592691 | 3300016294 | Soil | DPGEWLPRMPKRLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0182033_104171391 | 3300016319 | Soil | GEWHPRMPEQLDEEELADWRAGRDAVYQLAALTIGARLAVADVSRE |
Ga0182033_104271021 | 3300016319 | Soil | MPERLDEEELTDWRAGRNAIYQLAALTVGARLAVADA |
Ga0182033_112100391 | 3300016319 | Soil | LHIPERLDEEELADWRAGRNAIFQLAALTIGARLAIADA |
Ga0182033_118579401 | 3300016319 | Soil | ESLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0182035_103026143 | 3300016341 | Soil | MPDRLDEDELADWRSGRDAIYQLAALTVGARLAVA |
Ga0182035_106224381 | 3300016341 | Soil | PHMPDRLDEEELADWHAGRNAVYQLAALTLGSRLAVADG |
Ga0182034_103953941 | 3300016371 | Soil | EWHPRMPEQLDENELADWHAGRDAIFRLAALTVGARIAVADG |
Ga0182034_115058021 | 3300016371 | Soil | MPECLDEQELADWRAGRDAVYQLAALTIGARLAVADA |
Ga0182034_115306531 | 3300016371 | Soil | EWQPRMPESLDADELADWRAGRNAVYQLAALTIGTRLAVADG |
Ga0182040_101472852 | 3300016387 | Soil | VIRPIRGEWHPHMPDRLDENELADWRVGRDAVYQLAAHTIGARLAVAEG |
Ga0182040_107835952 | 3300016387 | Soil | VIRPDPGEWLPRMPKRLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0182040_109542711 | 3300016387 | Soil | RMPEQLDEEELADWRAGRNAFYQLAALTIGARLAVADA |
Ga0182037_104326042 | 3300016404 | Soil | IRGAWHPRMPERLDEEELSDWRAGRDAVYQLAALTICARLAVADG |
Ga0182037_107208021 | 3300016404 | Soil | MPECLDEEELADWRAGRNAVYQLAALTLGTRLAVADG |
Ga0182039_104228171 | 3300016422 | Soil | GEWHPRMPERLDELELADWRAGRDAIYQLAAVTVGARLAVADG |
Ga0182039_107158002 | 3300016422 | Soil | IRPDPGGWHPRMPERLEEDELADWRAGRDAIYQLAALTVGARLAVADG |
Ga0182039_113679411 | 3300016422 | Soil | YMPERLDEEELADWRAGRNAVYQLAALTVGARLAVAEG |
Ga0182039_118678132 | 3300016422 | Soil | SQILAIRGEWHPRMPERLDEEELADWRAGRAAVYQLAALTVGARLAVADG |
Ga0182038_114842742 | 3300016445 | Soil | RMPDRLDEEELADWRAGRDAIYQLAALTVGARLAVSDN |
Ga0182038_121303112 | 3300016445 | Soil | VMGEWQPHMPKSLDEEELADWRAGRNAVYQLAAHTIGARLVVADG |
Ga0187817_107261941 | 3300017955 | Freshwater Sediment | HMPERLDDEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0187782_111902782 | 3300017975 | Tropical Peatland | RPIRGEWHPHMPERLDEEELADWRAGRNAVYQLAALTIGARLAVTDG |
Ga0210407_100211405 | 3300020579 | Soil | MPKQLDEEELADWRAGRNTIYQLAALAVGARLAVADA |
Ga0210407_101895961 | 3300020579 | Soil | MAAAHAERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210407_102478402 | 3300020579 | Soil | VIRPDPGEWHPRMPERLDEEELADWRAGRNAVYQLAARTVGARLAVADA |
Ga0210407_108507612 | 3300020579 | Soil | VIRPDPGEWHPRMPKRLDEEELADWRAGRNAVYQLAARTGGARLAVADA |
Ga0210407_108526152 | 3300020579 | Soil | MARMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADA |
Ga0210407_110341181 | 3300020579 | Soil | MARPERLDEQELADWQAGRNAVYQLAVLTIGARLAVADA |
Ga0210407_111736551 | 3300020579 | Soil | WHPHMPEQLDDKELADWRAGRNAVYQLAALTIGARLADADA |
Ga0210407_113438181 | 3300020579 | Soil | HIPERLDEEELADWRAGRNALYQLAALTIGVRLAVADL |
Ga0210403_100102566 | 3300020580 | Soil | VIRPDPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADA |
Ga0210403_101027255 | 3300020580 | Soil | ARLDEEELADWRAGRNAIYQLAALTIGTRLAVADA |
Ga0210403_104390431 | 3300020580 | Soil | MARSERLDEQELADWQAGRNAVYQLAVLTIGARLAVADA |
Ga0210403_106793371 | 3300020580 | Soil | WGPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210403_110202232 | 3300020580 | Soil | LFLGEGDEELADWRAGRNAVYQLAGLTIGTRLAVADA |
Ga0210399_104398152 | 3300020581 | Soil | MPERLDEEELADWRAGRNAVCQLAALTVGARLAVADS |
Ga0210399_107987331 | 3300020581 | Soil | WHPRMPARLDEEELADWRAGRNAVYQLAALTIDARLAVADA |
Ga0210399_113721043 | 3300020581 | Soil | MPERLDEEELADWRAGRNAVYQLAALTVGARLAVADA |
Ga0210399_115275241 | 3300020581 | Soil | EHLDEEDLADWRAGRDAVYQLAALTIGARLALAEA |
Ga0210395_1000087314 | 3300020582 | Soil | MPERLDEEELADWRAGHNAVYQLAALTISTRLAVADV |
Ga0210395_103902253 | 3300020582 | Soil | MPERLDDEELADWRAGRNAVYQPAALTIGARLAVADA |
