Basic Information | |
---|---|
Family ID | F005562 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 396 |
Average Sequence Length | 39 residues |
Representative Sequence | MTRPNIQIDDEVREMTEEEYEALLATGWTLEGTDETPTAD |
Number of Associated Samples | 187 |
Number of Associated Scaffolds | 396 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 86.33 % |
% of genes near scaffold ends (potentially truncated) | 7.07 % |
% of genes from short scaffolds (< 2000 bps) | 66.67 % |
Associated GOLD sequencing projects | 166 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (70.960 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.162 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.556 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.061 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.24% β-sheet: 11.76% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 396 Family Scaffolds |
---|---|---|
PF02557 | VanY | 3.28 |
PF01464 | SLT | 2.02 |
PF14279 | HNH_5 | 1.52 |
PF08774 | VRR_NUC | 1.52 |
PF04586 | Peptidase_S78 | 1.26 |
PF04860 | Phage_portal | 0.76 |
PF00535 | Glycos_transf_2 | 0.76 |
PF13884 | Peptidase_S74 | 0.76 |
PF05869 | Dam | 0.76 |
PF06737 | Transglycosylas | 0.76 |
PF01844 | HNH | 0.76 |
PF00386 | C1q | 0.51 |
PF02467 | Whib | 0.51 |
PF05866 | RusA | 0.25 |
PF03237 | Terminase_6N | 0.25 |
PF13385 | Laminin_G_3 | 0.25 |
PF03354 | TerL_ATPase | 0.25 |
PF16778 | Phage_tail_APC | 0.25 |
PF03118 | RNA_pol_A_CTD | 0.25 |
PF08784 | RPA_C | 0.25 |
PF04404 | ERF | 0.25 |
PF05065 | Phage_capsid | 0.25 |
PF06199 | Phage_tail_2 | 0.25 |
COG ID | Name | Functional Category | % Frequency in 396 Family Scaffolds |
---|---|---|---|
COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 3.28 |
COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.28 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 1.26 |
COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.25 |
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.25 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.25 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.25 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.31 % |
Unclassified | root | N/A | 18.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035265000|ErSWdraf_F5BXKTZ02FZRXL | Not Available | 538 | Open in IMG/M |
2035265000|ErSWdraf_F5BXKTZ02HX5ZX | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
2035265000|ErSWdraf_F5BXKTZ02IZ9OC | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300002161|JGI24766J26685_10019359 | All Organisms → Viruses → Predicted Viral | 1726 | Open in IMG/M |
3300002201|metazooDRAFT_1274823 | Not Available | 894 | Open in IMG/M |
3300002408|B570J29032_109657620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
3300002408|B570J29032_109727625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1146 | Open in IMG/M |
3300002408|B570J29032_109911652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2423 | Open in IMG/M |
3300002835|B570J40625_100051877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5817 | Open in IMG/M |
3300002835|B570J40625_100352444 | Not Available | 1457 | Open in IMG/M |
3300002835|B570J40625_101020386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300002835|B570J40625_101234725 | Not Available | 624 | Open in IMG/M |
3300002835|B570J40625_101510763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300003277|JGI25908J49247_10083263 | Not Available | 786 | Open in IMG/M |
3300003393|JGI25909J50240_1039923 | Not Available | 1000 | Open in IMG/M |
3300004240|Ga0007787_10235144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300004240|Ga0007787_10317304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300004481|Ga0069718_15928030 | Not Available | 895 | Open in IMG/M |
3300005527|Ga0068876_10015566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4879 | Open in IMG/M |
3300005581|Ga0049081_10001106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10151 | Open in IMG/M |
3300005581|Ga0049081_10004110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5481 | Open in IMG/M |
3300005581|Ga0049081_10017880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2687 | Open in IMG/M |
3300005581|Ga0049081_10051548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1558 | Open in IMG/M |
3300005581|Ga0049081_10157879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300005581|Ga0049081_10160160 | Not Available | 821 | Open in IMG/M |
3300005581|Ga0049081_10263361 | Not Available | 602 | Open in IMG/M |
3300005581|Ga0049081_10270393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300005581|Ga0049081_10288400 | Not Available | 568 | Open in IMG/M |
3300005581|Ga0049081_10315768 | Not Available | 536 | Open in IMG/M |
3300005581|Ga0049081_10336697 | Not Available | 514 | Open in IMG/M |
3300005582|Ga0049080_10004390 | All Organisms → cellular organisms → Bacteria | 4913 | Open in IMG/M |
3300005582|Ga0049080_10225225 | Not Available | 616 | Open in IMG/M |
3300005582|Ga0049080_10234219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
3300005584|Ga0049082_10034004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1786 | Open in IMG/M |
3300005662|Ga0078894_10129337 | Not Available | 2254 | Open in IMG/M |
3300005662|Ga0078894_11677710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300005805|Ga0079957_1027894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3789 | Open in IMG/M |
3300006030|Ga0075470_10023345 | All Organisms → Viruses → Predicted Viral | 1917 | Open in IMG/M |
3300006484|Ga0070744_10206897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300006637|Ga0075461_10003775 | All Organisms → Viruses → Predicted Viral | 4991 | Open in IMG/M |
3300006637|Ga0075461_10059578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
3300006641|Ga0075471_10013878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4876 | Open in IMG/M |
3300006641|Ga0075471_10379802 | Not Available | 711 | Open in IMG/M |
3300006641|Ga0075471_10454659 | Not Available | 638 | Open in IMG/M |
3300006802|Ga0070749_10083976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1899 | Open in IMG/M |
3300006802|Ga0070749_10156560 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
3300006802|Ga0070749_10449206 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300006802|Ga0070749_10613206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300006805|Ga0075464_10005354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6076 | Open in IMG/M |
3300006805|Ga0075464_10250269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1059 | Open in IMG/M |
3300006805|Ga0075464_10256358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1047 | Open in IMG/M |
3300006805|Ga0075464_10705309 | Not Available | 624 | Open in IMG/M |
3300006863|Ga0075459_1017352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1190 | Open in IMG/M |
3300006917|Ga0075472_10615776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300006919|Ga0070746_10235336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300006920|Ga0070748_1009297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4300 | Open in IMG/M |
3300006920|Ga0070748_1160573 | Not Available | 833 | Open in IMG/M |
3300006920|Ga0070748_1259725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300007169|Ga0102976_1125598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
