NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F005562

Metagenome / Metatranscriptome Family F005562

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F005562
Family Type Metagenome / Metatranscriptome
Number of Sequences 396
Average Sequence Length 39 residues
Representative Sequence MTRPNIQIDDEVREMTEEEYEALLATGWTLEGTDETPTAD
Number of Associated Samples 187
Number of Associated Scaffolds 396

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 86.33 %
% of genes near scaffold ends (potentially truncated) 7.07 %
% of genes from short scaffolds (< 2000 bps) 66.67 %
Associated GOLD sequencing projects 166
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (70.960 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(16.162 % of family members)
Environment Ontology (ENVO) Unclassified
(55.556 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.061 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.24%    β-sheet: 11.76%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 396 Family Scaffolds
PF02557VanY 3.28
PF01464SLT 2.02
PF14279HNH_5 1.52
PF08774VRR_NUC 1.52
PF04586Peptidase_S78 1.26
PF04860Phage_portal 0.76
PF00535Glycos_transf_2 0.76
PF13884Peptidase_S74 0.76
PF05869Dam 0.76
PF06737Transglycosylas 0.76
PF01844HNH 0.76
PF00386C1q 0.51
PF02467Whib 0.51
PF05866RusA 0.25
PF03237Terminase_6N 0.25
PF13385Laminin_G_3 0.25
PF03354TerL_ATPase 0.25
PF16778Phage_tail_APC 0.25
PF03118RNA_pol_A_CTD 0.25
PF08784RPA_C 0.25
PF04404ERF 0.25
PF05065Phage_capsid 0.25
PF06199Phage_tail_2 0.25

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 396 Family Scaffolds
COG1876LD-carboxypeptidase LdcB, LAS superfamilyCell wall/membrane/envelope biogenesis [M] 3.28
COG2173D-alanyl-D-alanine dipeptidaseCell wall/membrane/envelope biogenesis [M] 3.28
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 1.26
COG0202DNA-directed RNA polymerase, alpha subunit/40 kD subunitTranscription [K] 0.25
COG4570Holliday junction resolvase RusA (prophage-encoded endonuclease)Replication, recombination and repair [L] 0.25
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 0.25
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.25


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.31 %
UnclassifiedrootN/A18.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035265000|ErSWdraf_F5BXKTZ02FZRXLNot Available538Open in IMG/M
2035265000|ErSWdraf_F5BXKTZ02HX5ZXAll Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
2035265000|ErSWdraf_F5BXKTZ02IZ9OCAll Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300002161|JGI24766J26685_10019359All Organisms → Viruses → Predicted Viral1726Open in IMG/M
3300002201|metazooDRAFT_1274823Not Available894Open in IMG/M
3300002408|B570J29032_109657620All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1004Open in IMG/M
3300002408|B570J29032_109727625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1146Open in IMG/M
3300002408|B570J29032_109911652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2423Open in IMG/M
3300002835|B570J40625_100051877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5817Open in IMG/M
3300002835|B570J40625_100352444Not Available1457Open in IMG/M
3300002835|B570J40625_101020386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage705Open in IMG/M
3300002835|B570J40625_101234725Not Available624Open in IMG/M
3300002835|B570J40625_101510763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300003277|JGI25908J49247_10083263Not Available786Open in IMG/M
3300003393|JGI25909J50240_1039923Not Available1000Open in IMG/M
3300004240|Ga0007787_10235144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage898Open in IMG/M
3300004240|Ga0007787_10317304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300004481|Ga0069718_15928030Not Available895Open in IMG/M
3300005527|Ga0068876_10015566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4879Open in IMG/M
3300005581|Ga0049081_10001106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10151Open in IMG/M
3300005581|Ga0049081_10004110All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5481Open in IMG/M
3300005581|Ga0049081_10017880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2687Open in IMG/M
3300005581|Ga0049081_10051548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1558Open in IMG/M
3300005581|Ga0049081_10157879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage828Open in IMG/M
3300005581|Ga0049081_10160160Not Available821Open in IMG/M
3300005581|Ga0049081_10263361Not Available602Open in IMG/M
3300005581|Ga0049081_10270393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300005581|Ga0049081_10288400Not Available568Open in IMG/M
3300005581|Ga0049081_10315768Not Available536Open in IMG/M
3300005581|Ga0049081_10336697Not Available514Open in IMG/M
3300005582|Ga0049080_10004390All Organisms → cellular organisms → Bacteria4913Open in IMG/M
3300005582|Ga0049080_10225225Not Available616Open in IMG/M
3300005582|Ga0049080_10234219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
3300005584|Ga0049082_10034004All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1786Open in IMG/M
3300005662|Ga0078894_10129337Not Available2254Open in IMG/M
3300005662|Ga0078894_11677710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300005805|Ga0079957_1027894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3789Open in IMG/M
3300006030|Ga0075470_10023345All Organisms → Viruses → Predicted Viral1917Open in IMG/M
3300006484|Ga0070744_10206897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300006637|Ga0075461_10003775All Organisms → Viruses → Predicted Viral4991Open in IMG/M
3300006637|Ga0075461_10059578All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1230Open in IMG/M
3300006641|Ga0075471_10013878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4876Open in IMG/M
3300006641|Ga0075471_10379802Not Available711Open in IMG/M
3300006641|Ga0075471_10454659Not Available638Open in IMG/M
3300006802|Ga0070749_10083976All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1899Open in IMG/M
3300006802|Ga0070749_10156560All Organisms → Viruses → Predicted Viral1322Open in IMG/M
3300006802|Ga0070749_10449206All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300006802|Ga0070749_10613206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300006805|Ga0075464_10005354All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6076Open in IMG/M
3300006805|Ga0075464_10250269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1059Open in IMG/M
3300006805|Ga0075464_10256358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1047Open in IMG/M
3300006805|Ga0075464_10705309Not Available624Open in IMG/M
3300006863|Ga0075459_1017352All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1190Open in IMG/M
3300006917|Ga0075472_10615776All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300006919|Ga0070746_10235336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage860Open in IMG/M
3300006920|Ga0070748_1009297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4300Open in IMG/M
3300006920|Ga0070748_1160573Not Available833Open in IMG/M
3300006920|Ga0070748_1259725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage623Open in IMG/M
3300007169|Ga0102976_1125598All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1127Open in IMG/M
3300007177|Ga0102978_1269585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2149Open in IMG/M
3300007538|Ga0099851_1066259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1404Open in IMG/M
3300007538|Ga0099851_1091243All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1167Open in IMG/M
3300007538|Ga0099851_1274246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300007538|Ga0099851_1335237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300007541|Ga0099848_1214279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300007542|Ga0099846_1076667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1245Open in IMG/M
3300007545|Ga0102873_1000405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15351Open in IMG/M
3300007559|Ga0102828_1058176Not Available906Open in IMG/M
3300007560|Ga0102913_1217554All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300007629|Ga0102895_1142364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300007636|Ga0102856_1004365All Organisms → Viruses → Predicted Viral1837Open in IMG/M
3300007639|Ga0102865_1089348Not Available920Open in IMG/M
3300007708|Ga0102859_1004690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3230Open in IMG/M
3300007708|Ga0102859_1018988All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1779Open in IMG/M
3300007708|Ga0102859_1125378Not Available747Open in IMG/M
3300007708|Ga0102859_1219700Not Available567Open in IMG/M
3300007960|Ga0099850_1339567Not Available564Open in IMG/M
3300008055|Ga0108970_11479734All Organisms → cellular organisms → Bacteria5367Open in IMG/M
3300008107|Ga0114340_1065468Not Available1547Open in IMG/M
3300008107|Ga0114340_1082216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1328Open in IMG/M
3300008107|Ga0114340_1096963Not Available1185Open in IMG/M
3300008107|Ga0114340_1104220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1129Open in IMG/M
3300008111|Ga0114344_1054718All Organisms → Viruses → Predicted Viral2208Open in IMG/M