Ga0210395_108575512 | 3300020582 | Soil | HMPERLDDEELADWRAGRNAVYQPAALTIGARLAVADA |
Ga0210395_110215521 | 3300020582 | Soil | VKPELLDEEELADWRAGRNAVYQLAARTVGARLAVADE |
Ga0210401_100143259 | 3300020583 | Soil | MPERLDEEELADWRAGRNAVYQLAARTVGARLAVADA |
Ga0210401_104354822 | 3300020583 | Soil | MAPRMPERLDEEELADWRAGRNAVYQLAALTMGARLVVADA |
Ga0210401_104513132 | 3300020583 | Soil | MPEQLDDKELADWRAGRNAVYQLAALTIGARLADADA |
Ga0210401_106128743 | 3300020583 | Soil | MPARLDEEELADWRAGRNAVYQLAALTIDTRLAVADA |
Ga0210401_110184471 | 3300020583 | Soil | ERLDEEELADWRAGRNAVYQLAALTIGTRLAVADA |
Ga0210401_112220382 | 3300020583 | Soil | MPERLDEPELADWRAPAAMRVYRLAALTMGARLAVADT |
Ga0210401_113140792 | 3300020583 | Soil | MPEQLDEEELADWRAGRDAVYQLAALTIGTRLAVAEA |
Ga0210401_114734282 | 3300020583 | Soil | APLDEEKLADWRAGRNAIHQLAALTIGAPLAIADA |
Ga0210406_100892631 | 3300021168 | Soil | QPRMPEQLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210406_103581553 | 3300021168 | Soil | GEWHPRMPERLDEEELADWRAGRDAVYQLAALTVGARLAVADA |
Ga0210406_104059721 | 3300021168 | Soil | MLERLDEDELADWRADRNAVYQLAALTIGARLAVADA |
Ga0210406_104615642 | 3300021168 | Soil | MPERLDGEELADWRAGRNAVCQLAALTVGARLADA |
Ga0210406_105784752 | 3300021168 | Soil | VIRPAPGEWHPRMPEQLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210406_107665392 | 3300021168 | Soil | VIRPDPGEWHPRMPELLDEEELADWRAGRNAVYQLAARTVGARLA |
Ga0210406_109326582 | 3300021168 | Soil | MPERLDEEELADWRAGRNAVYQLAALTVGARLAVADE |
Ga0210400_113556632 | 3300021170 | Soil | MPEQLDEEELADWRTGRDAVYQMAARTIGARLAVADA |
Ga0210405_105588464 | 3300021171 | Soil | RNPVNGTRACPERLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0210405_106213211 | 3300021171 | Soil | RPRMPERLDEEELADWRAGRNAVYQLAALTIGARLVVADA |
Ga0210405_106800422 | 3300021171 | Soil | GEWHPRMPERLDDEELANWRAGRNAVYQLAALTVGERPAVADG |
Ga0210405_107475412 | 3300021171 | Soil | MRPLPGEWHPRMPERLDEEELADWRAGRNAVYQLALTIGARLAVADA |
Ga0210405_111232151 | 3300021171 | Soil | ERLDDEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210405_112670842 | 3300021171 | Soil | MPAQLDEEELADWRAGRNAIYQLASLTIGARLAVADA |
Ga0210405_112962651 | 3300021171 | Soil | EPGEWHPYMPKRLDDEELADWRAGRNAVYQLAALTVGTRLAVADG |
Ga0210408_100733585 | 3300021178 | Soil | QAGGDPGKWHPRMPARLDEEELADWRAGRNAVYQLAALTIDTRLAVADA |
Ga0210408_100851483 | 3300021178 | Soil | VIRPDPGEWHPRMPERLDEEELADWRAGRDAVYQLAALTVGARLAVADA |
Ga0210408_100971344 | 3300021178 | Soil | GEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210408_103288703 | 3300021178 | Soil | EWQPRMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADA |
Ga0210408_103794512 | 3300021178 | Soil | QIPERLDEQELADWQAGRNAVYQLAALTIGARLAVADA |
Ga0210408_106720991 | 3300021178 | Soil | WHPRMPERLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0210408_106746202 | 3300021178 | Soil | PRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVGDA |
Ga0210408_108265692 | 3300021178 | Soil | MPELLDEEELADWRAGRNAVYQLAARTVGARLAVADE |
Ga0210408_108322001 | 3300021178 | Soil | MARMPERPDEEELADWRAGRNAVYQLAALTVGARLAVADS |
Ga0210408_108521791 | 3300021178 | Soil | MPEQLDDKELADWRAGRNAVYQLAALTIGARLADA |
Ga0210408_108687762 | 3300021178 | Soil | MPERLDDEELADWRAGRDAVYQLAALTIGARLAVADA |
Ga0210408_111254181 | 3300021178 | Soil | MPERLDDGEPADRRAGRDASYRLVALTIVAGIAVADA |
Ga0210396_102248191 | 3300021180 | Soil | VIRPDPGEWHPRMPELLDEEELADWRAGRNAVYQLAARTVGAR |
Ga0210396_102638354 | 3300021180 | Soil | RPDPGEWHPRMPELLDEEELADWRAGRNAVYQLAARTVGARLAVADE |
Ga0210396_103107813 | 3300021180 | Soil | VIRPVAGEWHPRMPERLDDEELAHWRAGRNAVYQLAALTVGARLAVADG |
Ga0210396_106466263 | 3300021180 | Soil | PSMPERLDDEELADWRAGRNAVYQLAALTVGARFAVVDA |
Ga0213873_100861291 | 3300021358 | Rhizosphere | VPGEWHPHVPDRLNQEELAERRAGRNAVYQLAALTIGTCLAVADA |