3300007177|Ga0102978_1269585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2149 | Open in IMG/M |
3300007538|Ga0099851_1066259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
3300007538|Ga0099851_1091243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1167 | Open in IMG/M |
3300007538|Ga0099851_1274246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300007538|Ga0099851_1335237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300007541|Ga0099848_1214279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300007542|Ga0099846_1076667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
3300007545|Ga0102873_1000405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15351 | Open in IMG/M |
3300007559|Ga0102828_1058176 | Not Available | 906 | Open in IMG/M |
3300007560|Ga0102913_1217554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300007629|Ga0102895_1142364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300007636|Ga0102856_1004365 | All Organisms → Viruses → Predicted Viral | 1837 | Open in IMG/M |
3300007639|Ga0102865_1089348 | Not Available | 920 | Open in IMG/M |
3300007708|Ga0102859_1004690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3230 | Open in IMG/M |
3300007708|Ga0102859_1018988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1779 | Open in IMG/M |
3300007708|Ga0102859_1125378 | Not Available | 747 | Open in IMG/M |
3300007708|Ga0102859_1219700 | Not Available | 567 | Open in IMG/M |
3300007960|Ga0099850_1339567 | Not Available | 564 | Open in IMG/M |
3300008055|Ga0108970_11479734 | All Organisms → cellular organisms → Bacteria | 5367 | Open in IMG/M |
3300008107|Ga0114340_1065468 | Not Available | 1547 | Open in IMG/M |
3300008107|Ga0114340_1082216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1328 | Open in IMG/M |
3300008107|Ga0114340_1096963 | Not Available | 1185 | Open in IMG/M |
3300008107|Ga0114340_1104220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1129 | Open in IMG/M |
3300008111|Ga0114344_1054718 | All Organisms → Viruses → Predicted Viral | 2208 | Open in IMG/M |
3300008113|Ga0114346_1324965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300008259|Ga0114841_1211169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300008261|Ga0114336_1256886 | Not Available | 691 | Open in IMG/M |
3300008261|Ga0114336_1369470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300008266|Ga0114363_1002828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9541 | Open in IMG/M |
3300008266|Ga0114363_1013928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4248 | Open in IMG/M |
3300008266|Ga0114363_1018404 | Not Available | 3115 | Open in IMG/M |
3300008266|Ga0114363_1037535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2000 | Open in IMG/M |
3300008266|Ga0114363_1120230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
3300008266|Ga0114363_1125234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300008266|Ga0114363_1139856 | Not Available | 816 | Open in IMG/M |
3300008266|Ga0114363_1151598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
3300008266|Ga0114363_1189770 | Not Available | 642 | Open in IMG/M |
3300008267|Ga0114364_1099295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
3300008448|Ga0114876_1077269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1394 | Open in IMG/M |
3300008448|Ga0114876_1161622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300008448|Ga0114876_1188619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300008450|Ga0114880_1007040 | Not Available | 5753 | Open in IMG/M |
3300008450|Ga0114880_1012300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4180 | Open in IMG/M |
3300008450|Ga0114880_1071776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
3300008450|Ga0114880_1105568 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
3300008450|Ga0114880_1230341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300008450|Ga0114880_1268918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300009068|Ga0114973_10039117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2835 | Open in IMG/M |
3300009068|Ga0114973_10126799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
3300009068|Ga0114973_10476906 | Not Available | 648 | Open in IMG/M |
3300009081|Ga0105098_10174818 | Not Available | 978 | Open in IMG/M |
3300009081|Ga0105098_10293293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300009085|Ga0105103_10585309 | Not Available | 633 | Open in IMG/M |
3300009155|Ga0114968_10145392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1411 | Open in IMG/M |
3300009158|Ga0114977_10005258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8219 | Open in IMG/M |
3300009158|Ga0114977_10069888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 2154 | Open in IMG/M |
3300009158|Ga0114977_10074605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2076 | Open in IMG/M |
3300009158|Ga0114977_10552762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300009158|Ga0114977_10640126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300009159|Ga0114978_10333504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
3300009159|Ga0114978_10526273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300009161|Ga0114966_10484933 | Not Available | 707 | Open in IMG/M |
3300009163|Ga0114970_10012699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5845 | Open in IMG/M |
3300009164|Ga0114975_10007755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6816 | Open in IMG/M |
3300009165|Ga0105102_10026192 | All Organisms → Viruses → Predicted Viral | 2409 | Open in IMG/M |
3300009165|Ga0105102_10028384 | All Organisms → Viruses → Predicted Viral | 2330 | Open in IMG/M |
3300009165|Ga0105102_10107062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
3300009165|Ga0105102_10376062 | Not Available | 750 | Open in IMG/M |
3300009165|Ga0105102_10886838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300009169|Ga0105097_10006942 | Not Available | 5775 | Open in IMG/M |
3300009169|Ga0105097_10012217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4451 | Open in IMG/M |
3300009169|Ga0105097_10040088 | All Organisms → Viruses → Predicted Viral | 2514 | Open in IMG/M |
3300009169|Ga0105097_10264763 | Not Available | 948 | Open in IMG/M |
3300009180|Ga0114979_10083718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1978 | Open in IMG/M |
3300009181|Ga0114969_10047934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2870 | Open in IMG/M |
3300009183|Ga0114974_10002454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14224 | Open in IMG/M |
3300009183|Ga0114974_10103122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1833 | Open in IMG/M |
3300009419|Ga0114982_1014371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2726 | Open in IMG/M |
3300010354|Ga0129333_10003089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15554 | Open in IMG/M |
3300010354|Ga0129333_10069501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3272 | Open in IMG/M |
3300010354|Ga0129333_10094192 | All Organisms → Viruses → Predicted Viral | 2768 | Open in IMG/M |
3300010354|Ga0129333_10348332 | All Organisms → Viruses → Predicted Viral | 1318 | Open in IMG/M |
3300010354|Ga0129333_10354438 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