3300008113|Ga0114346_1324965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300008259|Ga0114841_1211169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300008261|Ga0114336_1256886Not Available691Open in IMG/M
3300008261|Ga0114336_1369470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300008266|Ga0114363_1002828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9541Open in IMG/M
3300008266|Ga0114363_1013928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4248Open in IMG/M
3300008266|Ga0114363_1018404Not Available3115Open in IMG/M
3300008266|Ga0114363_1037535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2000Open in IMG/M
3300008266|Ga0114363_1120230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage913Open in IMG/M
3300008266|Ga0114363_1125234All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage886Open in IMG/M
3300008266|Ga0114363_1139856Not Available816Open in IMG/M
3300008266|Ga0114363_1151598All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage768Open in IMG/M
3300008266|Ga0114363_1189770Not Available642Open in IMG/M
3300008267|Ga0114364_1099295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage910Open in IMG/M
3300008448|Ga0114876_1077269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1394Open in IMG/M
3300008448|Ga0114876_1161622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300008448|Ga0114876_1188619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300008450|Ga0114880_1007040Not Available5753Open in IMG/M
3300008450|Ga0114880_1012300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4180Open in IMG/M
3300008450|Ga0114880_1071776All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1404Open in IMG/M
3300008450|Ga0114880_1105568All Organisms → Viruses → Predicted Viral1081Open in IMG/M
3300008450|Ga0114880_1230341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300008450|Ga0114880_1268918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300009068|Ga0114973_10039117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2835Open in IMG/M
3300009068|Ga0114973_10126799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1433Open in IMG/M
3300009068|Ga0114973_10476906Not Available648Open in IMG/M
3300009081|Ga0105098_10174818Not Available978Open in IMG/M
3300009081|Ga0105098_10293293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage779Open in IMG/M
3300009085|Ga0105103_10585309Not Available633Open in IMG/M
3300009155|Ga0114968_10145392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1411Open in IMG/M
3300009158|Ga0114977_10005258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8219Open in IMG/M
3300009158|Ga0114977_10069888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.5612154Open in IMG/M
3300009158|Ga0114977_10074605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2076Open in IMG/M
3300009158|Ga0114977_10552762All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300009158|Ga0114977_10640126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300009159|Ga0114978_10333504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage921Open in IMG/M
3300009159|Ga0114978_10526273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage691Open in IMG/M
3300009161|Ga0114966_10484933Not Available707Open in IMG/M
3300009163|Ga0114970_10012699All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5845Open in IMG/M
3300009164|Ga0114975_10007755All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6816Open in IMG/M
3300009165|Ga0105102_10026192All Organisms → Viruses → Predicted Viral2409Open in IMG/M
3300009165|Ga0105102_10028384All Organisms → Viruses → Predicted Viral2330Open in IMG/M
3300009165|Ga0105102_10107062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1319Open in IMG/M
3300009165|Ga0105102_10376062Not Available750Open in IMG/M
3300009165|Ga0105102_10886838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300009169|Ga0105097_10006942Not Available5775Open in IMG/M
3300009169|Ga0105097_10012217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4451Open in IMG/M
3300009169|Ga0105097_10040088All Organisms → Viruses → Predicted Viral2514Open in IMG/M
3300009169|Ga0105097_10264763Not Available948Open in IMG/M
3300009180|Ga0114979_10083718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1978Open in IMG/M
3300009181|Ga0114969_10047934All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2870Open in IMG/M
3300009183|Ga0114974_10002454All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14224Open in IMG/M
3300009183|Ga0114974_10103122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1833Open in IMG/M
3300009419|Ga0114982_1014371All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2726Open in IMG/M
3300010354|Ga0129333_10003089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes15554Open in IMG/M
3300010354|Ga0129333_10069501All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3272Open in IMG/M
3300010354|Ga0129333_10094192All Organisms → Viruses → Predicted Viral2768Open in IMG/M
3300010354|Ga0129333_10348332All Organisms → Viruses → Predicted Viral1318Open in IMG/M
3300010354|Ga0129333_10354438All Organisms → Viruses → Predicted Viral1305Open in IMG/M
3300010354|Ga0129333_10922150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300010370|Ga0129336_10105909All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1646Open in IMG/M
3300010885|Ga0133913_10105539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7548Open in IMG/M
3300010885|Ga0133913_10220844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5042Open in IMG/M
3300010885|Ga0133913_10385117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3707Open in IMG/M
3300010885|Ga0133913_10399460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3633Open in IMG/M
3300010885|Ga0133913_10474481All Organisms → Viruses → Predicted Viral3299Open in IMG/M
3300010885|Ga0133913_10849452All Organisms → Viruses → Predicted Viral2375Open in IMG/M
3300010885|Ga0133913_11176251All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1969Open in IMG/M
3300010885|Ga0133913_11374560All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1798Open in IMG/M
3300010885|Ga0133913_13414606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1040Open in IMG/M
3300010885|Ga0133913_13509957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1022Open in IMG/M
3300011114|Ga0151515_10621All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes15028Open in IMG/M
3300012012|Ga0153799_1005884All Organisms → Viruses → Predicted Viral2975Open in IMG/M
3300012012|Ga0153799_1010125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.5612107Open in IMG/M
3300012013|Ga0153805_1006553All Organisms → Viruses → Predicted Viral2034Open in IMG/M
3300012013|Ga0153805_1050183Not Available707Open in IMG/M
3300012017|Ga0153801_1093949All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300012663|Ga0157203_1052153All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300012666|Ga0157498_1075141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300012990|Ga0159060_1104225All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300013004|Ga0164293_10019026All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5734Open in IMG/M
3300013004|Ga0164293_10037555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3987Open in IMG/M
3300013004|Ga0164293_10138920Not Available1819Open in IMG/M
3300013004|Ga0164293_10213321All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1386Open in IMG/M
3300013004|Ga0164293_10465840Not Available840Open in IMG/M
3300013004|Ga0164293_10735209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage630Open in IMG/M
3300013005|Ga0164292_10383187Not Available942Open in IMG/M
(restricted) 3300013126|Ga0172367_10045161All Organisms → Viruses → Predicted Viral3586Open in IMG/M
(restricted) 3300013126|Ga0172367_10352450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage848Open in IMG/M
(restricted) 3300013126|Ga0172367_10585826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300013372|Ga0177922_10446973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1073Open in IMG/M
3300014811|Ga0119960_1030098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage783Open in IMG/M
3300014811|Ga0119960_1034723All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage758Open in IMG/M
3300014811|Ga0119960_1077796Not Available589Open in IMG/M
3300017716|Ga0181350_1150513All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300017716|Ga0181350_1159049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300017722|Ga0181347_1022172Not Available2003Open in IMG/M
3300017722|Ga0181347_1106488Not Available795Open in IMG/M
3300017723|Ga0181362_1105150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300017736|Ga0181365_1101119All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300017736|Ga0181365_1118407All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300017747|Ga0181352_1123040Not Available698Open in IMG/M
3300017754|Ga0181344_1005989All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4062Open in IMG/M
3300017754|Ga0181344_1026318Not Available1788Open in IMG/M
3300017754|Ga0181344_1041371All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1389Open in IMG/M