Ga0210385_109186551 | 3300021402 | Soil | VIRPIPREWHPHMPEQLDDKELADWRAGRNAVYQLAALTIGARLADADA |
Ga0210397_109895201 | 3300021403 | Soil | VIRPDPGEWHPRMPELLDEEELADWRAGRNAVYQLAARTVGARLAVADE |
Ga0210397_110505481 | 3300021403 | Soil | MARMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADAVA |
Ga0210389_104379331 | 3300021404 | Soil | PELLDEEELADWRAGRNAVYQLAARTVGARLAVADE |
Ga0210387_103966273 | 3300021405 | Soil | TGEWQPRMPERLDDEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210387_106952482 | 3300021405 | Soil | VIRPDPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTGGA |
Ga0210387_114843921 | 3300021405 | Soil | MPEGLDEEELADWRAGRNALYQLAALTIGVRLAVADL |
Ga0210386_107633901 | 3300021406 | Soil | MPERLDDEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210386_109063381 | 3300021406 | Soil | VNGTRACPERLDEEELADWRAGRNAVYQLAALTIG |
Ga0210386_111363791 | 3300021406 | Soil | PKRLDDQELADWRTGRNAVYQLAALTVGARLAVADG |
Ga0210386_111755082 | 3300021406 | Soil | VNRTALGEWHPRMPERLDDEELANWRAGRNAVYQLAALTVGERPAVADG |
Ga0210383_112721901 | 3300021407 | Soil | MPERLDEEELADWHAGRNAVWQLAALTIGARLAVAHA |
Ga0210383_113482503 | 3300021407 | Soil | MPERLDEEELADWRAGRDAIYQLAALTVGVRLAVADG |
Ga0210383_116651062 | 3300021407 | Soil | MPERLDEEELADRRAGRDAVYQLAALAIGARLAVADA |
Ga0210394_108459531 | 3300021420 | Soil | PGEWHPRMPERLDEEELADWRTGRNAVYQLAALTIGARLAVADA |
Ga0210394_116954622 | 3300021420 | Soil | PVPGQWRPRMPERLDEDELADWRAGRDAVYQLAALTIGARLVVADA |
Ga0210384_101331221 | 3300021432 | Soil | PVAGEWQPRMPERLDDEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210384_108272631 | 3300021432 | Soil | PRKWYLLMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADS |
Ga0210384_113227111 | 3300021432 | Soil | MARMPERLDEEELADWRAGRNAVYQLAALTVGARLAVAD |
Ga0213878_100254733 | 3300021444 | Bulk Soil | QSVIRPVMGEWHPHIPERLDQTELADWRAGRDAVYQLAALTIGTRLAVADA |
Ga0213878_102559602 | 3300021444 | Bulk Soil | RPVMGEWQPHIPERLDETELADWRAGRDAVYQLAALTIGARLAVAEA |
Ga0213878_104546102 | 3300021444 | Bulk Soil | EWQPHIPARLDEEELEDWRAGRNAVYQLAALTIGARLAVANG |
Ga0210390_102552712 | 3300021474 | Soil | VIRPDPGEWHPRMPERLDEEELADWRAGRNAVYQLAARTVGARLAVADE |
Ga0210390_109923881 | 3300021474 | Soil | MAAAHAERLDEEELADWRAGRNAVYQLAALTIGARLAV |
Ga0210392_107424832 | 3300021475 | Soil | MPGRLDGEELADWRAGRNAVYRLATPTVGARLAVADA |
Ga0210392_113190551 | 3300021475 | Soil | PGEWQPRMPERLDEEELADWRAGRNAVYQLAALTIGTRLAVADA |
Ga0187846_101070583 | 3300021476 | Biofilm | AGEWHPRMPDRLDEEELADWRAGRDAVYQLAALTVGARLAVSDN |
Ga0210402_103829191 | 3300021478 | Soil | MPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210402_112355822 | 3300021478 | Soil | ERLDEGELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0210402_112902992 | 3300021478 | Soil | PERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210402_114670172 | 3300021478 | Soil | MPEHLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0210402_119122061 | 3300021478 | Soil | MPERLDEEELADWRAGRNAVYQLAALTIGAPVAVADG |
Ga0210410_106268802 | 3300021479 | Soil | MRPVPCEWHPHMPAQLDDEELADWRAGRAAVYQLAALTIGARIAVAEA |
Ga0210410_106668183 | 3300021479 | Soil | GEWHPRMPERLDEEELADWRAGRNAVYQFAALTVGARLAAADA |
Ga0210410_107237181 | 3300021479 | Soil | WLPHMPERLDEEELRDWRSGRDAVYQLAALTIGARLAVADA |
Ga0210410_113301391 | 3300021479 | Soil | ERLDEEELADWRAGRNAVYQLAARTVGARLAVADE |
Ga0210409_114781842 | 3300021559 | Soil | PRMPERLDDEELADWRAGRNAVYQLAALTVGARLAVADA |
Ga0210409_116587882 | 3300021559 | Soil | AHAERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0126371_109696462 | 3300021560 | Tropical Forest Soil | MPERLDEQELADWRAGRSAVYQLAALTIGARLVVA |
Ga0126371_109898531 | 3300021560 | Tropical Forest Soil | AVIRPVGEWQPHMPKSLDEDELGDWRAGRNAVYQLAALTIGARLAVADG |