3300010354|Ga0129333_10922150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300010370|Ga0129336_10105909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1646 | Open in IMG/M |
3300010885|Ga0133913_10105539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7548 | Open in IMG/M |
3300010885|Ga0133913_10220844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5042 | Open in IMG/M |
3300010885|Ga0133913_10385117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3707 | Open in IMG/M |
3300010885|Ga0133913_10399460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3633 | Open in IMG/M |
3300010885|Ga0133913_10474481 | All Organisms → Viruses → Predicted Viral | 3299 | Open in IMG/M |
3300010885|Ga0133913_10849452 | All Organisms → Viruses → Predicted Viral | 2375 | Open in IMG/M |
3300010885|Ga0133913_11176251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1969 | Open in IMG/M |
3300010885|Ga0133913_11374560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1798 | Open in IMG/M |
3300010885|Ga0133913_13414606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
3300010885|Ga0133913_13509957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1022 | Open in IMG/M |
3300011114|Ga0151515_10621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15028 | Open in IMG/M |
3300012012|Ga0153799_1005884 | All Organisms → Viruses → Predicted Viral | 2975 | Open in IMG/M |
3300012012|Ga0153799_1010125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 2107 | Open in IMG/M |
3300012013|Ga0153805_1006553 | All Organisms → Viruses → Predicted Viral | 2034 | Open in IMG/M |
3300012013|Ga0153805_1050183 | Not Available | 707 | Open in IMG/M |
3300012017|Ga0153801_1093949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300012663|Ga0157203_1052153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300012666|Ga0157498_1075141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300012990|Ga0159060_1104225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300013004|Ga0164293_10019026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5734 | Open in IMG/M |
3300013004|Ga0164293_10037555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3987 | Open in IMG/M |
3300013004|Ga0164293_10138920 | Not Available | 1819 | Open in IMG/M |
3300013004|Ga0164293_10213321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1386 | Open in IMG/M |
3300013004|Ga0164293_10465840 | Not Available | 840 | Open in IMG/M |
3300013004|Ga0164293_10735209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300013005|Ga0164292_10383187 | Not Available | 942 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10045161 | All Organisms → Viruses → Predicted Viral | 3586 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10352450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10585826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300013372|Ga0177922_10446973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
3300014811|Ga0119960_1030098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
3300014811|Ga0119960_1034723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300014811|Ga0119960_1077796 | Not Available | 589 | Open in IMG/M |
3300017716|Ga0181350_1150513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300017716|Ga0181350_1159049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300017722|Ga0181347_1022172 | Not Available | 2003 | Open in IMG/M |
3300017722|Ga0181347_1106488 | Not Available | 795 | Open in IMG/M |
3300017723|Ga0181362_1105150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300017736|Ga0181365_1101119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300017736|Ga0181365_1118407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300017747|Ga0181352_1123040 | Not Available | 698 | Open in IMG/M |
3300017754|Ga0181344_1005989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4062 | Open in IMG/M |
3300017754|Ga0181344_1026318 | Not Available | 1788 | Open in IMG/M |
3300017754|Ga0181344_1041371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1389 | Open in IMG/M |
3300017761|Ga0181356_1167935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300017774|Ga0181358_1186671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300017774|Ga0181358_1188684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300017774|Ga0181358_1199406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300017774|Ga0181358_1203951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300017777|Ga0181357_1195468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300017777|Ga0181357_1220018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300017778|Ga0181349_1114356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
3300017780|Ga0181346_1074771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 1342 | Open in IMG/M |
3300017780|Ga0181346_1118247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1017 | Open in IMG/M |
3300017780|Ga0181346_1125546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 980 | Open in IMG/M |
3300017780|Ga0181346_1155854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300017780|Ga0181346_1179706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
3300017780|Ga0181346_1223590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300017780|Ga0181346_1335216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300017784|Ga0181348_1000866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13227 | Open in IMG/M |
3300017784|Ga0181348_1186662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300017785|Ga0181355_1041860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1960 | Open in IMG/M |
3300017785|Ga0181355_1144059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300017785|Ga0181355_1162851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300017785|Ga0181355_1318317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300019784|Ga0181359_1003870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4672 | Open in IMG/M |
3300019784|Ga0181359_1009245 | All Organisms → Viruses → Predicted Viral | 3442 | Open in IMG/M |
3300019784|Ga0181359_1032167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2029 | Open in IMG/M |
3300019784|Ga0181359_1039638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1824 | Open in IMG/M |
3300019784|Ga0181359_1044992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1707 | Open in IMG/M |
3300019784|Ga0181359_1047203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1663 | Open in IMG/M |
3300019784|Ga0181359_1124753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
3300019784|Ga0181359_1159199 | Not Available | 766 | Open in IMG/M |
3300019784|Ga0181359_1187257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300020048|Ga0207193_1101727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2614 | Open in IMG/M |
3300020048|Ga0207193_1142995 | Not Available | 2031 | Open in IMG/M |
3300020048|Ga0207193_1202053 | All Organisms → Viruses → Predicted Viral | 1569 | Open in IMG/M |
3300020151|Ga0211736_10338156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300020151|Ga0211736_10881493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300020157|Ga0194049_1090510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300020159|Ga0211734_11255319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
3300020160|Ga0211733_10365799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300020161|Ga0211726_10123238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