3300017761|Ga0181356_1167935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage669Open in IMG/M
3300017774|Ga0181358_1186671All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300017774|Ga0181358_1188684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300017774|Ga0181358_1199406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300017774|Ga0181358_1203951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300017777|Ga0181357_1195468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage725Open in IMG/M
3300017777|Ga0181357_1220018All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage670Open in IMG/M
3300017778|Ga0181349_1114356All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage999Open in IMG/M
3300017780|Ga0181346_1074771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.5611342Open in IMG/M
3300017780|Ga0181346_1118247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1017Open in IMG/M
3300017780|Ga0181346_1125546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage980Open in IMG/M
3300017780|Ga0181346_1155854All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage851Open in IMG/M
3300017780|Ga0181346_1179706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage775Open in IMG/M
3300017780|Ga0181346_1223590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage669Open in IMG/M
3300017780|Ga0181346_1335216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300017784|Ga0181348_1000866All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13227Open in IMG/M
3300017784|Ga0181348_1186662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage752Open in IMG/M
3300017785|Ga0181355_1041860All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1960Open in IMG/M
3300017785|Ga0181355_1144059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage965Open in IMG/M
3300017785|Ga0181355_1162851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage895Open in IMG/M
3300017785|Ga0181355_1318317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300019784|Ga0181359_1003870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4672Open in IMG/M
3300019784|Ga0181359_1009245All Organisms → Viruses → Predicted Viral3442Open in IMG/M
3300019784|Ga0181359_1032167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2029Open in IMG/M
3300019784|Ga0181359_1039638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1824Open in IMG/M
3300019784|Ga0181359_1044992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1707Open in IMG/M
3300019784|Ga0181359_1047203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1663Open in IMG/M
3300019784|Ga0181359_1124753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage916Open in IMG/M
3300019784|Ga0181359_1159199Not Available766Open in IMG/M
3300019784|Ga0181359_1187257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300020048|Ga0207193_1101727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2614Open in IMG/M
3300020048|Ga0207193_1142995Not Available2031Open in IMG/M
3300020048|Ga0207193_1202053All Organisms → Viruses → Predicted Viral1569Open in IMG/M
3300020151|Ga0211736_10338156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300020151|Ga0211736_10881493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage745Open in IMG/M
3300020157|Ga0194049_1090510All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage814Open in IMG/M
3300020159|Ga0211734_11255319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1099Open in IMG/M
3300020160|Ga0211733_10365799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300020161|Ga0211726_10123238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage994Open in IMG/M
3300020161|Ga0211726_10490253Not Available2388Open in IMG/M
3300020162|Ga0211735_11227510All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300020172|Ga0211729_10078458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1273Open in IMG/M
3300020172|Ga0211729_10482868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage654Open in IMG/M
3300020172|Ga0211729_10931926Not Available1586Open in IMG/M
3300020172|Ga0211729_11285460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1620Open in IMG/M
3300020205|Ga0211731_10345575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1015Open in IMG/M
3300020205|Ga0211731_11080010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1782Open in IMG/M
3300020205|Ga0211731_11436765All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9188Open in IMG/M
3300020506|Ga0208091_1003784Not Available2134Open in IMG/M
3300020524|Ga0208858_1001054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4990Open in IMG/M
3300020542|Ga0208857_1053200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561610Open in IMG/M
3300020549|Ga0207942_1002751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2856Open in IMG/M
3300020556|Ga0208486_1042712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage669Open in IMG/M
3300020560|Ga0208852_1027369Not Available1047Open in IMG/M
3300020572|Ga0207909_1001200All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7184Open in IMG/M
3300021325|Ga0210301_1369938All Organisms → Viruses → Predicted Viral2085Open in IMG/M
3300021438|Ga0213920_1059580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300021516|Ga0194045_1012242Not Available2342Open in IMG/M
3300021519|Ga0194048_10000847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15025Open in IMG/M
3300021519|Ga0194048_10301829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300021600|Ga0194059_1042710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1507Open in IMG/M
3300021956|Ga0213922_1004399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4413Open in IMG/M
3300021961|Ga0222714_10066209All Organisms → Viruses → Predicted Viral2415Open in IMG/M
3300021961|Ga0222714_10350970Not Available793Open in IMG/M
3300021962|Ga0222713_10095280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2144Open in IMG/M
3300021963|Ga0222712_10002935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage19056Open in IMG/M
3300021963|Ga0222712_10361461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage892Open in IMG/M
3300021963|Ga0222712_10751125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300022176|Ga0212031_1005427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1620Open in IMG/M
3300022176|Ga0212031_1020143All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1034Open in IMG/M
3300022179|Ga0181353_1003325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3601Open in IMG/M
3300022198|Ga0196905_1013022All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2710Open in IMG/M
3300022407|Ga0181351_1010581All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3732Open in IMG/M
3300022407|Ga0181351_1068817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1438Open in IMG/M
3300022407|Ga0181351_1150861All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage835Open in IMG/M
3300023184|Ga0214919_10118159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2198Open in IMG/M
3300024343|Ga0244777_10671586Not Available622Open in IMG/M
3300024346|Ga0244775_10044304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3903Open in IMG/M
3300024346|Ga0244775_10517792Not Available973Open in IMG/M
3300024346|Ga0244775_10591638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage901Open in IMG/M
3300024346|Ga0244775_10832459All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300024346|Ga0244775_11526480All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300024348|Ga0244776_10001466All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage25013Open in IMG/M
3300024348|Ga0244776_10091357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2293Open in IMG/M
3300024348|Ga0244776_10297257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1104Open in IMG/M
3300024348|Ga0244776_10348991All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage996Open in IMG/M
3300025585|Ga0208546_1004264All Organisms → Viruses → Predicted Viral4071Open in IMG/M
3300025630|Ga0208004_1017220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2301Open in IMG/M
3300025630|Ga0208004_1044140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1230Open in IMG/M
3300025635|Ga0208147_1062084Not Available943Open in IMG/M
3300025848|Ga0208005_1162878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300025889|Ga0208644_1006081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8817Open in IMG/M
3300025889|Ga0208644_1215493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage821Open in IMG/M
3300025896|Ga0208916_10013796All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3156Open in IMG/M
3300025896|Ga0208916_10038213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1946Open in IMG/M
3300025896|Ga0208916_10101427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1217Open in IMG/M
3300027214|Ga0208306_1050238Not Available728Open in IMG/M
3300027608|Ga0208974_1012753Not Available2703Open in IMG/M
3300027608|Ga0208974_1037091All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1448Open in IMG/M
3300027659|Ga0208975_1101202Not Available837Open in IMG/M