Ga0126371_112888863 | 3300021560 | Tropical Forest Soil | VIGPVMGEWQPHMPKSLDEEELADSRAGRNAVYQLAAHTIGARLTVADG |
Ga0126371_124391771 | 3300021560 | Tropical Forest Soil | RMPERLDEEELADWRAGREAIYKLAALTVGARLAVADS |
Ga0126371_125093001 | 3300021560 | Tropical Forest Soil | RAAPGEWHPRMPERLDEDELADWLAGRNAIYQLAALTIGARLAVADA |
Ga0126371_125921541 | 3300021560 | Tropical Forest Soil | QPVLGQWEPSVPERLDEEELADWRAGRNAVYQLAALTLGARLAVADG |
Ga0126371_130411532 | 3300021560 | Tropical Forest Soil | EWHPRMRERLDENELADWRAGRNAVYQLAALTIGTRLAVADA |
Ga0126371_131137251 | 3300021560 | Tropical Forest Soil | WHPHMPQRLDEQELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0126371_133080322 | 3300021560 | Tropical Forest Soil | GEWQPRMPEQLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0126371_135439591 | 3300021560 | Tropical Forest Soil | IRPVTGEWHPRMPQHLDEEELADWRAGRDAIYQLAALTIGARLGVADG |
Ga0242648_10597552 | 3300022506 | Soil | GEWHPHTPEQLDEEELADWRAGRSALYQLAALTICARLAVVSLTDRKVTISHR |
Ga0242654_101593121 | 3300022726 | Soil | CMPERLDEEELADWRAGRDAIYQLAALTVGARLAVADG |
Ga0228598_11195891 | 3300024227 | Rhizosphere | GAVIRPILGEWHPRMPERLDDAELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0207699_113321082 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEHLDEEDLADWRAGRDAVYQLAALTIGARLALAE |
Ga0207684_104892791 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EWHPHMPERLDEEELADWRAGRNAVYQLAALTIGTRLAVADA |
Ga0207684_112724942 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEQLDEEEVADSRAGRNAIYQLAALTIGARLAVAEA |
Ga0207693_109342752 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RPEPGEWHPRMPERLDEEKLADWRAGRNAVYQFAALTIGARLAVADA |
Ga0207663_109390131 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRPDPGEWHPRMPERLDEEELADLRAGRDAIYQLAALMVGGRLVVADG |
Ga0207646_104510541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IRPVPGEWHPRTPERVDEKELADWRGGRNAVYQLATLTVGARLANA |
Ga0207646_105489642 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PEQLDEEELADWRAGRNAVYQLAALTVGARLAVADG |
Ga0207700_105809052 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MARMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADS |
Ga0207664_101779061 | 3300025929 | Agricultural Soil | MPEHLDEEELADWRAGRDAVYQLAALTIGARLALAEA |
Ga0207665_103046341 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRPDPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADE |
Ga0207698_122271942 | 3300026142 | Corn Rhizosphere | PGEWHPHMPAQLDEEELADWRAGRAAIYQLAALTVGARLAVAEA |
Ga0209648_102135172 | 3300026551 | Grasslands Soil | MASRMPERLDEEELADWRADRNAVYQLAALTVGARLAVSDA |
Ga0209648_102739712 | 3300026551 | Grasslands Soil | MPARLDEGELADWRAGRNAVYQLAALTLGARLAVADG |
Ga0209648_102890032 | 3300026551 | Grasslands Soil | EPGEWHPHIPERLDEEELADWRAGRNAVYQLAALTVGLRLAVADG |
Ga0209648_108453821 | 3300026551 | Grasslands Soil | LYAANGKPRMPEQLDEDELADWRAGRNALYQLAALTVGALLAVADG |
Ga0179593_11650743 | 3300026555 | Vadose Zone Soil | MPERLDEDELADWRSGRDAVYQLAALTIGARLAVADA |
Ga0179587_111915282 | 3300026557 | Vadose Zone Soil | MPERLHEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0208489_10001412 | 3300027065 | Forest Soil | MPERLDEEELADWRAGRNAVYQLAALPDGARLAVADA |
Ga0208603_10615251 | 3300027109 | Forest Soil | RPIPGEWHPHMPGQLDDEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0207948_10051163 | 3300027174 | Forest Soil | VIRPDPGEWHPRMPELLDEEELADWRAGRNAVYQLAARTVGARLAVADA |
Ga0209524_10106421 | 3300027521 | Forest Soil | MARMPERLDEEELADWRAGRNAVYQLAALTVGARL |
Ga0209008_10220252 | 3300027545 | Forest Soil | MPERLDEEELADRRAGRDAVYQTAALTIGARLAVADA |
Ga0209219_10192212 | 3300027565 | Forest Soil | QWRPRMPERLDEEELADWRAGRNALYQLAALTIGARLVVADA |
Ga0209527_10269332 | 3300027583 | Forest Soil | ALIRPVPGEWHPHMPGQLDDKELADWCAGRNAVYQLAALTIGARLAVADA |