3300020161|Ga0211726_10490253 | Not Available | 2388 | Open in IMG/M |
3300020162|Ga0211735_11227510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300020172|Ga0211729_10078458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1273 | Open in IMG/M |
3300020172|Ga0211729_10482868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300020172|Ga0211729_10931926 | Not Available | 1586 | Open in IMG/M |
3300020172|Ga0211729_11285460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1620 | Open in IMG/M |
3300020205|Ga0211731_10345575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
3300020205|Ga0211731_11080010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1782 | Open in IMG/M |
3300020205|Ga0211731_11436765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9188 | Open in IMG/M |
3300020506|Ga0208091_1003784 | Not Available | 2134 | Open in IMG/M |
3300020524|Ga0208858_1001054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4990 | Open in IMG/M |
3300020542|Ga0208857_1053200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 610 | Open in IMG/M |
3300020549|Ga0207942_1002751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2856 | Open in IMG/M |
3300020556|Ga0208486_1042712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300020560|Ga0208852_1027369 | Not Available | 1047 | Open in IMG/M |
3300020572|Ga0207909_1001200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7184 | Open in IMG/M |
3300021325|Ga0210301_1369938 | All Organisms → Viruses → Predicted Viral | 2085 | Open in IMG/M |
3300021438|Ga0213920_1059580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
3300021516|Ga0194045_1012242 | Not Available | 2342 | Open in IMG/M |
3300021519|Ga0194048_10000847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15025 | Open in IMG/M |
3300021519|Ga0194048_10301829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300021600|Ga0194059_1042710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1507 | Open in IMG/M |
3300021956|Ga0213922_1004399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4413 | Open in IMG/M |
3300021961|Ga0222714_10066209 | All Organisms → Viruses → Predicted Viral | 2415 | Open in IMG/M |
3300021961|Ga0222714_10350970 | Not Available | 793 | Open in IMG/M |
3300021962|Ga0222713_10095280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2144 | Open in IMG/M |
3300021963|Ga0222712_10002935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19056 | Open in IMG/M |
3300021963|Ga0222712_10361461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300021963|Ga0222712_10751125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300022176|Ga0212031_1005427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1620 | Open in IMG/M |
3300022176|Ga0212031_1020143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
3300022179|Ga0181353_1003325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3601 | Open in IMG/M |
3300022198|Ga0196905_1013022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2710 | Open in IMG/M |
3300022407|Ga0181351_1010581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3732 | Open in IMG/M |
3300022407|Ga0181351_1068817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1438 | Open in IMG/M |
3300022407|Ga0181351_1150861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300023184|Ga0214919_10118159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2198 | Open in IMG/M |
3300024343|Ga0244777_10671586 | Not Available | 622 | Open in IMG/M |
3300024346|Ga0244775_10044304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3903 | Open in IMG/M |
3300024346|Ga0244775_10517792 | Not Available | 973 | Open in IMG/M |
3300024346|Ga0244775_10591638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300024346|Ga0244775_10832459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300024346|Ga0244775_11526480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300024348|Ga0244776_10001466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25013 | Open in IMG/M |
3300024348|Ga0244776_10091357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2293 | Open in IMG/M |
3300024348|Ga0244776_10297257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
3300024348|Ga0244776_10348991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
3300025585|Ga0208546_1004264 | All Organisms → Viruses → Predicted Viral | 4071 | Open in IMG/M |
3300025630|Ga0208004_1017220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2301 | Open in IMG/M |
3300025630|Ga0208004_1044140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
3300025635|Ga0208147_1062084 | Not Available | 943 | Open in IMG/M |
3300025848|Ga0208005_1162878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300025889|Ga0208644_1006081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8817 | Open in IMG/M |
3300025889|Ga0208644_1215493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300025896|Ga0208916_10013796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3156 | Open in IMG/M |
3300025896|Ga0208916_10038213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1946 | Open in IMG/M |
3300025896|Ga0208916_10101427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1217 | Open in IMG/M |
3300027214|Ga0208306_1050238 | Not Available | 728 | Open in IMG/M |
3300027608|Ga0208974_1012753 | Not Available | 2703 | Open in IMG/M |
3300027608|Ga0208974_1037091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1448 | Open in IMG/M |
3300027659|Ga0208975_1101202 | Not Available | 837 | Open in IMG/M |
3300027659|Ga0208975_1170495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300027679|Ga0209769_1189699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300027693|Ga0209704_1004815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3000 | Open in IMG/M |
3300027693|Ga0209704_1058762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1060 | Open in IMG/M |
3300027697|Ga0209033_1036069 | All Organisms → Viruses → Predicted Viral | 1862 | Open in IMG/M |
3300027697|Ga0209033_1212140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300027710|Ga0209599_10018156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2013 | Open in IMG/M |
3300027733|Ga0209297_1001262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14716 | Open in IMG/M |
3300027733|Ga0209297_1039903 | All Organisms → Viruses → Predicted Viral | 2156 | Open in IMG/M |
3300027733|Ga0209297_1159294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
3300027734|Ga0209087_1036832 | All Organisms → Viruses → Predicted Viral | 2307 | Open in IMG/M |
3300027736|Ga0209190_1001744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15045 | Open in IMG/M |
3300027736|Ga0209190_1005612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7996 | Open in IMG/M |
3300027736|Ga0209190_1010680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5481 | Open in IMG/M |
3300027736|Ga0209190_1015232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4432 | Open in IMG/M |
3300027736|Ga0209190_1276637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300027746|Ga0209597_1001633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14538 | Open in IMG/M |
3300027746|Ga0209597_1001691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14303 | Open in IMG/M |