3300027659|Ga0208975_1170495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300027679|Ga0209769_1189699All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300027693|Ga0209704_1004815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3000Open in IMG/M
3300027693|Ga0209704_1058762All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1060Open in IMG/M
3300027697|Ga0209033_1036069All Organisms → Viruses → Predicted Viral1862Open in IMG/M
3300027697|Ga0209033_1212140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300027710|Ga0209599_10018156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2013Open in IMG/M
3300027733|Ga0209297_1001262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14716Open in IMG/M
3300027733|Ga0209297_1039903All Organisms → Viruses → Predicted Viral2156Open in IMG/M
3300027733|Ga0209297_1159294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage922Open in IMG/M
3300027734|Ga0209087_1036832All Organisms → Viruses → Predicted Viral2307Open in IMG/M
3300027736|Ga0209190_1001744All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15045Open in IMG/M
3300027736|Ga0209190_1005612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7996Open in IMG/M
3300027736|Ga0209190_1010680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5481Open in IMG/M
3300027736|Ga0209190_1015232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4432Open in IMG/M
3300027736|Ga0209190_1276637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300027746|Ga0209597_1001633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14538Open in IMG/M
3300027746|Ga0209597_1001691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14303Open in IMG/M
3300027754|Ga0209596_1080652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1587Open in IMG/M
3300027759|Ga0209296_1001997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14983Open in IMG/M
3300027759|Ga0209296_1003298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11036Open in IMG/M
3300027759|Ga0209296_1062246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1902Open in IMG/M
3300027764|Ga0209134_10167136All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage758Open in IMG/M
3300027769|Ga0209770_10140870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage976Open in IMG/M
3300027785|Ga0209246_10209616Not Available760Open in IMG/M
3300027797|Ga0209107_10013455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4644Open in IMG/M
3300027797|Ga0209107_10022424All Organisms → Viruses → Predicted Viral3625Open in IMG/M
3300027798|Ga0209353_10312816All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300027808|Ga0209354_10244886All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300027808|Ga0209354_10290277Not Available651Open in IMG/M
3300027808|Ga0209354_10335868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300027816|Ga0209990_10013922All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4793Open in IMG/M
3300027956|Ga0209820_1040142All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1229Open in IMG/M
3300027972|Ga0209079_10288023All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300028025|Ga0247723_1001398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14200Open in IMG/M
3300028025|Ga0247723_1002503All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9729Open in IMG/M
3300028025|Ga0247723_1003877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7282Open in IMG/M
3300028025|Ga0247723_1017652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2490Open in IMG/M
3300028025|Ga0247723_1031294All Organisms → Viruses → Predicted Viral1673Open in IMG/M
3300028025|Ga0247723_1040193All Organisms → Viruses → Predicted Viral1398Open in IMG/M
3300028025|Ga0247723_1148853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300031758|Ga0315907_10454189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1023Open in IMG/M
3300031787|Ga0315900_10422155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1043Open in IMG/M
3300031857|Ga0315909_10004616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16161Open in IMG/M
3300031857|Ga0315909_10007212All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12445Open in IMG/M
3300031857|Ga0315909_10035495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4774Open in IMG/M
3300031857|Ga0315909_10063363All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3347Open in IMG/M
3300031857|Ga0315909_10124588All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2171Open in IMG/M
3300031857|Ga0315909_10631450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300031951|Ga0315904_10006035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16657Open in IMG/M
3300031951|Ga0315904_10045928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4917Open in IMG/M
3300031952|Ga0315294_10816758All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage801Open in IMG/M
3300031952|Ga0315294_10864401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage771Open in IMG/M
3300031952|Ga0315294_11097867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300031999|Ga0315274_10665851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1134Open in IMG/M
3300032046|Ga0315289_11450285Not Available528Open in IMG/M
3300032050|Ga0315906_10208421Not Available1832Open in IMG/M
3300032050|Ga0315906_10792777All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300032053|Ga0315284_10727443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1161Open in IMG/M
3300032116|Ga0315903_10477044All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage992Open in IMG/M
3300032116|Ga0315903_11237206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300032173|Ga0315268_10310562All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1529Open in IMG/M
3300033418|Ga0316625_102013070Not Available569Open in IMG/M
3300033992|Ga0334992_0124479All Organisms → Viruses → Predicted Viral1352Open in IMG/M
3300033993|Ga0334994_0357956All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage719Open in IMG/M
3300033993|Ga0334994_0405816Not Available657Open in IMG/M
3300033994|Ga0334996_0228975All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage971Open in IMG/M
3300033996|Ga0334979_0005222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes9124Open in IMG/M
3300033996|Ga0334979_0026001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3922Open in IMG/M
3300033996|Ga0334979_0041939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3000Open in IMG/M
3300033996|Ga0334979_0324100Not Available869Open in IMG/M
3300033996|Ga0334979_0367274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561802Open in IMG/M
3300033996|Ga0334979_0371619Not Available796Open in IMG/M
3300033996|Ga0334979_0390220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300033996|Ga0334979_0515831All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300034013|Ga0334991_0196732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300034021|Ga0335004_0233721All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1125Open in IMG/M
3300034022|Ga0335005_0002300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14645Open in IMG/M
3300034061|Ga0334987_0014035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7351Open in IMG/M
3300034061|Ga0334987_0734347All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300034062|Ga0334995_0009812All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes9053Open in IMG/M
3300034062|Ga0334995_0217250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.5611315Open in IMG/M
3300034062|Ga0334995_0726783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage555Open in IMG/M
3300034066|Ga0335019_0081461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2184Open in IMG/M
3300034073|Ga0310130_0002366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8859Open in IMG/M
3300034073|Ga0310130_0019561All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2178Open in IMG/M
3300034073|Ga0310130_0032445All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1604Open in IMG/M
3300034073|Ga0310130_0087979Not Available929Open in IMG/M
3300034082|Ga0335020_0000090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage68525Open in IMG/M
3300034082|Ga0335020_0001785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14927Open in IMG/M
3300034092|Ga0335010_0485930All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300034095|Ga0335022_0057880Not Available2539Open in IMG/M
3300034101|Ga0335027_0018607All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5938Open in IMG/M
3300034101|Ga0335027_0363249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage953Open in IMG/M
3300034101|Ga0335027_0506389Not Available756Open in IMG/M
3300034102|Ga0335029_0002266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15293Open in IMG/M
3300034102|Ga0335029_0081395All Organisms → Viruses → Predicted Viral2316Open in IMG/M
3300034102|Ga0335029_0195103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1349Open in IMG/M
3300034102|Ga0335029_0415203Not Available808Open in IMG/M
3300034106|Ga0335036_0000203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage53595Open in IMG/M
3300034106|Ga0335036_0210326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1342Open in IMG/M