Ga0209329_11190073 | 3300027605 | Forest Soil | ERLDEKELADWRTGRNAVYQLAALTIGARLAVADA |
Ga0209528_10213542 | 3300027610 | Forest Soil | PGQWRPRMPERLDEEELADWRAGRNAVYQLAALTIGARLVVADA |
Ga0209248_100068113 | 3300027729 | Bog Forest Soil | MEGHPRMPERLDEEELADWHAGRNAVYQPAALTIGARLAVAHA |
Ga0209448_100078481 | 3300027783 | Bog Forest Soil | MDGHPRMPERLDEEELADWHAGRNAVYQLAALTIGARLAVAHA |
Ga0209448_102070543 | 3300027783 | Bog Forest Soil | IRPVGGEWHPHIPERLDDEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0209040_100509443 | 3300027824 | Bog Forest Soil | MPEELDDEELADWLAGRNAVYQLAALTIGARLAVANT |
Ga0209040_100744335 | 3300027824 | Bog Forest Soil | GAVIRSVPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLTVADA |
Ga0209040_100756101 | 3300027824 | Bog Forest Soil | MPEQLDDEELADWLAGRNAVYQLAALTIGARLADA |
Ga0209773_101797781 | 3300027829 | Bog Forest Soil | PRMPERLDEEELADWRAGRNAVYQLAALTIGTRLKVADA |
Ga0209180_104598702 | 3300027846 | Vadose Zone Soil | AVIRPIRGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0209693_102384743 | 3300027855 | Soil | LIRPDPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTVGARLAVADA |
Ga0209380_100469614 | 3300027889 | Soil | MPQRLDEEELADWRAGRDAIYQLAALTIGARLVVADA |
Ga0209380_104099242 | 3300027889 | Soil | MPERVDEEELADWRAGRNAVYQLAALTIGTRLAVADA |
Ga0209526_101991423 | 3300028047 | Forest Soil | VIRPDPGEWHPRMPERLDEEELADWRAGRNGVYQLAALTVGARLAVADA |
Ga0209526_107468371 | 3300028047 | Forest Soil | GEWHRRIPERLDEEELADWRSGRNAVYQLAALTIRVRLAVADA |
Ga0137415_108296433 | 3300028536 | Vadose Zone Soil | MPQRLDEEEFADWPAGRNAVYQLAALTIGARLAVADA |
Ga0308309_103974522 | 3300028906 | Soil | VIRPGGILANGTPRMPARLDEEELADWRAGRNAVYQLAALTIDTRLAVADA |
Ga0308309_105543503 | 3300028906 | Soil | MPERLDEEELADWRAGRNAVYQIAALTIGAPVAVADG |
Ga0308309_118958561 | 3300028906 | Soil | MPERLDEEEPADWRAGRNAVYQLAALTTGTRLVVAEA |
Ga0222749_100950271 | 3300029636 | Soil | RPVPGEWHPHMPGQLDDEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0222749_101500181 | 3300029636 | Soil | PRMPERLDDKELADWRAGRNAIYQLAALTIGARLAVAEA |
Ga0222749_104563402 | 3300029636 | Soil | VNGTGACPERLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0222749_105827641 | 3300029636 | Soil | RIPERLDEEELADWRAGRNAVYQLAALTVGARLAVADA |
Ga0222749_108383653 | 3300029636 | Soil | MPERLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0170822_149192561 | 3300031122 | Forest Soil | GEWQPRMPEQLDEEELADWRAGRNAVYQLAALTIGARLAVADS |
Ga0170823_115183482 | 3300031128 | Forest Soil | MPERLDEEELADWRPGRNAVYQLAALTVGARLAVADA |
Ga0170824_1093641062 | 3300031231 | Forest Soil | LQSTNEELEIEEELADWRAGRDAIYQLAALTVGARLALAGV |
Ga0170824_1207540682 | 3300031231 | Forest Soil | MPEQLDEEELADWRAGRNAVYQLAALTIGARLAVADS |
Ga0318516_100789584 | 3300031543 | Soil | RVPEQLDENELADWHAGRDAIFRLAALTVGARIAVADG |
Ga0318516_104360311 | 3300031543 | Soil | MPDRFDEEKPSDWRAGRDAVYQLTADSIGARLAVADG |
Ga0318534_101543851 | 3300031544 | Soil | RPVPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADV |
Ga0318541_100060981 | 3300031545 | Soil | GEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLTVADA |
Ga0318541_100793324 | 3300031545 | Soil | MPDRLDETELADWRAGRDAVYQLAAHTIGARLAVADA |
Ga0318541_101923942 | 3300031545 | Soil | VIRPVLGEWQPRMPERLDEEELADWRAGRDAVYQLAALTIGARLAVADG |
Ga0318541_106811962 | 3300031545 | Soil | IRPVLGEWQPHMPDRLDEEELADWRTGRNAVYQLAALTIGARIAVADG |
Ga0318538_101134653 | 3300031546 | Soil | GQWQPRMPESLDADELADWRAGRNAVYQLAALTIGTRLAVADG |
Ga0318538_104067531 | 3300031546 | Soil | PVAGEWQPRMPDCLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0318538_104483101 | 3300031546 | Soil | EWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVVDA |
Ga0318573_100106341 | 3300031564 | Soil | PIRGEWQPHMPDRLDDEELADWRAGRNAVYQFAAVTIGARLAVADG |