3300027754|Ga0209596_1080652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1587 | Open in IMG/M |
3300027759|Ga0209296_1001997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14983 | Open in IMG/M |
3300027759|Ga0209296_1003298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11036 | Open in IMG/M |
3300027759|Ga0209296_1062246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1902 | Open in IMG/M |
3300027764|Ga0209134_10167136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300027769|Ga0209770_10140870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
3300027785|Ga0209246_10209616 | Not Available | 760 | Open in IMG/M |
3300027797|Ga0209107_10013455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4644 | Open in IMG/M |
3300027797|Ga0209107_10022424 | All Organisms → Viruses → Predicted Viral | 3625 | Open in IMG/M |
3300027798|Ga0209353_10312816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300027808|Ga0209354_10244886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300027808|Ga0209354_10290277 | Not Available | 651 | Open in IMG/M |
3300027808|Ga0209354_10335868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300027816|Ga0209990_10013922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4793 | Open in IMG/M |
3300027956|Ga0209820_1040142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1229 | Open in IMG/M |
3300027972|Ga0209079_10288023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300028025|Ga0247723_1001398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14200 | Open in IMG/M |
3300028025|Ga0247723_1002503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9729 | Open in IMG/M |
3300028025|Ga0247723_1003877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7282 | Open in IMG/M |
3300028025|Ga0247723_1017652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2490 | Open in IMG/M |
3300028025|Ga0247723_1031294 | All Organisms → Viruses → Predicted Viral | 1673 | Open in IMG/M |
3300028025|Ga0247723_1040193 | All Organisms → Viruses → Predicted Viral | 1398 | Open in IMG/M |
3300028025|Ga0247723_1148853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300031758|Ga0315907_10454189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
3300031787|Ga0315900_10422155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
3300031857|Ga0315909_10004616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16161 | Open in IMG/M |
3300031857|Ga0315909_10007212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12445 | Open in IMG/M |
3300031857|Ga0315909_10035495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4774 | Open in IMG/M |
3300031857|Ga0315909_10063363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3347 | Open in IMG/M |
3300031857|Ga0315909_10124588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2171 | Open in IMG/M |
3300031857|Ga0315909_10631450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300031951|Ga0315904_10006035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16657 | Open in IMG/M |
3300031951|Ga0315904_10045928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4917 | Open in IMG/M |
3300031952|Ga0315294_10816758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300031952|Ga0315294_10864401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300031952|Ga0315294_11097867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300031999|Ga0315274_10665851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
3300032046|Ga0315289_11450285 | Not Available | 528 | Open in IMG/M |
3300032050|Ga0315906_10208421 | Not Available | 1832 | Open in IMG/M |
3300032050|Ga0315906_10792777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300032053|Ga0315284_10727443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1161 | Open in IMG/M |
3300032116|Ga0315903_10477044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
3300032116|Ga0315903_11237206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300032173|Ga0315268_10310562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1529 | Open in IMG/M |
3300033418|Ga0316625_102013070 | Not Available | 569 | Open in IMG/M |
3300033992|Ga0334992_0124479 | All Organisms → Viruses → Predicted Viral | 1352 | Open in IMG/M |
3300033993|Ga0334994_0357956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300033993|Ga0334994_0405816 | Not Available | 657 | Open in IMG/M |
3300033994|Ga0334996_0228975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
3300033996|Ga0334979_0005222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9124 | Open in IMG/M |
3300033996|Ga0334979_0026001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3922 | Open in IMG/M |
3300033996|Ga0334979_0041939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3000 | Open in IMG/M |
3300033996|Ga0334979_0324100 | Not Available | 869 | Open in IMG/M |
3300033996|Ga0334979_0367274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 802 | Open in IMG/M |
3300033996|Ga0334979_0371619 | Not Available | 796 | Open in IMG/M |
3300033996|Ga0334979_0390220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300033996|Ga0334979_0515831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300034013|Ga0334991_0196732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300034021|Ga0335004_0233721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
3300034022|Ga0335005_0002300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14645 | Open in IMG/M |
3300034061|Ga0334987_0014035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7351 | Open in IMG/M |
3300034061|Ga0334987_0734347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300034062|Ga0334995_0009812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9053 | Open in IMG/M |
3300034062|Ga0334995_0217250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 1315 | Open in IMG/M |
3300034062|Ga0334995_0726783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300034066|Ga0335019_0081461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2184 | Open in IMG/M |
3300034073|Ga0310130_0002366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8859 | Open in IMG/M |
3300034073|Ga0310130_0019561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2178 | Open in IMG/M |
3300034073|Ga0310130_0032445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1604 | Open in IMG/M |
3300034073|Ga0310130_0087979 | Not Available | 929 | Open in IMG/M |
3300034082|Ga0335020_0000090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 68525 | Open in IMG/M |
3300034082|Ga0335020_0001785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14927 | Open in IMG/M |
3300034092|Ga0335010_0485930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300034095|Ga0335022_0057880 | Not Available | 2539 | Open in IMG/M |
3300034101|Ga0335027_0018607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5938 | Open in IMG/M |
3300034101|Ga0335027_0363249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
3300034101|Ga0335027_0506389 | Not Available | 756 | Open in IMG/M |
3300034102|Ga0335029_0002266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15293 | Open in IMG/M |
3300034102|Ga0335029_0081395 | All Organisms → Viruses → Predicted Viral | 2316 | Open in IMG/M |
3300034102|Ga0335029_0195103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1349 | Open in IMG/M |
3300034102|Ga0335029_0415203 | Not Available | 808 | Open in IMG/M |