3300034106|Ga0335036_0245264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1216Open in IMG/M
3300034106|Ga0335036_0443618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage823Open in IMG/M
3300034107|Ga0335037_0007855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5669Open in IMG/M
3300034283|Ga0335007_0596823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300034284|Ga0335013_0224363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.5611233Open in IMG/M
3300034284|Ga0335013_0748108Not Available552Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake16.16%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater12.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake10.86%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.10%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.29%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic4.80%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.04%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.78%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.77%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.77%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.77%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment1.77%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.52%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.52%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.26%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water1.01%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.76%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.76%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.51%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.51%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.51%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.51%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.25%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.25%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.25%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.25%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.25%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.25%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.25%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.25%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2035265000Freshwater microbial communities from Swedish Lakes - surface of Lake ErkenEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002201Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007560Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02EnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011114Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016FebEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300012990Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015EngineeredOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020157Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020506Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020524Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020542Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020556Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020560Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020572Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021516Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11mEnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021600Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11mEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027214Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027707Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ErSWdraft_140023302035265000FreshwaterMTRPNIQIDDEVREMTEVEYEALLATGWTLEATDETPSPA
ErSWdraft_13063302035265000FreshwaterMTRPNIQIDNEVREMTEAEYEALLATGWRLEATDETSSPA
ErSWdraft_4606802035265000FreshwaterMTRPNIQIDNEVREMTEAEYEALLATGWTLEATDETSSPA
JGI24766J26685_1001935923300002161Freshwater And SedimentMEPERPNIQIDDLVRPMTDEEYEALLATGWTLEPSEVTDGD*
metazooDRAFT_127482333300002201LakeVTMTRPNIQIDDKIREMTEDEYAELLASGWTPGEETETE*
B570J29032_10965762033300002408FreshwaterRPNIQIDDEVREMTEEEHEALLATGWTLEGTDETPSPA*
B570J29032_10972762533300002408FreshwaterMTKPNIQIDDEVREMTDEEYAQLLASGWTEEPIEE*
B570J29032_10991165213300002408FreshwaterMNKPLIQIDDEVREMTDEEYAQLLESGWTEEGPEE*
B570J40625_10005187733300002835FreshwaterMSRPNIQIDNEVREMTEEEYAELLASGWTEEGTPLGGTV*
B570J40625_10035244423300002835FreshwaterMTNPNIQIDDLVREMTDEEHEALLATGWTMEPKNETLTAD*
B570J40625_10102038613300002835FreshwaterMTKPNIQIDDEVREMTDEEYAQLLATGWTMEGTNEAPTADVDTGISPE*
B570J40625_10123472513300002835FreshwaterMTNPLIRIDDELREMTDEEYAELLARGWTMEGTNEATIPDADTGISPE*
B570J40625_10151076313300002835FreshwaterMTKPNIQIGDEVREMTDEEYAELLATGWTMEAKDETPSPD*
JGI25908J49247_1008326323300003277Freshwater LakeMTRPKIQIDXLVREMTAEEHEALLATGWTEATDEAPTAD*
JGI25909J50240_103992323300003393Freshwater LakeMTRPKIQIDDLVREMTAEEHEALLATGWTEATDEAPTAD*
Ga0007787_1023514423300004240Freshwater LakeMSDTSSKPLIQIDDEVREMTEEEYEALLATGWTLESTNEIPLGS*
Ga0007787_1031730423300004240Freshwater LakeMTNPNIQINDEVREMTDEEYAELLATGWTMEPKNETPSPD*
Ga0069718_1592803023300004481SedimentMTRPLIQIDDIGTTREMTEEEYANLLATGWTLEEKDETPSAHS*
Ga0068876_1001556673300005527Freshwater LakeMAKPNIQIDDEVREMTDEEYQALLDSGWTPEPKEPDNE*
Ga0049081_10001106113300005581Freshwater LenticMTRPNIQIDDEVREMTQEEYEALLATGWTLEGTDETPTAD*
Ga0049081_10004110123300005581Freshwater LenticMTKPLKQIDDEVCEMTDEEYEELLASGWTPSDEDTK*
Ga0049081_1001788033300005581Freshwater LenticMSRPNIQIDDEVREMTKAEHDALIASGWTEEAKADEVTE*
Ga0049081_1005154833300005581Freshwater LenticMTRPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAG*
Ga0049081_1015787923300005581Freshwater LenticMTRPNIQIDDEVREMTEAEYEALLATGWTLETPDETPSPA*
Ga0049081_1016016013300005581Freshwater LenticMTRPLIQIDDVVREMTEEEHEALLATGWTLEGTDEAPSPA*
Ga0049081_1026336123300005581Freshwater LenticMTRPNIQIDDEVREMTKEEYEALLATGWTLEGTDETATAD*
Ga0049081_1027039323300005581Freshwater LenticMTKPNIQIDDEVREMTDEEYAALIASGWKETTDETPSPD*
Ga0049081_1028840013300005581Freshwater LenticMTRPNIQIDDEVREMTDEEYEALLTTGWTEEGTDETPTAD*
Ga0049081_1031576813300005581Freshwater LenticMTRPNIQIDDEVREMTEAEYEALLATGWTLEATDETPSPD*
Ga0049081_1033669723300005581Freshwater LenticMTKPNIQIDDEVREMTDQEYAELLASGWTEEPTEE*
Ga0049080_1000439053300005582Freshwater LenticMTKPNIQIDDEIREMTDEEYADLLASGWTPDDTEPPA*
Ga0049080_1022522523300005582Freshwater LenticMTRPLIQIDDVVREMTEEEHEALLATGWTEATDEAPSPA*
Ga0049080_1023421923300005582Freshwater LenticMTRPNIQIDDEVREMTEEEYAELIASGWTEEGTDETPTAD*
Ga0049082_1003400423300005584Freshwater LenticMTKPNIQIDDEVREMTDEEYAELLASGWTEEPSEP*
Ga0078894_1012933733300005662Freshwater LakeMTKPNIQIDDEVREMTDEEYAELLATGWTEEPTEP*
Ga0078894_1167771023300005662Freshwater LakeMTRPNIQIDDEVREMTEEEYANLLATGWTLESTDEVPSTGV*
Ga0079957_102789443300005805LakeMSKPNIQIDDVVRLMTDEEYEALLASGWTEEASDTKPVE*
Ga0075470_1002334523300006030AqueousMTKPNIQTDDEVREMTDEEYAELLATGWTLESEETSDGD*
Ga0070744_1020689723300006484EstuarineMTRPNIQTDDEVREMTEEEYEALLATGWTLEGTNETLTAD*
Ga0075461_1000377583300006637AqueousMPRPNIQIDDEVREMTDEEYADLIASGWTETAPEETPTE*
Ga0075461_1005957833300006637AqueousMEPERPNIQIDDLVRPMTDEEYEALLASGWTLESTEVTDGD*
Ga0075471_1001387833300006641AqueousMEKPNIQIDDEIREMTDEEYQALLDSGWTADAPDTNPISDPA*
Ga0075471_1037980213300006641AqueousNIQIDDEVREMTEQEYADLIASGWTETAQEENTPE*
Ga0075471_1045465923300006641AqueousMDTGRRDMNKPNIQIDGEVREMTDEEYQELLDQGWTPAPEPE*
Ga0070749_1008397623300006802AqueousMTRPNIQIDDEIREMTEEEYEALLASGWTAEAPPEPDPA*
Ga0070749_1015656043300006802AqueousMTRPNIQIDDEVREMTEEEYADLIASGWTETPQEENTPE*
Ga0070749_1044920623300006802AqueousMEPERPNIQIDDLVRPMTDEEYEALLALGWTLESTEVTDGN*
Ga0070749_1061320623300006802AqueousMTRPNIQIDDEVREMTEEEYAALIESGWTETAPEETTTE*
Ga0075464_1000535433300006805AqueousMTRPNIQIDDEIREMTEEEYEALLATGWTLEGTDETPTSD*
Ga0075464_1025026913300006805AqueousMTKPNIQIDDEVREMTDEEYAELLASGWTPEPTDE*
Ga0075464_1025635823300006805AqueousVTKPNIQIDDLVREMTDEEYAELIASGWTMEATDETPSPD*
Ga0075464_1070530923300006805AqueousMTKPNIQIDDLVREMTEEEYEALLATGWKRESKDETPSPD*
Ga0075459_101735233300006863AqueousMTKPYIQIDDEVREMTDEEYAELLASGWTEESTEP*
Ga0075472_1061577623300006917AqueousMARPNIQIDDEVREMTEEEYADLIASGWTETPQEENTPQ*
Ga0070746_1023533613300006919AqueousKMTRPNIQIDDEVREMTDEEYSALVESGWTETTPEEAPEE*
Ga0070748_100929713300006920AqueousPKGITMTRPNIQIDDEVREMTEEEYEALLATGWTEGTDETPTAD*
Ga0070748_116057323300006920AqueousMTNPNIQIDDEIREMTDDEYAELLATGWTAEPVDEPTEP*
Ga0070748_125972513300006920AqueousMTKPNIQIDDEVREMTDEEYQALLDSGWTPEPKEPDNE
Ga0102976_112559823300007169Freshwater LakeMTRPNIGIDDEVREMTEEEYADLIASGWTFEAEEEIPNP*
Ga0102978_126958523300007177Freshwater LakeVTRPNIQIDDEVREMTEEEYEALLASGWTPEPPVEPDPA*
Ga0099851_106625933300007538AqueousMPRPNIQIDDEVREMTEEEYAALIASGWTETAPEETPTE*
Ga0099851_109124323300007538AqueousMPRPNIQIDDEVREMTEEEYAALIESGWTENAPEETTEE*
Ga0099851_127424623300007538AqueousMPRPNIQIDDEVREMTDEEYEALLASGWTEEGPADEEPA*
Ga0099851_133523723300007538AqueousMTRPNIQINDEVREMTEEEYADLLATGWTLEPSEDATR*
Ga0099848_121427923300007541AqueousMMKPNIQIDDEVREMTDEEYEALLASGWTEEAPAEEEPA*
Ga0099846_107666733300007542AqueousMTRPNIQIDDEVREMTEEEYAELIASGWTETAPEETPTE*
Ga0102873_1000405133300007545EstuarineMARPNIQIDDEVREMTEEEYAELLASGWTEEGTSDLAG*
Ga0102828_105817623300007559EstuarineMTRPNIQIDDEVREMTQEEYEALLATGWTLEGTNETPIAD*
Ga0102913_121755423300007560EstuarineMVRPNIQINDEIREMTEEEYEALLASGWTEEGPDDL