Ga0318573_100686913 | 3300031564 | Soil | MPEQLDEEELADWRAGRDAVYQLAALTIGVPLAVADA |
Ga0318573_101394791 | 3300031564 | Soil | HMPERLDEEELADWRAGRNAVYQLAALTIGSRLAVADG |
Ga0318515_102051622 | 3300031572 | Soil | PEQLDENELADWHAGRDAIFRLAALTVGARIAVADG |
Ga0310915_100451673 | 3300031573 | Soil | VIRPEPGQWQPRMPESLDADELADWRAGRNAVYQLAALTIGTRLAVADG |
Ga0310915_107451521 | 3300031573 | Soil | MPDCLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0310915_108312792 | 3300031573 | Soil | AVIRPVMGEWQPHMPKSLDEEELADWRAGRNAVYQLAALTVGARLAVADG |
Ga0310915_110306581 | 3300031573 | Soil | VIRPVMGEWQPHMPKSLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0318542_100133662 | 3300031668 | Soil | MPDRLDEDELADWRSGRDAIYQLAALTVGARLAVADG |
Ga0318542_100556791 | 3300031668 | Soil | HMPDRLDENELADWRVGRDAVYQLAAHTIGARLAVAEG |
Ga0318561_100559191 | 3300031679 | Soil | PRIPERLDEEELADWRAGRNAVYQLAALTIGARLAVANA |
Ga0318561_105567742 | 3300031679 | Soil | VIRPVAGEWQPRMPDRLDEEELADWRAGRDAVYQLAALTIGARLAVADG |
Ga0318574_105163351 | 3300031680 | Soil | MPDRLDETELAEWRAGRDAVYQLAAHTIGARLAVADA |
Ga0310686_1048235691 | 3300031708 | Soil | RPILGEWHPRMPERLDDAELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0310686_1155151571 | 3300031708 | Soil | MRVNCGQIQPGAVVWPALGEWHPHIPERLDQEELGDRRASRDAIYQLAALMIGGHLVVAD |
Ga0307476_106162851 | 3300031715 | Hardwood Forest Soil | DPGEWHPRMPERLDEEELADWRAGRNAVYQFAALTVGARLAVADA |
Ga0306917_100540174 | 3300031719 | Soil | PRMPESLDADELADWRAGRNAVYQLAALTIGTRLAVADG |
Ga0318493_108408852 | 3300031723 | Soil | VVRPVLGEWQPHMPDRLDEDELADWRAGRNAVYQLAALTIGSRLAVADG |
Ga0318501_108716381 | 3300031736 | Soil | RIPERLDDEELADWRAGRNAVYQLAALTIGARLAVANA |
Ga0306918_104905392 | 3300031744 | Soil | HRPDRLDETELADWRAGRDAVYQLAAHTIGARLAVADA |
Ga0306918_109876051 | 3300031744 | Soil | HPRMPERLEEDELADWRAGRDAIYQLAALTIGTRLAVADG |
Ga0318502_100503274 | 3300031747 | Soil | MPERLDEEELADWRAGRNAVYQLAALTIGARLAVVDA |
Ga0318502_101938231 | 3300031747 | Soil | GCYCFGIPDRLDEDELADWRSGRDAIYQLAALTVGARLAVADG |
Ga0318494_102331991 | 3300031751 | Soil | PRGVIRPIRGEWHPHMPDRLDENELADWRVGRDAVYQLAAHTIGARLAVAEG |
Ga0318494_109578752 | 3300031751 | Soil | MPDRLDEEELADWRAGRDAVYQLAAPTIGARLAVADG |
Ga0307477_105349632 | 3300031753 | Hardwood Forest Soil | VIRPVPGEWQPRMPEQLDEEELADWRAGRDAVYQLAALTIGARLAVADG |
Ga0307475_112737202 | 3300031754 | Hardwood Forest Soil | PESLDDEELADWRAGRNAVYQLAALAIGARLAVADG |
Ga0307475_112788302 | 3300031754 | Hardwood Forest Soil | PEQLDEDELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0318537_101035281 | 3300031763 | Soil | ERLDEQELADWRAGRDALYQLAALTIGARLAVVDA |
Ga0318537_102941251 | 3300031763 | Soil | IRPVPGEWHPRIPERLDEEELADWRAGRNAVYQLAALTIGARLTVADA |
Ga0318537_103704651 | 3300031763 | Soil | PVPGEWHPRIPEHLDEEELGDWRAGRDAVYQLAALTIGARLAVADA |
Ga0318509_100447592 | 3300031768 | Soil | PESLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0318509_107242052 | 3300031768 | Soil | RMPERLEEDELADWRAGRDAIYQLAALTIGTRLAVADG |
Ga0318546_104276632 | 3300031771 | Soil | PVLGEWQPHMPDRLDEDELGDWRAGRNAVYQLAAHTIGARLAVADG |
Ga0318546_104484601 | 3300031771 | Soil | PERLDEEELADWRAGRNAVYQLAALTIGARLTVADA |
Ga0318546_108517652 | 3300031771 | Soil | PGEWHPRIPEHLDEEELGDWRAGRDAVYQLAALTIGARLAVADA |
Ga0318546_113322201 | 3300031771 | Soil | VIRPVAGEWQPHLPERLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0318546_113465942 | 3300031771 | Soil | AVIRPVAGEWQPRMPDCLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0318498_100453505 | 3300031778 | Soil | YPFMPDRLDEDELADWRSGRDAIYQLAALTVGARLAVADG |
Ga0318498_104553051 | 3300031778 | Soil | PIRREWHPHMPDRLDETELAEWRAGRDAVYQLAAHTIGARLAVADA |
Ga0318552_101954423 | 3300031782 | Soil | PRMPDCLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0318552_107035202 | 3300031782 | Soil | MPERLDEEELADWRAGRDAVYQLAALTIGARLAVVDA |