3300034106|Ga0335036_0000203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 53595 | Open in IMG/M |
3300034106|Ga0335036_0210326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1342 | Open in IMG/M |
3300034106|Ga0335036_0245264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1216 | Open in IMG/M |
3300034106|Ga0335036_0443618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300034107|Ga0335037_0007855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5669 | Open in IMG/M |
3300034283|Ga0335007_0596823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300034284|Ga0335013_0224363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 1233 | Open in IMG/M |
3300034284|Ga0335013_0748108 | Not Available | 552 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.16% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.86% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.10% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.29% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.80% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.80% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.80% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.04% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.78% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.77% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.77% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.77% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.77% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.52% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.52% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.26% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.01% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.76% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.76% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.51% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.51% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.51% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.51% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.25% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.25% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.25% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.25% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.25% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.25% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.25% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.25% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.25% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002201 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012990 | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 | Engineered | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021325 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021516 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ErSWdraft_14002330 | 2035265000 | Freshwater | MTRPNIQIDDEVREMTEVEYEALLATGWTLEATDETPSPA |
ErSWdraft_1306330 | 2035265000 | Freshwater | MTRPNIQIDNEVREMTEAEYEALLATGWRLEATDETSSPA |
ErSWdraft_460680 | 2035265000 | Freshwater | MTRPNIQIDNEVREMTEAEYEALLATGWTLEATDETSSPA |
JGI24766J26685_100193592 | 3300002161 | Freshwater And Sediment | MEPERPNIQIDDLVRPMTDEEYEALLATGWTLEPSEVTDGD* |
metazooDRAFT_12748233 | 3300002201 | Lake | VTMTRPNIQIDDKIREMTEDEYAELLASGWTPGEETETE* |
B570J29032_1096576203 | 3300002408 | Freshwater | RPNIQIDDEVREMTEEEHEALLATGWTLEGTDETPSPA* |
B570J29032_1097276253 | 3300002408 | Freshwater | MTKPNIQIDDEVREMTDEEYAQLLASGWTEEPIEE* |
B570J29032_1099116521 | 3300002408 | Freshwater | MNKPLIQIDDEVREMTDEEYAQLLESGWTEEGPEE* |
B570J40625_1000518773 | 3300002835 | Freshwater | MSRPNIQIDNEVREMTEEEYAELLASGWTEEGTPLGGTV* |
B570J40625_1003524442 | 3300002835 | Freshwater | MTNPNIQIDDLVREMTDEEHEALLATGWTMEPKNETLTAD* |
B570J40625_1010203861 | 3300002835 | Freshwater | MTKPNIQIDDEVREMTDEEYAQLLATGWTMEGTNEAPTADVDTGISPE* |
B570J40625_1012347251 | 3300002835 | Freshwater | MTNPLIRIDDELREMTDEEYAELLARGWTMEGTNEATIPDADTGISPE* |
B570J40625_1015107631 | 3300002835 | Freshwater | MTKPNIQIGDEVREMTDEEYAELLATGWTMEAKDETPSPD* |
JGI25908J49247_100832632 | 3300003277 | Freshwater Lake | MTRPKIQIDXLVREMTAEEHEALLATGWTEATDEAPTAD* |
JGI25909J50240_10399232 | 3300003393 | Freshwater Lake | MTRPKIQIDDLVREMTAEEHEALLATGWTEATDEAPTAD* |
Ga0007787_102351442 | 3300004240 | Freshwater Lake | MSDTSSKPLIQIDDEVREMTEEEYEALLATGWTLESTNEIPLGS* |
Ga0007787_103173042 | 3300004240 | Freshwater Lake | MTNPNIQINDEVREMTDEEYAELLATGWTMEPKNETPSPD* |
Ga0069718_159280302 | 3300004481 | Sediment | MTRPLIQIDDIGTTREMTEEEYANLLATGWTLEEKDETPSAHS* |
Ga0068876_100155667 | 3300005527 | Freshwater Lake | MAKPNIQIDDEVREMTDEEYQALLDSGWTPEPKEPDNE* |
Ga0049081_1000110611 | 3300005581 | Freshwater Lentic | MTRPNIQIDDEVREMTQEEYEALLATGWTLEGTDETPTAD* |
Ga0049081_1000411012 | 3300005581 | Freshwater Lentic | MTKPLKQIDDEVCEMTDEEYEELLASGWTPSDEDTK* |
Ga0049081_100178803 | 3300005581 | Freshwater Lentic | MSRPNIQIDDEVREMTKAEHDALIASGWTEEAKADEVTE* |
Ga0049081_100515483 | 3300005581 | Freshwater Lentic | MTRPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAG* |
Ga0049081_101578792 | 3300005581 | Freshwater Lentic | MTRPNIQIDDEVREMTEAEYEALLATGWTLETPDETPSPA* |
Ga0049081_101601601 | 3300005581 | Freshwater Lentic | MTRPLIQIDDVVREMTEEEHEALLATGWTLEGTDEAPSPA* |
Ga0049081_102633612 | 3300005581 | Freshwater Lentic | MTRPNIQIDDEVREMTKEEYEALLATGWTLEGTDETATAD* |
Ga0049081_102703932 | 3300005581 | Freshwater Lentic | MTKPNIQIDDEVREMTDEEYAALIASGWKETTDETPSPD* |
Ga0049081_102884001 | 3300005581 | Freshwater Lentic | MTRPNIQIDDEVREMTDEEYEALLTTGWTEEGTDETPTAD* |
Ga0049081_103157681 | 3300005581 | Freshwater Lentic | MTRPNIQIDDEVREMTEAEYEALLATGWTLEATDETPSPD* |
Ga0049081_103366972 | 3300005581 | Freshwater Lentic | MTKPNIQIDDEVREMTDQEYAELLASGWTEEPTEE* |
Ga0049080_100043905 | 3300005582 | Freshwater Lentic | MTKPNIQIDDEIREMTDEEYADLLASGWTPDDTEPPA* |
Ga0049080_102252252 | 3300005582 | Freshwater Lentic | MTRPLIQIDDVVREMTEEEHEALLATGWTEATDEAPSPA* |
Ga0049080_102342192 | 3300005582 | Freshwater Lentic | MTRPNIQIDDEVREMTEEEYAELIASGWTEEGTDETPTAD* |
Ga0049082_100340042 | 3300005584 | Freshwater Lentic | MTKPNIQIDDEVREMTDEEYAELLASGWTEEPSEP* |
Ga0078894_101293373 | 3300005662 | Freshwater Lake | MTKPNIQIDDEVREMTDEEYAELLATGWTEEPTEP* |
Ga0078894_116777102 | 3300005662 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYANLLATGWTLESTDEVPSTGV* |
Ga0079957_10278944 | 3300005805 | Lake | MSKPNIQIDDVVRLMTDEEYEALLASGWTEEASDTKPVE* |
Ga0075470_100233452 | 3300006030 | Aqueous | MTKPNIQTDDEVREMTDEEYAELLATGWTLESEETSDGD* |
Ga0070744_102068972 | 3300006484 | Estuarine | MTRPNIQTDDEVREMTEEEYEALLATGWTLEGTNETLTAD* |
Ga0075461_100037758 | 3300006637 | Aqueous | MPRPNIQIDDEVREMTDEEYADLIASGWTETAPEETPTE* |
Ga0075461_100595783 | 3300006637 | Aqueous | MEPERPNIQIDDLVRPMTDEEYEALLASGWTLESTEVTDGD* |
Ga0075471_100138783 | 3300006641 | Aqueous | MEKPNIQIDDEIREMTDEEYQALLDSGWTADAPDTNPISDPA* |
Ga0075471_103798021 | 3300006641 | Aqueous | NIQIDDEVREMTEQEYADLIASGWTETAQEENTPE* |
Ga0075471_104546592 | 3300006641 | Aqueous | MDTGRRDMNKPNIQIDGEVREMTDEEYQELLDQGWTPAPEPE* |
Ga0070749_100839762 | 3300006802 | Aqueous | MTRPNIQIDDEIREMTEEEYEALLASGWTAEAPPEPDPA* |
Ga0070749_101565604 | 3300006802 | Aqueous | MTRPNIQIDDEVREMTEEEYADLIASGWTETPQEENTPE* |