Ga0102895_114236423300007629EstuarineMVRPNIQINDEIREMTEDEYEALLASGWTEEGPDDLAN*
Ga0102856_100436543300007636EstuarineMTRPNIGIDDEVREMTEEEYEALLASGWTEEGTPLGGAV*
Ga0102865_108934823300007639EstuarineMPNPNIQIDDEVREMTDDEYAALLKSGWTEEEAPSEE*
Ga0102859_100469053300007708EstuarineMTRPNIQIDDEVREMTEEEYEALLATGWTMEPQDDLAS*
Ga0102859_101898823300007708EstuarineMTKPNIQIDDLFREMTDEEYAELLATGWTEEATEPPA*
Ga0102859_112537813300007708EstuarineMTRPNIQIDDEVREMTEAEYDALLATGWTLEGTDETLSPD*
Ga0102859_121970013300007708EstuarineMTRPNKQIGDEIREMTEEEYAELLASGWTLEGPDDLAG*
Ga0099850_133956713300007960AqueousMSNPLIQIGNEVREMTDDEFAELLATGWTAEPVDERAEP*
Ga0108970_1147973473300008055EstuaryVSKPNIQINDEVREMTEEEYSALLESGWTSEANSEE*
Ga0114340_106546833300008107Freshwater, PlanktonMNKPNIQIDDEIREMTDDEYAELIASGWTEESQDDREP*
Ga0114340_108221613300008107Freshwater, PlanktonMTRPNIQIDDEVREMTEEEYAELIASGWTEEGKDDLAG*
Ga0114340_109696333300008107Freshwater, PlanktonMTRPNIQIDNEVREMTEEEYAALIESGWTEQGETPE*
Ga0114340_110422023300008107Freshwater, PlanktonMARPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAG*
Ga0114344_105471833300008111Freshwater, PlanktonMARPNIQIDDEVREMTEEEYAALLAGGWTEEGPSDLA*
Ga0114346_132496513300008113Freshwater, PlanktonMARPNIQIDDEVREMTEEEYEALLASGWTEEGSDGLAD*
Ga0114841_121116923300008259Freshwater, PlanktonMARPNIQIDDKVREMTEEEYEALLASGWTEEGTSDLAG*
Ga0114336_125688623300008261Freshwater, PlanktonMTRPNIQIDDEVREMTEEEYEALLASGWTEEGTNDLAG*
Ga0114336_136947023300008261Freshwater, PlanktonMTRPNIQIDDEVREMTEEEYEELLASGWTEEGSNALEG*
Ga0114363_100282893300008266Freshwater, PlanktonMTRPNIQIDDEVREMTDEEYAALIDSGWTPGEPEEATEE*
Ga0114363_101392833300008266Freshwater, PlanktonMTRPNIQIDDEVREMTEEEYEELLASGWTEEGTNDLAP*
Ga0114363_101840443300008266Freshwater, PlanktonMTKPNIQIDDEVREMTDEEYQALLDSGWTPEPKEPTNE*
Ga0114363_103753543300008266Freshwater, PlanktonMARPNIQIDNEVREMTEEEYEALLASGWTEEGPDDLAG*
Ga0114363_112023013300008266Freshwater, PlanktonMARPNIQIDDEVREMTEEEYEALLASGWTMESQDDLAD*
Ga0114363_112523433300008266Freshwater, PlanktonMARPNIQIDDEVREMTEEEYAELLASGWTEEGTSDALA*
Ga0114363_113985613300008266Freshwater, PlanktonMTRPNIQIDDEIREMTEEEYEALLASGWTEEGSDDLAS*
Ga0114363_115159823300008266Freshwater, PlanktonMARPNIQIDDEVREMTEEEYEALLASGWTEEGPDDLAD*
Ga0114363_118977023300008266Freshwater, PlanktonMTRPNIQIDDEIREMTEEEYEALLASGWTEEGINDLAD*
Ga0114364_109929523300008267Freshwater, PlanktonMTRPNIQIDDEVREMTEEEYEALLASGWTEEGSDGLAD*
Ga0114876_107726923300008448Freshwater LakeMTKPLIQIDDEVREMTEEEYEALLASGWTMEPKDDLAD*
Ga0114876_116162223300008448Freshwater LakeMARPNIQIDDDVREMTEEEYAELLASGWTEEGSSDLAS*
Ga0114876_118861913300008448Freshwater LakeMARPNIQIDDEVREMTEEEYAALIAGGWTEEGTSDLAG*
Ga0114880_100704073300008450Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAD*
Ga0114880_101230043300008450Freshwater LakeMARPNIQIDDEIREMTEEEYAALIAGGWTEKGPDDLAG*
Ga0114880_107177613300008450Freshwater LakeMARPNIQIDDEVREMTEEEYEALLASGWTEEGPDDL
Ga0114880_110556843300008450Freshwater LakeMPRPNIQIDDEVREMTEEEYADLIASGWTETAPEENTPE*
Ga0114880_123034123300008450Freshwater LakeMTRPNIQIDDEIREMTEEEYEALLASGWTEEGINALAD*
Ga0114880_126891823300008450Freshwater LakeMARPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAN*
Ga0114973_1003911733300009068Freshwater LakeMTRPNIQIDDEVREMTEQEYADLLATGWTLEGKNETPTAD*
Ga0114973_1012679943300009068Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTEGTDETPTAD*
Ga0114973_1047690623300009068Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTLEGTDETPTAD*
Ga0105098_1017481813300009081Freshwater SedimentMSKPLIQIDDLVREMTDEEYEALLATGWTLEGTDETP
Ga0105098_1029329333300009081Freshwater SedimentMTKPNIQLGDEVREMTDEEYAALIADGWTEGETQE*
Ga0105103_1058530923300009085Freshwater SedimentMSKPLIQIDDLIREMTDEEYEALIARGWTMEPKDETPSPD*
Ga0114968_1014539233300009155Freshwater LakeMTRPNIQIDDEVREMTEEEYAELLESGWTEGTDETPTAD*
Ga0114977_10005258113300009158Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTEGTDDN*
Ga0114977_1006988843300009158Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTEATNETFTAD*
Ga0114977_1007460513300009158Freshwater LakeMTRPNIQIDDEVREMTEEEYQALLATGWTEGTDETPTAD*
Ga0114977_1055276213300009158Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTLEGTDETPTAG*
Ga0114977_1064012623300009158Freshwater LakeMTRPNIQIDDEVREMTEEEYAALLATGWTEEDSEALP*
Ga0114978_1033350433300009159Freshwater LakeMTRPNIQIDDEVREMTQEEYEALLATGWTEGTDETPTAD*
Ga0114978_1052627323300009159Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTEATDETPTAD*
Ga0114966_1048493323300009161Freshwater LakeMIKPNIQIDDEVREMTDDEYDALLASGWTETALDDLAD*
Ga0114970_1001269953300009163Freshwater LakeMIKPNIQIDDAIREMTDDEYNALLASGWTETASDDLAG*
Ga0114975_1000775543300009164Freshwater LakeMTRPNIQIDDEVREMTEAEYEALLATGWTLEGTDETPTAG*
Ga0105102_1002619253300009165Freshwater SedimentMSKPNIQIDDLVREMTDEEYEALLATGWTLEGTDETPSPA*
Ga0105102_1002838453300009165Freshwater SedimentMSKPLIQIDDLIREMTDEEHEALLATGWTMEPKDETPSPD*
Ga0105102_1010706223300009165Freshwater SedimentMTRPNIQIGDEVREMTEEEYEALLATGWTLEGTNEAPTAD*
Ga0105102_1037606223300009165Freshwater SedimentMSKPSIQIGDEIREMTDEEYQTLLDSGWTLEGTDETPSPA*
Ga0105102_1088683823300009165Freshwater SedimentMSKPNIQIDDLVREMTDEEYADLLASGWTLEGTDETPSAD*
Ga0105097_1000694293300009169Freshwater SedimentMTNPLIQIGDLIREMTDEEHEALLASGWTMEPKDETPSTD*
Ga0105097_1001221713300009169Freshwater SedimentKPLIQIDDIGTTREMTDEEYAQLLAGGWTLEAPAPTETPEP*
Ga0105097_1004008843300009169Freshwater SedimentMSRPNIQIDDEVREMTEEEYANLLSSGWAEEPSDDATR*
Ga0105097_1026476323300009169Freshwater SedimentMSRPNIQIDDEVREMTEEEYINFLAVCRTLENEPIAAEPPA*
Ga0114979_1008371823300009180Freshwater LakeMTRPNIQIDDEVREMTEEEYADLLATGWTLEGTDETPTAD*
Ga0114969_1004793423300009181Freshwater LakeMIKPNIQIDDAVREMTDDEYNALLASGWTETASDDLAG*
Ga0114974_10002454113300009183Freshwater LakeMPRPNIQIDDEVREMTEEEYATLLESGWTPEEPNEK*
Ga0114974_1010312213300009183Freshwater LakeMTRPNIQIDDEVREMTEEEYQALLATGWTLEGKDETPTAD*
Ga0114982_101437163300009419Deep SubsurfaceMTRPNIQIGDEVREMTEEEFAELVAGGWTLEGTNETPTAD*
Ga0129333_10003089143300010354Freshwater To Marine Saline GradientMTNPNIQIDDEIREMTDEEYADLIASGWTEEPQDDREP*
Ga0129333_1006950153300010354Freshwater To Marine Saline GradientMTRPNIQIDDEVREMTEEEYAALIESGWTETLAEEASEE*
Ga0129333_1009419243300010354Freshwater To Marine Saline GradientMKPNIQIGDVVREMTDEEYEALLASGWTEESSGGRDER*
Ga0129333_1034833233300010354Freshwater To Marine Saline GradientMPRPNIQIDDEVREMTEEEYAELIASGWTETPAEEANPE*
Ga0129333_1035443823300010354Freshwater To Marine Saline GradientMSLPNIQIDNEVRGMTEEEYSALLESGWTPEANTEE*
Ga0129333_1092215023300010354Freshwater To Marine Saline GradientMMKPNIQIDDVVREMTDEEYEALLASGWTEEGPADEEPA*
Ga0129336_1010590933300010370Freshwater To Marine Saline GradientMTRPNIQIDDEVREMTEEEYAALIESGWTETAPEENTPQ*
Ga0133913_1010553953300010885Freshwater LakeMIKPNIQIDDEVREMTDDEYDALLTSGWTETAQNDLAG*
Ga0133913_1022084463300010885Freshwater LakeMTRPLIQIDDEVREMTQEEYEALLATGWTEGTDETPTAD*
Ga0133913_1038511733300010885Freshwater LakeMTRPNIQIDDQVREMTEEEYEALLATGWTIEGTNETLTAD*
Ga0133913_1039946053300010885Freshwater LakeMIKPNTQTDDAVREMTDDEYNALLASGWTETASDDLAG
Ga0133913_1047448133300010885Freshwater LakeMARPNIQIDDEVREMTEEEYAELIESGWTEEPTEPDE*
Ga0133913_1084945223300010885Freshwater LakeMTRPNIQINDEVREMTEEEYAELIESGWTEEPTEPDE*
Ga0133913_1117625123300010885Freshwater LakeMIKPNTQIDDAVREMTDDEYNALLASGWTETASDDLAD*
Ga0133913_1137456033300010885Freshwater LakeMTRPNIQIDDEVREMTEAEYEALLATGWTLEGTDETLTAG*
Ga0133913_1341460633300010885Freshwater LakeMTRPNIQIDDEVREMTQEEYEALLATGWTLEGTNETPIAG*
Ga0133913_1350995733300010885Freshwater LakeMTRPNIQIDDEVREMTEAEYEALLATGWTLEGTDETPSPD*
Ga0151515_10621133300011114FreshwaterMTKPNIQIDNEVREMTDEEYAELLASGWREEADETPSPD*
Ga0153799_100588423300012012FreshwaterMTRPNIQVDDEVREMTEEEYQALLASGWTKEGSDDLAG*
Ga0153799_101012543300012012FreshwaterMTKPNIQIDDEVREMTQEEYEALLATGWTEATDETPTAD*
Ga0153805_100655343300012013Surface IceMTRPNIQIDDEVREMTQEEYEALLALGWTEEGTTEGPA*
Ga0153805_105018323300012013Surface IceMTRPNLQIGDEIREMTEEEYAELLASGWTEEGKSDLAD*
Ga0153801_109394913300012017FreshwaterGITMTRPNIQVDDEVREMTEEEYQALLASGWTKEGSDDLAG*
Ga0157203_105215313300012663FreshwaterMTRPNVQIDNEVREMTDEEYAALIESGWTETPPEETPTE*
Ga0157498_107514123300012666Freshwater, Surface IceMTRPNIQIDDEVREMTEEEYAELLATGWTMEPKDDLAG*
Ga0159060_110422523300012990Hydrocarbon Resource EnvironmentsMDNPFIQIDDEVREMTDEEYAELVASGWTLEAPEETPEP*
Ga0164293_1001902663300013004FreshwaterMTRPNIQIDDEVREMTEEEYEALLATGWTEGKDETPSPD*
Ga0164293_1003755553300013004FreshwaterMTKPNIQIDDEVREMTDEEYAELIASGWKETTDETPSSD*
Ga0164293_1013892043300013004FreshwaterMTKPNTQTDNEVREMTDEEYAELLATGWTETNETPSPD*
Ga0164293_1021332143300013004FreshwaterMTKPNIQIDDVVREMTEDEYAQLIASGWTPESDE*
Ga0164293_1046584033300013004FreshwaterMTKPNTQTDNEVREMTDEEYAELLATGWTETNETLSPD*
Ga0164293_1073520913300013004FreshwaterMTRPNIQIGDEVREMTEEEYEVLLATGWTLEGTDETSSPD*
Ga0164292_1038318743300013005FreshwaterMSKSLIQIDDEVREMTDEEYATLLADGWTDDDLA*
(restricted) Ga0172367_1004516123300013126FreshwaterMPKPNIQIDDQVREMTDEEYAALIASGWTLEPKEETPEQ*
(restricted) Ga0172367_1035245033300013126FreshwaterMNRPNIQIDDEVREMTGEEYDALLAFGWTEEDPVTE*
(restricted) Ga0172367_1058582623300013126FreshwaterMTRPNIQIDDEVREMTDVEYAALIASGWTPGEPQEERDPNTP*
Ga0177922_1044697323300013372FreshwaterMTKPNIQIDDEVREMTQEEYEALLATGWTEATDETPTAN*
Ga0119960_103009823300014811AquaticMTRPNIQIDDLVREMTEEEYAELLASGWTLEGPDDLAD*