Ga0318557_105097801 | 3300031795 | Soil | MPARLDEETFADRRAGLDATYQLAALTLSARLAIADA |
Ga0318576_104856203 | 3300031796 | Soil | MPKHLDDEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0318550_100157681 | 3300031797 | Soil | VMRPVPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADV |
Ga0318550_101773612 | 3300031797 | Soil | RGRRLALDEDELADWRSGRDAIYQLAALTVGARLAVADG |
Ga0318550_106173091 | 3300031797 | Soil | EWRPYIPERLDEEELADWRVGRNAIYQLAALTIGARLAIADA |
Ga0318523_100332516 | 3300031798 | Soil | PVPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLTVADA |
Ga0318497_101308481 | 3300031805 | Soil | MPESLDEEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0318497_101310333 | 3300031805 | Soil | GSKVESDEQELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0318568_103536581 | 3300031819 | Soil | VLGEWRPHIPERLDEEELADWRAGRNAIYQLAALTIGARLAIADA |
Ga0307473_104759861 | 3300031820 | Hardwood Forest Soil | ACCVCSRMPERLDEEELADWRSGRKAVHQLAALTIGARIAVA |
Ga0307473_111957761 | 3300031820 | Hardwood Forest Soil | PRMPEQLDEEELADWRAGRNEVYQLAVLTIGARLAVADA |
Ga0307473_113850771 | 3300031820 | Hardwood Forest Soil | RMPERLDDEELADWRAGRDAVYQLAALTIGARLAVADA |
Ga0318567_100801271 | 3300031821 | Soil | EHLDEEELGDWRAGRDAVYQLAALTIGARLAVADA |
Ga0318564_105382882 | 3300031831 | Soil | HPHMPDRLDETELAEWRAGRDAVYQLAAHTIGARLAVADA |
Ga0310917_112129821 | 3300031833 | Soil | QPRMPESLDADELADWRAGRNAVYQLAALTIGTRLAVADG |
Ga0318517_100080175 | 3300031835 | Soil | MPERLDEEEFADRRAGLDATYQLAALTLSARLAIADA |
Ga0318517_101766613 | 3300031835 | Soil | RPEPGQWQPRMPESLDADELADWRAGRNAVYQLAALTIGTRLAVADG |
Ga0306919_105402831 | 3300031879 | Soil | VPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0306919_111046212 | 3300031879 | Soil | GEWQPHMPKSLDEEELADWRAGRNAVYQLAALTVGARLAVADG |
Ga0306925_111245291 | 3300031890 | Soil | DPGEWRPRMPERLDEDELADWRAGRDAIYQLAALTVGARLAVADG |
Ga0306925_112052212 | 3300031890 | Soil | PGEWHPRMPEHLDEEELADWCAGRNAVYQLAALTIGARLAVVDA |
Ga0306925_120586081 | 3300031890 | Soil | WHPRMPERLDEEELADWRAGRNAVYQLAALTIGTRLAVADA |
Ga0318522_101971312 | 3300031894 | Soil | PEPGEWHPRMPDRLDEEGLADWRAGRDAIYQLAALTVGARLAVSDN |
Ga0318551_109192301 | 3300031896 | Soil | LHIPERLDEEELADWRAGRNAIYQLAALTIGARLAIADA |
Ga0318520_108054162 | 3300031897 | Soil | MPKRLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0318520_110466171 | 3300031897 | Soil | HPRMPEHLDEEELADWCAGRNAVYQLAALTIGARLAVVDA |
Ga0318520_110789141 | 3300031897 | Soil | RIPERLDEEELADWRAGRNAVYQLAALTIGARLTVADA |
Ga0306923_116213772 | 3300031910 | Soil | WHPCMPKRLGEDELADWLAGRNAVYQLAALTIGARPAVADG |
Ga0306923_124467241 | 3300031910 | Soil | ERLDEEELSDWRAGRDAVYQLAALTICARLAVADG |
Ga0306921_108112711 | 3300031912 | Soil | MAAAVPGHLDEEELADWLAGRNAVYQLAAITIGARLAVADG |
Ga0306921_108389453 | 3300031912 | Soil | PRIPERLDEEELADWRAGRNAIYQLAALTIGARLAVADA |
Ga0306921_111068481 | 3300031912 | Soil | VIRPVLGKWQPHVPGRLDEAELADWLTGRNAVYQLAAMTIGARLTVADG |
Ga0310912_109771392 | 3300031941 | Soil | RGEWHPLMPDCLDEEELANWRAGRDAIYQLAALAIGARLAVSDN |
Ga0310912_109969521 | 3300031941 | Soil | EPRVPERLDEEELADWRAGRNAVYQLAALTIGSRLAVADA |
Ga0310916_104662353 | 3300031942 | Soil | DGLDEEELADWRAGRDAIYQVAALTVGARLAISDN |
Ga0310913_105529443 | 3300031945 | Soil | RMPEHLDEEELADWRAGRDAIYQLAALTIGARLGVADG |
Ga0310913_110889682 | 3300031945 | Soil | WQPRMPESLDADELADWRAGRNAVYQLAALTIGTRLAVADG |
Ga0310913_112161281 | 3300031945 | Soil | WLPRMPKRLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0310910_111708483 | 3300031946 | Soil | MPERLNEEELADWRAGRDAVYQLAALTIGARLAVADS |
Ga0310910_113581441 | 3300031946 | Soil | QPHGHLDEEELADWLAGRNAVYQLAAITIGARLAVADG |