Ga0070749_104492062 | 3300006802 | Aqueous | MEPERPNIQIDDLVRPMTDEEYEALLALGWTLESTEVTDGN* |
Ga0070749_106132062 | 3300006802 | Aqueous | MTRPNIQIDDEVREMTEEEYAALIESGWTETAPEETTTE* |
Ga0075464_100053543 | 3300006805 | Aqueous | MTRPNIQIDDEIREMTEEEYEALLATGWTLEGTDETPTSD* |
Ga0075464_102502691 | 3300006805 | Aqueous | MTKPNIQIDDEVREMTDEEYAELLASGWTPEPTDE* |
Ga0075464_102563582 | 3300006805 | Aqueous | VTKPNIQIDDLVREMTDEEYAELIASGWTMEATDETPSPD* |
Ga0075464_107053092 | 3300006805 | Aqueous | MTKPNIQIDDLVREMTEEEYEALLATGWKRESKDETPSPD* |
Ga0075459_10173523 | 3300006863 | Aqueous | MTKPYIQIDDEVREMTDEEYAELLASGWTEESTEP* |
Ga0075472_106157762 | 3300006917 | Aqueous | MARPNIQIDDEVREMTEEEYADLIASGWTETPQEENTPQ* |
Ga0070746_102353361 | 3300006919 | Aqueous | KMTRPNIQIDDEVREMTDEEYSALVESGWTETTPEEAPEE* |
Ga0070748_10092971 | 3300006920 | Aqueous | PKGITMTRPNIQIDDEVREMTEEEYEALLATGWTEGTDETPTAD* |
Ga0070748_11605732 | 3300006920 | Aqueous | MTNPNIQIDDEIREMTDDEYAELLATGWTAEPVDEPTEP* |
Ga0070748_12597251 | 3300006920 | Aqueous | MTKPNIQIDDEVREMTDEEYQALLDSGWTPEPKEPDNE |
Ga0102976_11255982 | 3300007169 | Freshwater Lake | MTRPNIGIDDEVREMTEEEYADLIASGWTFEAEEEIPNP* |
Ga0102978_12695852 | 3300007177 | Freshwater Lake | VTRPNIQIDDEVREMTEEEYEALLASGWTPEPPVEPDPA* |
Ga0099851_10662593 | 3300007538 | Aqueous | MPRPNIQIDDEVREMTEEEYAALIASGWTETAPEETPTE* |
Ga0099851_10912432 | 3300007538 | Aqueous | MPRPNIQIDDEVREMTEEEYAALIESGWTENAPEETTEE* |
Ga0099851_12742462 | 3300007538 | Aqueous | MPRPNIQIDDEVREMTDEEYEALLASGWTEEGPADEEPA* |
Ga0099851_13352372 | 3300007538 | Aqueous | MTRPNIQINDEVREMTEEEYADLLATGWTLEPSEDATR* |
Ga0099848_12142792 | 3300007541 | Aqueous | MMKPNIQIDDEVREMTDEEYEALLASGWTEEAPAEEEPA* |
Ga0099846_10766673 | 3300007542 | Aqueous | MTRPNIQIDDEVREMTEEEYAELIASGWTETAPEETPTE* |
Ga0102873_100040513 | 3300007545 | Estuarine | MARPNIQIDDEVREMTEEEYAELLASGWTEEGTSDLAG* |
Ga0102828_10581762 | 3300007559 | Estuarine | MTRPNIQIDDEVREMTQEEYEALLATGWTLEGTNETPIAD* |
Ga0102913_12175542 | 3300007560 | Estuarine | MVRPNIQINDEIREMTEEEYEALLASGWTEEGPDDL |
Ga0102895_11423642 | 3300007629 | Estuarine | MVRPNIQINDEIREMTEDEYEALLASGWTEEGPDDLAN* |
Ga0102856_10043654 | 3300007636 | Estuarine | MTRPNIGIDDEVREMTEEEYEALLASGWTEEGTPLGGAV* |
Ga0102865_10893482 | 3300007639 | Estuarine | MPNPNIQIDDEVREMTDDEYAALLKSGWTEEEAPSEE* |
Ga0102859_10046905 | 3300007708 | Estuarine | MTRPNIQIDDEVREMTEEEYEALLATGWTMEPQDDLAS* |
Ga0102859_10189882 | 3300007708 | Estuarine | MTKPNIQIDDLFREMTDEEYAELLATGWTEEATEPPA* |
Ga0102859_11253781 | 3300007708 | Estuarine | MTRPNIQIDDEVREMTEAEYDALLATGWTLEGTDETLSPD* |
Ga0102859_12197001 | 3300007708 | Estuarine | MTRPNKQIGDEIREMTEEEYAELLASGWTLEGPDDLAG* |
Ga0099850_13395671 | 3300007960 | Aqueous | MSNPLIQIGNEVREMTDDEFAELLATGWTAEPVDERAEP* |
Ga0108970_114797347 | 3300008055 | Estuary | VSKPNIQINDEVREMTEEEYSALLESGWTSEANSEE* |
Ga0114340_10654683 | 3300008107 | Freshwater, Plankton | MNKPNIQIDDEIREMTDDEYAELIASGWTEESQDDREP* |
Ga0114340_10822161 | 3300008107 | Freshwater, Plankton | MTRPNIQIDDEVREMTEEEYAELIASGWTEEGKDDLAG* |
Ga0114340_10969633 | 3300008107 | Freshwater, Plankton | MTRPNIQIDNEVREMTEEEYAALIESGWTEQGETPE* |
Ga0114340_11042202 | 3300008107 | Freshwater, Plankton | MARPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAG* |
Ga0114344_10547183 | 3300008111 | Freshwater, Plankton | MARPNIQIDDEVREMTEEEYAALLAGGWTEEGPSDLA* |
Ga0114346_13249651 | 3300008113 | Freshwater, Plankton | MARPNIQIDDEVREMTEEEYEALLASGWTEEGSDGLAD* |
Ga0114841_12111692 | 3300008259 | Freshwater, Plankton | MARPNIQIDDKVREMTEEEYEALLASGWTEEGTSDLAG* |
Ga0114336_12568862 | 3300008261 | Freshwater, Plankton | MTRPNIQIDDEVREMTEEEYEALLASGWTEEGTNDLAG* |
Ga0114336_13694702 | 3300008261 | Freshwater, Plankton | MTRPNIQIDDEVREMTEEEYEELLASGWTEEGSNALEG* |
Ga0114363_10028289 | 3300008266 | Freshwater, Plankton | MTRPNIQIDDEVREMTDEEYAALIDSGWTPGEPEEATEE* |
Ga0114363_10139283 | 3300008266 | Freshwater, Plankton | MTRPNIQIDDEVREMTEEEYEELLASGWTEEGTNDLAP* |
Ga0114363_10184044 | 3300008266 | Freshwater, Plankton | MTKPNIQIDDEVREMTDEEYQALLDSGWTPEPKEPTNE* |
Ga0114363_10375354 | 3300008266 | Freshwater, Plankton | MARPNIQIDNEVREMTEEEYEALLASGWTEEGPDDLAG* |
Ga0114363_11202301 | 3300008266 | Freshwater, Plankton | MARPNIQIDDEVREMTEEEYEALLASGWTMESQDDLAD* |
Ga0114363_11252343 | 3300008266 | Freshwater, Plankton | MARPNIQIDDEVREMTEEEYAELLASGWTEEGTSDALA* |
Ga0114363_11398561 | 3300008266 | Freshwater, Plankton | MTRPNIQIDDEIREMTEEEYEALLASGWTEEGSDDLAS* |
Ga0114363_11515982 | 3300008266 | Freshwater, Plankton | MARPNIQIDDEVREMTEEEYEALLASGWTEEGPDDLAD* |
Ga0114363_11897702 | 3300008266 | Freshwater, Plankton | MTRPNIQIDDEIREMTEEEYEALLASGWTEEGINDLAD* |
Ga0114364_10992952 | 3300008267 | Freshwater, Plankton | MTRPNIQIDDEVREMTEEEYEALLASGWTEEGSDGLAD* |
Ga0114876_10772692 | 3300008448 | Freshwater Lake | MTKPLIQIDDEVREMTEEEYEALLASGWTMEPKDDLAD* |
Ga0114876_11616222 | 3300008448 | Freshwater Lake | MARPNIQIDDDVREMTEEEYAELLASGWTEEGSSDLAS* |
Ga0114876_11886191 | 3300008448 | Freshwater Lake | MARPNIQIDDEVREMTEEEYAALIAGGWTEEGTSDLAG* |
Ga0114880_10070407 | 3300008450 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAD* |
Ga0114880_10123004 | 3300008450 | Freshwater Lake | MARPNIQIDDEIREMTEEEYAALIAGGWTEKGPDDLAG* |
Ga0114880_10717761 | 3300008450 | Freshwater Lake | MARPNIQIDDEVREMTEEEYEALLASGWTEEGPDDL |
Ga0114880_11055684 | 3300008450 | Freshwater Lake | MPRPNIQIDDEVREMTEEEYADLIASGWTETAPEENTPE* |
Ga0114880_12303412 | 3300008450 | Freshwater Lake | MTRPNIQIDDEIREMTEEEYEALLASGWTEEGINALAD* |
Ga0114880_12689182 | 3300008450 | Freshwater Lake | MARPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAN* |
Ga0114973_100391173 | 3300009068 | Freshwater Lake | MTRPNIQIDDEVREMTEQEYADLLATGWTLEGKNETPTAD* |
Ga0114973_101267994 | 3300009068 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTEGTDETPTAD* |
Ga0114973_104769062 | 3300009068 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTLEGTDETPTAD* |
Ga0105098_101748181 | 3300009081 | Freshwater Sediment | MSKPLIQIDDLVREMTDEEYEALLATGWTLEGTDETP |
Ga0105098_102932933 | 3300009081 | Freshwater Sediment | MTKPNIQLGDEVREMTDEEYAALIADGWTEGETQE* |
Ga0105103_105853092 | 3300009085 | Freshwater Sediment | MSKPLIQIDDLIREMTDEEYEALIARGWTMEPKDETPSPD* |
Ga0114968_101453923 | 3300009155 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYAELLESGWTEGTDETPTAD* |
Ga0114977_1000525811 | 3300009158 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTEGTDDN* |
Ga0114977_100698884 | 3300009158 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTEATNETFTAD* |
Ga0114977_100746051 | 3300009158 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYQALLATGWTEGTDETPTAD* |
Ga0114977_105527621 | 3300009158 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTLEGTDETPTAG* |
Ga0114977_106401262 | 3300009158 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYAALLATGWTEEDSEALP* |
Ga0114978_103335043 | 3300009159 | Freshwater Lake | MTRPNIQIDDEVREMTQEEYEALLATGWTEGTDETPTAD* |
Ga0114978_105262732 | 3300009159 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTEATDETPTAD* |
Ga0114966_104849332 | 3300009161 | Freshwater Lake | MIKPNIQIDDEVREMTDDEYDALLASGWTETALDDLAD* |
Ga0114970_100126995 | 3300009163 | Freshwater Lake | MIKPNIQIDDAIREMTDDEYNALLASGWTETASDDLAG* |
Ga0114975_100077554 | 3300009164 | Freshwater Lake | MTRPNIQIDDEVREMTEAEYEALLATGWTLEGTDETPTAG* |
Ga0105102_100261925 | 3300009165 | Freshwater Sediment | MSKPNIQIDDLVREMTDEEYEALLATGWTLEGTDETPSPA* |