Ga0119960_103472323300014811AquaticMTKPNIQIDDEVREMTDGEYAKLIASGWKETTDETPSPD*
Ga0119960_107779623300014811AquaticFPVTIKLQIDDEVREMTEEEYADLLATGWTLEGTDETPTAD*
Ga0181350_115051313300017716Freshwater LakeMTRPNIQIDNQVREMTQEEYEALLAAGWTEGTDETPTAD
Ga0181350_115904923300017716Freshwater LakeMARPNIQIDDEVREMTQEEYEALLATGWTEGTDETPTAD
Ga0181347_102217233300017722Freshwater LakeMTRPKIQINDEVREMTAEEHEALLATGWTEATDEAPTAD
Ga0181347_110648833300017722Freshwater LakeMTRPNIQIDDEVREMTEEEYAQLLANGWTLETSNEDTK
Ga0181362_110515013300017723Freshwater LakeMTRPNIQIDNEVREMTEEEYEALLATGWTLEGTDDN
Ga0181365_110111923300017736Freshwater LakeMTRPNIQIDDEVREMTQEEYEALLATGWTLEGTDETPTAN
Ga0181365_111840713300017736Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLASVWTEEGTNGLAG
Ga0181352_112304023300017747Freshwater LakeMPRPNIQIDDEVREMTEEEYADLIASGWTETTLEEATPE
Ga0181344_100598923300017754Freshwater LakeMMTRPNIQIDDEVREMTEEEYANLLATGWTLESTDEVPSIGV
Ga0181344_102631833300017754Freshwater LakeMTKPNIQIDDEVREMTDEEYAELLATGWTEEPTEP
Ga0181344_104137123300017754Freshwater LakeMTRPLVQIDDEIREMTKEEYEALLASGWTEEGTNALAG
Ga0181356_116793523300017761Freshwater LakeMTRPNIQIDDLVREMTEEEHEALLATGWTETTDETLTAD
Ga0181358_118667123300017774Freshwater LakeMARPNIQIDNEVREMTEEEYEVLLASGWTEEGTTEGPA
Ga0181358_118868423300017774Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTEATDETLTTD
Ga0181358_119940623300017774Freshwater LakeMTRPNIQIDDLVREMTAEEYADLLATGWTEATDETPTTD
Ga0181358_120395113300017774Freshwater LakeMTRPNIQIDDLVREMTEEEYEALLATGWTEATDEAPTAD
Ga0181357_119546813300017777Freshwater LakeMTRPNIQIDDEVREMTQEEHEALLTTGWTEATDETPTTD
Ga0181357_122001823300017777Freshwater LakeMTKPNIQIDDEVREMTDEEYAELLATGWTEEPTES
Ga0181349_111435623300017778Freshwater LakeMTRPNIQIDDRVREMTEEEHEALLAAGWTETTDETLTAD
Ga0181346_107477113300017780Freshwater LakeMTRPNIQIDDLVREMTAEEYADLLATGWTEATDETPTAD
Ga0181346_111824733300017780Freshwater LakeMTKPNIQIDDEVREMTDEEYAELLATGWTETNEAPSPA
Ga0181346_112554633300017780Freshwater LakeMIKPNIQIDDAVREMTDDEYDALLASGWTETALDDLAG
Ga0181346_115585413300017780Freshwater LakeRPKIQIDNLVREKTAEEHEALLATGWTETDEAPTAD
Ga0181346_117970623300017780Freshwater LakeMTRPNIQIDDLVREMTEEEHEALLAAGWTETTDETLTAD
Ga0181346_122359023300017780Freshwater LakePNIQIDDEVREMTEEEYEALLATGWTLEGTDETPTAD
Ga0181346_133521613300017780Freshwater LakeMTRPNIQIDDEVREMTQQEYEALLATGWTLEGTNETPTAD
Ga0181348_100086683300017784Freshwater LakeMTRPLIQIDDVAREMTEDEYAALLATGWTLEASSEE
Ga0181348_118666223300017784Freshwater LakeMIKPNTQIDDAVREMTDDEYNALLASGWTETASDDLAG
Ga0181355_104186043300017785Freshwater LakeMTRPNIQIDDEVREMTQEEHEALLATGWTEATDEAPTAD
Ga0181355_114405933300017785Freshwater LakeMTRPNIQVDDEIREMTDEEYADLLATGWSETNPDEVPE
Ga0181355_116285123300017785Freshwater LakeMTRPNIQIDDLVREMTEEEYEALLATGWTEATDETLTAD
Ga0181355_131831713300017785Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLASGWTEEGTNGLA
Ga0181359_1003870123300019784Freshwater LakeMTKPNIQIDDEVREMTDEEYAELLASGWTEEPTEP
Ga0181359_1009245113300019784Freshwater LakeKMTRPNIQIDDEIREMTEEEYEALLATGWTMEPKDDLAG
Ga0181359_103216723300019784Freshwater LakeMTRPNIQIGDEVREMTEEEYAELLASGWTEEGKSDLAG
Ga0181359_103963833300019784Freshwater LakeMTKPNIQIDDEVREMTDEEYAELLASGWTEEPSEP
Ga0181359_104499233300019784Freshwater LakeMTRPNIQIDDEVREMTQEEYEALLATGWTLEGTDETTTAD
Ga0181359_104720323300019784Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLASGWTEEGTNGLAG
Ga0181359_112475323300019784Freshwater LakeMTRPNIQIDDLVREMTEEEHEALLAAGWTEGTDETPTAD
Ga0181359_115919913300019784Freshwater LakeMTRPKIQIDDLVREMTAEEHEALLATGWTEATDEAPTAD
Ga0181359_118725723300019784Freshwater LakeMTRPNIQIDDLVREMTEEEHQALLATVWTEATNETP
Ga0207193_110172733300020048Freshwater Lake SedimentMALPNIQIDDKVREMTSEEYEALLATGWSEEETAKDA
Ga0207193_114299543300020048Freshwater Lake SedimentMTRPNIQIDDEIREMTEEEYQALLATGWAEEGTSGLAG
Ga0207193_120205323300020048Freshwater Lake SedimentMARPNIQIDDEVREMTEEEYAELLASGWTEESPTTPSLPGS
Ga0211736_1033815613300020151FreshwaterMTNPKIQIDDEVREMTDEEHQALLATGWTMEPTDETPSPA
Ga0211736_1088149313300020151FreshwaterMARPNIQIDDEVREMTEAEYEALLATGWTLEATDETPSPD
Ga0194049_109051033300020157Anoxic Zone FreshwaterMTRPNIQIDDEVREMTEEEYQWLLSTGWTLEGTDETPTAD
Ga0211734_1125531923300020159FreshwaterMSKPLIQIDDEVREMTDEEYAQLLASGWTEEGPEE
Ga0211733_1036579923300020160FreshwaterMTRPNIQIDDEVREMTEAEYEALLATGWTLEATNDNSEPT
Ga0211726_1012323833300020161FreshwaterMTRPNIQIDDEVREMTEAEYEALLATGWTLEATDETLSPD
Ga0211726_1049025323300020161FreshwaterMTKPNIQIDDEVREMTDEEYAALLATGWTMEPTDETPSPD
Ga0211735_1122751013300020162FreshwaterMTRPNIQIDDEVREMTAEEYEALLATGWTLEGADETPTAG
Ga0211729_1007845823300020172FreshwaterMTRPNIQIDDEVREMTEVEYEALLATGWTLEATDETPSSD
Ga0211729_1048286823300020172FreshwaterMTRPNIQIDNEIREMTEEEYEALLATGWTEEGTSEGPA
Ga0211729_1093192633300020172FreshwaterMTNPKIQIDDEVREMTDEEHEALLATGWTMEPTDETPSPD
Ga0211729_1128546033300020172FreshwaterMTRPNIQIDDEVREMTAEEYEALLATGWTLEGTDETPTAG
Ga0211731_1034557523300020205FreshwaterMTRPNIQIDDEVREMTEAEYEVLLATGWTLEATDETLSPD
Ga0211731_1108001033300020205FreshwaterMTRPNIQIDDEVREMTAEEYEALLATGWTLEGTDETPTAD
Ga0211731_1143676593300020205FreshwaterMTRPNIQTDDQVREMTEAEYEALLATGWTLEGTDETPSPA
Ga0208091_100378433300020506FreshwaterMTNPNIQIDDLVREMTDEEHEALLATGWTMEPKNETLTAD
Ga0208858_100105463300020524FreshwaterMTKPNIQIDDEVREMTDEEYAQLLASGWTEEPIEE
Ga0208857_105320023300020542FreshwaterMTKPNIQIGDEVREMTDEEYAELLATGWTMEAKDETPSPD
Ga0207942_100275123300020549FreshwaterMTNPNIQIDDLVREMTDEEHEALLATGWTMEVKDETLSPD
Ga0208486_104271233300020556FreshwaterMTRPNIQIDDEVREMTEEEHEALLATGWTLEGTDETPSPA
Ga0208852_102736923300020560FreshwaterMNKPLIQIDDEVREMTDEEYAQLLESGWTEEGPEE
Ga0207909_1001200113300020572FreshwaterMSRPNIQIDNEVREMTEEEYAELLASGWTEEGTPLGGTV
Ga0210301_136993823300021325EstuarineMTRPLIQIDDVVREMTEEEHEALLATGWTEGTDETPSPA
Ga0213920_105958043300021438FreshwaterMNKPQIQIDDQIREMTDEEYQTLLDSGWTPEPSAE
Ga0194045_101224233300021516Anoxic Zone FreshwaterMTRPLIQIDDELREMTEEEYEALLATGWTLEGSDDLAH
Ga0194048_1000084763300021519Anoxic Zone FreshwaterMTRPNIQIDDEVREMTAEEYEALIASGWTEEGTNDLAG
Ga0194048_1030182923300021519Anoxic Zone FreshwaterMTRPNIQIDDEVREMTEEEYEVLLASGWTEEGTSDLAG
Ga0194059_104271013300021600Anoxic Zone FreshwaterMTNPLIGIDDLVREMTEEEYAELLVSGWTLEGTDETPTAD
Ga0213922_100439953300021956FreshwaterMTKPLIQIDDEVREMTDEEYQALIDSGWTPEPKEPSDE
Ga0222714_1006620923300021961Estuarine WaterMEPERPNIQIDDLVRPMTDEEYEALLATGWTLESTEVTDGD
Ga0222714_1035097023300021961Estuarine WaterMSKPNIQTDNIVREMTDEEYAELLASGWTLESEETSDGD
Ga0222713_1009528053300021962Estuarine WaterMPKPNIQIDDIVREMTEEEYAELLASGWRETTDETPSPD
Ga0222712_10002935323300021963Estuarine WaterMSKPNIQIDNVVREMTDEEYAELLASGWTLETVEEDE
Ga0222712_1036146133300021963Estuarine WaterMTRPKIQIDDEVREMTDEEYADLIASGWTLEPQEETPTE
Ga0222712_1075112513300021963Estuarine WaterMNRPNIQIDDDVREMTEEEYQTLLDSGWTAEPPADNE
Ga0212031_100542723300022176AqueousMPRPNIQIDDEVREMTEEEYAALIESGWTENAPEETTEE
Ga0212031_102014323300022176AqueousMPRPNIQIDDEVREMTDEEYEALLASGWTEEGPADEEPA
Ga0181353_100332543300022179Freshwater LakeMPRPNIQIDDEVREMTEQEYADLIASGWTETPAEEAAPE
Ga0196905_101302223300022198AqueousMPRPNIQIDDEVREMTEEEYAALIASGWTETAPEETPTE
Ga0181351_101058143300022407Freshwater LakeMTKPNIQIDDEVREMTDEEYAELLASGWTEEPIEE
Ga0181351_106881733300022407Freshwater LakeMTRPNIQIDDLVREMTEEEHQALLATGWTEATNETPTTD
Ga0181351_115086123300022407Freshwater LakeMTRPNIQIDDEIREMTEEEYEALLATGWTMEPKDDLAG
Ga0214919_1011815923300023184FreshwaterMTRPKIQIDDEVREMTEEEYQWLLDTGWTEEGSDETPTVD
Ga0244777_1067158623300024343EstuarineMTRPNKQIGDEIREMTEEEYAELLASGWTLEGLDDLAD
Ga0244775_1004430443300024346EstuarineMTRPNIQIDDEVREMTQEEYEALLATGWTLEGTDETPTAD
Ga0244775_1051779223300024346EstuarineMIMTRPNIQLGDEVREMTEEEYEALLASGWTMEEKDELP
Ga0244775_1059163813300024346EstuarineMTRPNIQTDDEVREMTEEEYEALLATGWTLEGTNETLTAD
Ga0244775_1083245913300024346EstuarineMTRPNIQIDDEVREMTQEEYEALLATGWTLEGTNETPIAD
Ga0244775_1152648023300024346EstuarineMKRPLIQIDDEVREMTEEEYEALLATGWTEATDETPIAD
Ga0244776_10001466343300024348EstuarineMTRPNIGIDDEVREMTEEEYEALLASGWTEEGTPLGGAV
Ga0244776_1009135733300024348EstuarineMTRPNIQIDDEVREMTEEEYEALLATGWTMEPQDDLAS
Ga0244776_1029725733300024348EstuarineMVRPNIQINDEIREMTEEEYEALLASGWTEEGPDDLAN
Ga0244776_1034899123300024348EstuarineMTKPNIQIDDLFREMTDEEYAELLATGWTEEATEPPA
Ga0208546_100426463300025585AqueousMTKPNIQTDDEVREMTDEEYAELLATGWTLESEETSDGD
Ga0208004_101722043300025630AqueousMPRPNIQIDDEVREMTDEEYADLIASGWTETAPEETPTE
Ga0208004_104414033300025630AqueousMEPERPNIQIDDLVRPMTDEEYEALLASGWTLESTEVTDGD
Ga0208147_106208413300025635AqueousMEKPNIQIDDEIREMTDEEYQALLDSGWTADAPDTNPISDPA
Ga0208005_116287823300025848AqueousMNKPNIQIDGEVREMTDEEYQELLDQGWTPAPEPE
Ga0208644_1006081143300025889AqueousMPRPNIQIDDEVREMTEEEYADLIASGWTETPAEEAIPE
Ga0208644_121549343300025889AqueousMTRPNIQIDDEVREMTEEEYADLIASGWTETPQEENTPE
Ga0208916_1001379633300025896AqueousMTRPNIQIDDEIREMTEEEYEALLATGWTLEGTDETPTSD
Ga0208916_1003821343300025896AqueousMTKPNIQIDDVVREMTDEEYAELLASGWTPEPTDE
Ga0208916_1010142733300025896AqueousMTKPNIQIDDLVREMTEEEYEALLATGWKRESKDETPSPD
Ga0208306_105023823300027214EstuarineMPNPNIQIDDEVREMTDDEYAALLKSGWTEEEAPSEE
Ga0208974_101275353300027608Freshwater LenticMTRPNIQIDDEVREMTEAEYEALLATGWTLEATDETPSPD
Ga0208974_103709133300027608Freshwater LenticMTKPNIQIDDEIREMTDEEYADLLASGWTPDDTEPPA
Ga0208975_110120233300027659Freshwater LenticMTRPLIQIDDVVREMTEEEHEALLATGWTLEGTDEAPSPA