Ga0310910_114184301 | 3300031946 | Soil | GAVIRPVVGEWHPRMPERLDEEELADWRAGRDAVYQLAALTIGTRLAVADG |
Ga0310910_115041292 | 3300031946 | Soil | QPRMPERLDEEELADWRAGRDAVYQLAALTIGARLAVADG |
Ga0310909_106489511 | 3300031947 | Soil | IRPEPGEWQPRMPKSLDADELADWRAGRNAVYQLAALTIGTRLAVADA |
Ga0306926_100952425 | 3300031954 | Soil | IRPDPGEWLPRMPKRLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0306926_111989642 | 3300031954 | Soil | MPERLDEEELADWRAGRNAVYQLAPLTIGARLAVADG |
Ga0306926_124514821 | 3300031954 | Soil | PEPGEWQPRMPESLDADELADWRAGRNAVYQLAALTIGTRLAVADG |
Ga0318530_101721562 | 3300031959 | Soil | VLGEWRPHIPERLDEEELADWRAGRNAIFQLAALTIGARLAIADA |
Ga0307479_108958021 | 3300031962 | Hardwood Forest Soil | RPIRVEWHPHMPKRLDEEELAGWRAGRNAVYQLAALTIGARLAVADG |
Ga0318531_101571031 | 3300031981 | Soil | AVIRPVPGEWHPRIPERLDEEELADWRAGRNAVYQLAALTIGARLTVADA |
Ga0306922_103205301 | 3300032001 | Soil | ARMPKRLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0306922_116030231 | 3300032001 | Soil | WHPRMPERLDEEELSDWRAGRDAVYQLAALTICARLAVADG |
Ga0306922_122085972 | 3300032001 | Soil | PRMPDRLDEEELADWRAGRDAIYQLAALTVGARLAISDN |
Ga0318507_104127201 | 3300032025 | Soil | RMPERLDEEELADWRAGRNAVYQLAALTIGARRAVVDAL |
Ga0310911_100275141 | 3300032035 | Soil | PGEWHPRMPERLDEEELADWRAGRDAIYQLAALTVGARLAVGDR |
Ga0310911_100995381 | 3300032035 | Soil | VIRPVPGEWHPRIPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0310911_106808821 | 3300032035 | Soil | RIPERLDEEELADWRAGRNAIYQLAALTIGARLAVADA |
Ga0318559_105066061 | 3300032039 | Soil | HMPERLDEEELADWRAGRNAIYQLAALTIGARLAVADG |
Ga0318545_102283581 | 3300032042 | Soil | EWYPRMPDRLDEDELADWRSGRDAIYQLAALTVGARLAVADG |
Ga0318556_101544481 | 3300032043 | Soil | PKRLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0318506_101286861 | 3300032052 | Soil | HMPQRLDEQELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0318575_105041521 | 3300032055 | Soil | HPHMPQRLDEQELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0318533_111813362 | 3300032059 | Soil | IRPVPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0318504_101566132 | 3300032063 | Soil | GEWLPRMPKRLDEEELADWRAGRDAVYQLAALTVGARLAVADG |
Ga0318504_102014461 | 3300032063 | Soil | VGEWQPRMPERLDEEELADWRAGRDAVYQLAALTIGARLAVADG |
Ga0318510_100704763 | 3300032064 | Soil | MPERLDEEELADWRAGRNAVYQLAALTIGSRLAVADG |
Ga0318514_107467422 | 3300032066 | Soil | EPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADA |
Ga0306924_103571952 | 3300032076 | Soil | PHMPKSLDEEELADWRAGRNAVYQLAALTVGARLAVADG |
Ga0306924_112761521 | 3300032076 | Soil | PVTGEWHPRMPEHLDEEELADWRAGRDAIYQLAALTIGARLGVADG |
Ga0306924_118022002 | 3300032076 | Soil | PKRLDDEELADWRAGRNAVYQLAALTIGARLAVADG |
Ga0306924_120776582 | 3300032076 | Soil | MPERLDDEELADWRTGRDAVYQLAGHTTVTRLAVAD |
Ga0318518_100813013 | 3300032090 | Soil | PGEWHPRMPEQLDENELADWHAGRDAIFRLAALTVGARIAVADG |
Ga0318577_104051751 | 3300032091 | Soil | MRPVPGEWHPRMPERLDEEELADWRAGRNAVYQLAALTIGARLAVADV |
Ga0318540_105117951 | 3300032094 | Soil | PGEWHPHMPERLDEQELADWRAGRDALYQLAALTIGARLAVVDA |
Ga0306920_1005234292 | 3300032261 | Soil | MPERPDEQELADWRAGRDAVYQLAALTIGARLAVADA |
Ga0306920_1008483321 | 3300032261 | Soil | GAVIRPVVGEWHPRMPERLDEEELADWRAGRDAVYQLAALTIRTRLAVADG |
Ga0306920_1010889951 | 3300032261 | Soil | GAVVRPVLGEWQPHMPDRLDEDELADWRAGRNAVYQLAAHTIGARLAVADG |
Ga0306920_1011503541 | 3300032261 | Soil | PHMPERLDEETFVDRRAGLDATYQLAALTLSARLAIADA |
Ga0306920_1037088631 | 3300032261 | Soil | RPDPGEWHPRMPERLEEDELADWRAGRDAIYQLAALTIGTRLEVADG |
Ga0348332_104683502 | 3300032515 | Plant Litter | ERLDDEELADWRVGRNAVYQLAALTIGARLAVADA |
Ga0335076_106714281 | 3300032955 | Soil | IRPVAGEWHPHLPQRLNKEELADWRAGRNAIYQLAALTIGARLAVADG |
Ga0310914_102375582 | 3300033289 | Soil | MPERLDDEELADWRTGRDAVYQLAGHTTVTRLAVADG |
⦗Top⦘ |