Ga0208975_117049523300027659Freshwater LenticMTKPNIQIDDEVREMTDEEYAALIASGWKETTDETPSPD
Ga0209769_118969923300027679Freshwater LakeMTRPLIQIDDEVREMTEEEHEALLATGWTEATDEAPSPA
Ga0209704_100481553300027693Freshwater SedimentMSKPNIQIDDLVREMTDEEYEALLATGWTLEGTDETPSPA
Ga0209704_105876233300027693Freshwater SedimentMTRPNIQIGDEVREMTEEEYEALLATGWTLEGTNEAPTAD
Ga0209033_103606933300027697Freshwater LakeMTNPNIQINDEVREMTDEEYAELLATGWTMEPKNETPSPD
Ga0209033_121214013300027697Freshwater LakeMSDTSSKPLIQIDDEVREMTEEEYEALLATGWTLESTNEIPLGS
Ga0209443_112469933300027707Freshwater LakeMKPLIQIDDEIREMTDEEYSELLAAGWTPEGETGTTEE
Ga0209599_1001815623300027710Deep SubsurfaceMTRPNIQIGDEVREMTEEEFAELVAGGWTLEGTNETPTAD
Ga0209297_1001262143300027733Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTEGTDDN
Ga0209297_103990343300027733Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTLEGTDETPTAD
Ga0209297_115929413300027733Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTEATNETFTAD
Ga0209087_103683223300027734Freshwater LakeMARPNIQIDDEVREMTEEEYAELIESGWTEEPTEPDE
Ga0209190_1001744133300027736Freshwater LakeMTRPNIQIDDEVREMTEEEYAELLESGWTEGTDETPTAD
Ga0209190_1005612103300027736Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTLEGTDETPIAN
Ga0209190_101068063300027736Freshwater LakeMIKPNIQIDDAIREMTDDEYNALLASGWTETASDDLAG
Ga0209190_101523253300027736Freshwater LakeMTRPNIQMDDEVREMTEEEYEALLATGWTWGEPDETPTAD
Ga0209190_127663723300027736Freshwater LakeMTRPNIQIDDEVREMTEQEYADLLATGWTLEGKNETPTAD
Ga0209597_1001633123300027746Freshwater LakeMSNPNIQIDDEIREMTDEEYAELLASGWTPEPTDE
Ga0209597_1001691123300027746Freshwater LakeMTRPNIQIDDEVREMTEEEYEALLATGWTEGTDETPTAD
Ga0209596_108065223300027754Freshwater LakeMIKPNIQIDDAVREMTDDEYNALLASGWTETASDDLAG
Ga0209296_1001997133300027759Freshwater LakeMTRPNIQIDDEVREMTEAEYEALLATGWTLEGTDETPTAG
Ga0209296_1003298103300027759Freshwater LakeMPRPNIQIDDEVREMTEEEYATLLESGWTPEEPNEK
Ga0209296_106224663300027759Freshwater LakeMTRPNIQIDDEVREMTEEEYQALLATGWTLEGKDETPTAD
Ga0209134_1016713623300027764Freshwater LakeMTRPNIQIDDEVREMTEQEYADLVARGWTLEPTYEMPTTGV
Ga0209770_1014087023300027769Freshwater LakeMTRPNIQIDDEVREMTEEEYANLLATGWTLESTDEVPSTGV
Ga0209246_1020961633300027785Freshwater LakeMTRPNIQIDDEVREMTEEEYQALLATGWTLEGTDETPSPA
Ga0209107_1001345533300027797Freshwater And SedimentMTRPNIQIDDEVREMTEAEYEALLATGWTLETPDETPSPA
Ga0209107_1002242443300027797Freshwater And SedimentMTRPLIQIDDVVREMTEEEHEALLATGWTESTDETPSPA
Ga0209353_1031281613300027798Freshwater LakeMTRPNIQIGDEVREMTEEEHEALLATGWTEATDEAPTAD
Ga0209354_1024488613300027808Freshwater LakeMTRPLIQIDDEVREMTEEEYEALLATGWTLEGTDETPSPA
Ga0209354_1029027733300027808Freshwater LakeMTRPNIQIDDQVREMTEEEYEALLATGWTEEGTDETPSPA
Ga0209354_1033586823300027808Freshwater LakeIMTRPNIQIGDEVREMTEEEYAELLASGWTEEGKSDLAG
Ga0209990_1001392253300027816Freshwater LakeMAKPNIQIDDEVREMTDEEYQALLDSGWTPEPKEPDNE
Ga0209820_104014213300027956Freshwater SedimentMSKPLIQIDDLVREMTDEEYEALLATGWTLEGTDETPSAD
Ga0209079_1028802323300027972Freshwater SedimentMSKPNIQIDDEIREMTDEEYQTLLDSGWTLEGTDETPSPA
Ga0247723_1001398123300028025Deep Subsurface SedimentMARPNIQIDDEVREMTEEEYEALLASGWTEEGSDGLAD
Ga0247723_1002503123300028025Deep Subsurface SedimentMKRPNIQIDELVREMTEEEYADLLATGWTLESEDETPTSK
Ga0247723_1003877103300028025Deep Subsurface SedimentMTYPNIQIDDEVREMTKEEYDALLATGWTEEATEPPA
Ga0247723_101765223300028025Deep Subsurface SedimentMTRPKIQIDDLVREMTEEEYSELLATGWTLEPTDEVPPTGV
Ga0247723_103129423300028025Deep Subsurface SedimentMTRPNIQIDDEVREMTEEEYEALLASGWTEEGTTEGPA
Ga0247723_104019333300028025Deep Subsurface SedimentMTRPNIQIDDEVREMTEEEYADLLASGWTEFPDAS
Ga0247723_114885323300028025Deep Subsurface SedimentMTRPNIQIDEKVREMTEEEYEALLATGWTLEGTNETPTAN
Ga0315907_1045418933300031758FreshwaterMARPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAG
Ga0315900_1042215523300031787FreshwaterMKPNIQIDDEVREMTDEEYEALLASGWSPESVEELP
Ga0315909_10004616133300031857FreshwaterMARPNIQIDDEVREMTEEEYAALLAGGWTEEGPSDLA
Ga0315909_1000721223300031857FreshwaterMTKPLIQIDDEVREMTEEEYEALLASGWTMEPKDDLAD
Ga0315909_1003549523300031857FreshwaterMPNPNIQIDDVVREMTDEEYEALLASGWTEEAPVEEPA
Ga0315909_1006336333300031857FreshwaterMTRPNIQIDDEVREMTEEEYEELLASGWTEEGTNDLAP
Ga0315909_1012458843300031857FreshwaterMTRPNIQIDDEIREMTEEEYEALLASGWTEQGSDVVAS
Ga0315909_1063145023300031857FreshwaterMARPNIQIDDEVREMTEEEYEALLASGWTEEGPDDLAD
Ga0315904_10006035193300031951FreshwaterMTRPNIQIDDEVREMTEEEYEELLASGWTEEGSNALEG
Ga0315904_1004592843300031951FreshwaterMTRPNIQIDDEVREMTEEEYAELIASGWTEEGKDDLAG
Ga0315294_1081675823300031952SedimentRPNIQIDDEVREMTEEEYETLLASGWTDVEPVEEL
Ga0315294_1086440123300031952SedimentMTRPNIQIDDEVREMTEEEYEVLLASGWTLEGTSEGPA
Ga0315294_1109786713300031952SedimentMTRPKIQIDNEVRKMTEQKYADLLATGWTLEPTDEMPTTGV
Ga0315274_1066585133300031999SedimentMTRPNIQIDDEVREMSEEEYEALLATGWTLEATDETPSPT
Ga0315289_1145028513300032046SedimentMTRPNIQIGDLVREMTEEEYADLLASGWKLESKDETTNVG
Ga0315906_1020842123300032050FreshwaterMTRPNIQIDNEVREMTEEEYAALIESGWTEQGETPE
Ga0315906_1079277723300032050FreshwaterMTRPNIQIDDEVREMTEEEYEELLASGWTEEGTNDLA
Ga0315284_1072744333300032053SedimentMTRPNIQIDDEVREMTEEEYAQLLANGWTLETPDEDTK
Ga0315903_1047704413300032116FreshwaterLRIPKGITMARPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAG
Ga0315903_1123720623300032116FreshwaterMTRPNIQIDDEVREMTEEEYEALLASGWTEEGSDGLAD
Ga0315268_1031056243300032173SedimentMTRPNIQIDDEVREMTQEEYDALLATGWTEATYETPTAD
Ga0316625_10201307033300033418SoilMTRPLIQIDDEVREMTDDEYAALLEQGWTPGEEPTDD
Ga0334992_0124479_1157_12643300033992FreshwaterMTRPNIQIDDEVREMTEEEYADLLASGWTEVPDAS
Ga0334994_0357956_361_4863300033993FreshwaterMARPNIQIDDEIREMTKEEYEALLATGWTEEAAEATRDLAD
Ga0334994_0405816_389_5353300033993FreshwaterMTNPLIRIDDELREMTDEEYAELLARGWTMEGTNEATIPDADTGISPE
Ga0334996_0228975_552_6743300033994FreshwaterMTKPNIQIDNEVREMTDEEYAELLATGWTLEGTDETPSAD
Ga0334979_0005222_1407_15263300033996FreshwaterMTRPNIQIDDEVREMTEEEYEALLATGWTEGKDETPSPD
Ga0334979_0026001_2_1093300033996FreshwaterMTKPNIQIDDEVREMTDEEYAELIASGWKETTDETP
Ga0334979_0041939_889_10053300033996FreshwaterMTKPNTQTDNEVREMTDEEYAELLATGWTETNETPSPD
Ga0334979_0324100_91_2133300033996FreshwaterMTKPNIQIDDEVREMTDEEYAELLATGWTMEAKDETPSPD
Ga0334979_0367274_1_1083300033996FreshwaterMTKPNTQTDNEVREMTDEEYAELLATGWTETNETPS
Ga0334979_0371619_185_3043300033996FreshwaterMTKPNIQIDDEVREMTDEEYAELIASGWKETTDETPSSD
Ga0334979_0390220_614_7363300033996FreshwaterMTKPNIQIDNEVREMTDEEYAELLATGWTLEGTDETPSPA
Ga0334979_0515831_419_5353300033996FreshwaterMTKPNIQIDDEVREMTDEEYAALLATGWTETDETPSPA
Ga0334991_0196732_74_1873300034013FreshwaterMTRPLIQIGDEVREMTEEEYAALEATGWKEFPDDLAD
Ga0335004_0233721_693_8093300034021FreshwaterMTRPNIQIDDEVREMTEEEYEALLASGWTEEGSDDLAD
Ga0335005_0002300_3062_31843300034022FreshwaterMTRPNIQIDDEVREMTQEEYEALLATGWTSEGTDETPTAN
Ga0334987_0014035_1834_19623300034061FreshwaterMTRPKIQIDDIGTTREMTDEEYEALLATGWTMEATDETPSPD
Ga0334987_0734347_161_2833300034061FreshwaterMTKPNIQIDDEVREMTDEEYAELLATGWTMEPKNETPSPD
Ga0334995_0009812_8780_89023300034062FreshwaterMTRPNIQIDDIGTVREMTEEEYEALLAGGWTETNETPSPD
Ga0334995_0217250_1039_11613300034062FreshwaterMTRPNIQIDDEVREMTEEEYEALLASGWTLEGTDETPTAS
Ga0334995_0726783_239_3553300034062FreshwaterMTRPNIQIDDEVREMTEEEYEALLASGWTEEGTNDLAG
Ga0335019_0081461_1303_14223300034066FreshwaterMTRPNIQIDDEIREMTEEEYEALLATGWTEGTDETPSPA
Ga0310130_0002366_8298_84233300034073Fracking WaterMTKPYIQVDEVVREMTDEEYSELVASGWTEEGTGDLTSIIQ
Ga0310130_0019561_627_7463300034073Fracking WaterMPRPNIQIDDEVREMTDEEYAALIESGWTETTPEEATPE
Ga0310130_0032445_449_5683300034073Fracking WaterMPRPNIQIDDEVREMTEEEYAVLIESGWTEIAPEEAPTE
Ga0310130_0087979_195_3143300034073Fracking WaterMPRPNIQIDDEVREMTEEEYADYLAALPTDIYPQEAPTE
Ga0335020_0000090_37412_375433300034082FreshwaterMTRPNIQIDDEVREMTEEEYADLLASGWTEVAENNIAEEWTGE
Ga0335020_0001785_3332_34483300034082FreshwaterMTRPNIQIDNEVREMTEEEYEALLASGWTEEGTTEGLV
Ga0335010_0485930_36_1523300034092FreshwaterMTRPQIQIADEVREMTEEEYEALLASGWTEEGTDDLAG
Ga0335022_0057880_1502_16213300034095FreshwaterMTKPNIQIDDEVREMTDEEYAELLASGWKETTDETPSPD
Ga0335027_0018607_4623_47393300034101FreshwaterMARPNIQIDDEVREMTEEEYEALLASGWTEEGKDDLAG
Ga0335027_0363249_496_6213300034101FreshwaterMTRPLIGIDGETREMTEEEYADLLATGWTLEERDETPTPNS
Ga0335027_0506389_135_2753300034101FreshwaterMTLPDPQTRPNIQIDDIIREMTEEEYAQLLESGWTLEGTDETPTAS
Ga0335029_0002266_4601_47173300034102FreshwaterMAKPFIQIDDLLREMTEEEYEALLASGWTEEGLDDLAG
Ga0335029_0081395_1038_11543300034102FreshwaterMTRPNIQIDDLVREMTEEEYEALLASGWTEEGTTEGLA
Ga0335029_0195103_1049_11683300034102FreshwaterMTRPNIQIDDEVREMTEEEYSALIESGWTETPPEEATEE
Ga0335029_0415203_398_5203300034102FreshwaterMTKPNIQIGDEVREMTDEEYAELLATGWTLEGTDETPSPD
Ga0335036_0000203_40093_402063300034106FreshwaterMTKPNIQIDDEIREMTDEEYAELLASGWTLEASEETE
Ga0335036_0210326_1158_12803300034106FreshwaterMTMARPNIQIDDEVREMTEEEYAALLAGGWTEEGTDDLAP
Ga0335036_0245264_3_1163300034106FreshwaterPNIQIDDLVREMTDEEHEALLGTGWTMEVKDETLSPD
Ga0335036_0443618_665_7783300034106FreshwaterMTRPLIQIDDEVREMTDDEYAALLETGWTPGEEPTDD
Ga0335037_0007855_4196_43183300034107FreshwaterMTRPNIQIDDEVREMTEEEYEALLASGWALEGTDETPLAD
Ga0335007_0596823_40_1503300034283FreshwaterMTRPNIQIDDEVREMTQEEYEALLATGWTEETPSTE
Ga0335013_0224363_705_8213300034284FreshwaterMTKPNTQTDNEVREMTDEEYAELLATGWTETNETLSPD
Ga0335013_0748108_338_4543300034284FreshwaterMTKPNIQIDDEVREMTDEEYAALLATGWTETDETPSPD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.