Ga0105102_100283845 | 3300009165 | Freshwater Sediment | MSKPLIQIDDLIREMTDEEHEALLATGWTMEPKDETPSPD* |
Ga0105102_101070622 | 3300009165 | Freshwater Sediment | MTRPNIQIGDEVREMTEEEYEALLATGWTLEGTNEAPTAD* |
Ga0105102_103760622 | 3300009165 | Freshwater Sediment | MSKPSIQIGDEIREMTDEEYQTLLDSGWTLEGTDETPSPA* |
Ga0105102_108868382 | 3300009165 | Freshwater Sediment | MSKPNIQIDDLVREMTDEEYADLLASGWTLEGTDETPSAD* |
Ga0105097_100069429 | 3300009169 | Freshwater Sediment | MTNPLIQIGDLIREMTDEEHEALLASGWTMEPKDETPSTD* |
Ga0105097_100122171 | 3300009169 | Freshwater Sediment | KPLIQIDDIGTTREMTDEEYAQLLAGGWTLEAPAPTETPEP* |
Ga0105097_100400884 | 3300009169 | Freshwater Sediment | MSRPNIQIDDEVREMTEEEYANLLSSGWAEEPSDDATR* |
Ga0105097_102647632 | 3300009169 | Freshwater Sediment | MSRPNIQIDDEVREMTEEEYINFLAVCRTLENEPIAAEPPA* |
Ga0114979_100837182 | 3300009180 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYADLLATGWTLEGTDETPTAD* |
Ga0114969_100479342 | 3300009181 | Freshwater Lake | MIKPNIQIDDAVREMTDDEYNALLASGWTETASDDLAG* |
Ga0114974_1000245411 | 3300009183 | Freshwater Lake | MPRPNIQIDDEVREMTEEEYATLLESGWTPEEPNEK* |
Ga0114974_101031221 | 3300009183 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYQALLATGWTLEGKDETPTAD* |
Ga0114982_10143716 | 3300009419 | Deep Subsurface | MTRPNIQIGDEVREMTEEEFAELVAGGWTLEGTNETPTAD* |
Ga0129333_1000308914 | 3300010354 | Freshwater To Marine Saline Gradient | MTNPNIQIDDEIREMTDEEYADLIASGWTEEPQDDREP* |
Ga0129333_100695015 | 3300010354 | Freshwater To Marine Saline Gradient | MTRPNIQIDDEVREMTEEEYAALIESGWTETLAEEASEE* |
Ga0129333_100941924 | 3300010354 | Freshwater To Marine Saline Gradient | MKPNIQIGDVVREMTDEEYEALLASGWTEESSGGRDER* |
Ga0129333_103483323 | 3300010354 | Freshwater To Marine Saline Gradient | MPRPNIQIDDEVREMTEEEYAELIASGWTETPAEEANPE* |
Ga0129333_103544382 | 3300010354 | Freshwater To Marine Saline Gradient | MSLPNIQIDNEVRGMTEEEYSALLESGWTPEANTEE* |
Ga0129333_109221502 | 3300010354 | Freshwater To Marine Saline Gradient | MMKPNIQIDDVVREMTDEEYEALLASGWTEEGPADEEPA* |
Ga0129336_101059093 | 3300010370 | Freshwater To Marine Saline Gradient | MTRPNIQIDDEVREMTEEEYAALIESGWTETAPEENTPQ* |
Ga0133913_101055395 | 3300010885 | Freshwater Lake | MIKPNIQIDDEVREMTDDEYDALLTSGWTETAQNDLAG* |
Ga0133913_102208446 | 3300010885 | Freshwater Lake | MTRPLIQIDDEVREMTQEEYEALLATGWTEGTDETPTAD* |
Ga0133913_103851173 | 3300010885 | Freshwater Lake | MTRPNIQIDDQVREMTEEEYEALLATGWTIEGTNETLTAD* |
Ga0133913_103994605 | 3300010885 | Freshwater Lake | MIKPNTQTDDAVREMTDDEYNALLASGWTETASDDLAG |
Ga0133913_104744813 | 3300010885 | Freshwater Lake | MARPNIQIDDEVREMTEEEYAELIESGWTEEPTEPDE* |
Ga0133913_108494522 | 3300010885 | Freshwater Lake | MTRPNIQINDEVREMTEEEYAELIESGWTEEPTEPDE* |
Ga0133913_111762512 | 3300010885 | Freshwater Lake | MIKPNTQIDDAVREMTDDEYNALLASGWTETASDDLAD* |
Ga0133913_113745603 | 3300010885 | Freshwater Lake | MTRPNIQIDDEVREMTEAEYEALLATGWTLEGTDETLTAG* |
Ga0133913_134146063 | 3300010885 | Freshwater Lake | MTRPNIQIDDEVREMTQEEYEALLATGWTLEGTNETPIAG* |
Ga0133913_135099573 | 3300010885 | Freshwater Lake | MTRPNIQIDDEVREMTEAEYEALLATGWTLEGTDETPSPD* |
Ga0151515_1062113 | 3300011114 | Freshwater | MTKPNIQIDNEVREMTDEEYAELLASGWREEADETPSPD* |
Ga0153799_10058842 | 3300012012 | Freshwater | MTRPNIQVDDEVREMTEEEYQALLASGWTKEGSDDLAG* |
Ga0153799_10101254 | 3300012012 | Freshwater | MTKPNIQIDDEVREMTQEEYEALLATGWTEATDETPTAD* |
Ga0153805_10065534 | 3300012013 | Surface Ice | MTRPNIQIDDEVREMTQEEYEALLALGWTEEGTTEGPA* |
Ga0153805_10501832 | 3300012013 | Surface Ice | MTRPNLQIGDEIREMTEEEYAELLASGWTEEGKSDLAD* |
Ga0153801_10939491 | 3300012017 | Freshwater | GITMTRPNIQVDDEVREMTEEEYQALLASGWTKEGSDDLAG* |
Ga0157203_10521531 | 3300012663 | Freshwater | MTRPNVQIDNEVREMTDEEYAALIESGWTETPPEETPTE* |
Ga0157498_10751412 | 3300012666 | Freshwater, Surface Ice | MTRPNIQIDDEVREMTEEEYAELLATGWTMEPKDDLAG* |
Ga0159060_11042252 | 3300012990 | Hydrocarbon Resource Environments | MDNPFIQIDDEVREMTDEEYAELVASGWTLEAPEETPEP* |
Ga0164293_100190266 | 3300013004 | Freshwater | MTRPNIQIDDEVREMTEEEYEALLATGWTEGKDETPSPD* |
Ga0164293_100375555 | 3300013004 | Freshwater | MTKPNIQIDDEVREMTDEEYAELIASGWKETTDETPSSD* |
Ga0164293_101389204 | 3300013004 | Freshwater | MTKPNTQTDNEVREMTDEEYAELLATGWTETNETPSPD* |
Ga0164293_102133214 | 3300013004 | Freshwater | MTKPNIQIDDVVREMTEDEYAQLIASGWTPESDE* |
Ga0164293_104658403 | 3300013004 | Freshwater | MTKPNTQTDNEVREMTDEEYAELLATGWTETNETLSPD* |
Ga0164293_107352091 | 3300013004 | Freshwater | MTRPNIQIGDEVREMTEEEYEVLLATGWTLEGTDETSSPD* |
Ga0164292_103831874 | 3300013005 | Freshwater | MSKSLIQIDDEVREMTDEEYATLLADGWTDDDLA* |
(restricted) Ga0172367_100451612 | 3300013126 | Freshwater | MPKPNIQIDDQVREMTDEEYAALIASGWTLEPKEETPEQ* |
(restricted) Ga0172367_103524503 | 3300013126 | Freshwater | MNRPNIQIDDEVREMTGEEYDALLAFGWTEEDPVTE* |
(restricted) Ga0172367_105858262 | 3300013126 | Freshwater | MTRPNIQIDDEVREMTDVEYAALIASGWTPGEPQEERDPNTP* |
Ga0177922_104469732 | 3300013372 | Freshwater | MTKPNIQIDDEVREMTQEEYEALLATGWTEATDETPTAN* |
Ga0119960_10300982 | 3300014811 | Aquatic | MTRPNIQIDDLVREMTEEEYAELLASGWTLEGPDDLAD* |
Ga0119960_10347232 | 3300014811 | Aquatic | MTKPNIQIDDEVREMTDGEYAKLIASGWKETTDETPSPD* |
Ga0119960_10777962 | 3300014811 | Aquatic | FPVTIKLQIDDEVREMTEEEYADLLATGWTLEGTDETPTAD* |
Ga0181350_11505131 | 3300017716 | Freshwater Lake | MTRPNIQIDNQVREMTQEEYEALLAAGWTEGTDETPTAD |
Ga0181350_11590492 | 3300017716 | Freshwater Lake | MARPNIQIDDEVREMTQEEYEALLATGWTEGTDETPTAD |
Ga0181347_10221723 | 3300017722 | Freshwater Lake | MTRPKIQINDEVREMTAEEHEALLATGWTEATDEAPTAD |
Ga0181347_11064883 | 3300017722 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYAQLLANGWTLETSNEDTK |
Ga0181362_11051501 | 3300017723 | Freshwater Lake | MTRPNIQIDNEVREMTEEEYEALLATGWTLEGTDDN |
Ga0181365_11011192 | 3300017736 | Freshwater Lake | MTRPNIQIDDEVREMTQEEYEALLATGWTLEGTDETPTAN |
Ga0181365_11184071 | 3300017736 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLASVWTEEGTNGLAG |
Ga0181352_11230402 | 3300017747 | Freshwater Lake | MPRPNIQIDDEVREMTEEEYADLIASGWTETTLEEATPE |
Ga0181344_10059892 | 3300017754 | Freshwater Lake | MMTRPNIQIDDEVREMTEEEYANLLATGWTLESTDEVPSIGV |
Ga0181344_10263183 | 3300017754 | Freshwater Lake | MTKPNIQIDDEVREMTDEEYAELLATGWTEEPTEP |
Ga0181344_10413712 | 3300017754 | Freshwater Lake | MTRPLVQIDDEIREMTKEEYEALLASGWTEEGTNALAG |
Ga0181356_11679352 | 3300017761 | Freshwater Lake | MTRPNIQIDDLVREMTEEEHEALLATGWTETTDETLTAD |
Ga0181358_11866712 | 3300017774 | Freshwater Lake | MARPNIQIDNEVREMTEEEYEVLLASGWTEEGTTEGPA |
Ga0181358_11886842 | 3300017774 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTEATDETLTTD |
Ga0181358_11994062 | 3300017774 | Freshwater Lake | MTRPNIQIDDLVREMTAEEYADLLATGWTEATDETPTTD |
Ga0181358_12039511 | 3300017774 | Freshwater Lake | MTRPNIQIDDLVREMTEEEYEALLATGWTEATDEAPTAD |
Ga0181357_11954681 | 3300017777 | Freshwater Lake | MTRPNIQIDDEVREMTQEEHEALLTTGWTEATDETPTTD |
Ga0181357_12200182 | 3300017777 | Freshwater Lake | MTKPNIQIDDEVREMTDEEYAELLATGWTEEPTES |
Ga0181349_11143562 | 3300017778 | Freshwater Lake | MTRPNIQIDDRVREMTEEEHEALLAAGWTETTDETLTAD |
Ga0181346_10747711 | 3300017780 | Freshwater Lake | MTRPNIQIDDLVREMTAEEYADLLATGWTEATDETPTAD |
Ga0181346_11182473 | 3300017780 | Freshwater Lake | MTKPNIQIDDEVREMTDEEYAELLATGWTETNEAPSPA |
Ga0181346_11255463 | 3300017780 | Freshwater Lake | MIKPNIQIDDAVREMTDDEYDALLASGWTETALDDLAG |
Ga0181346_11558541 | 3300017780 | Freshwater Lake | RPKIQIDNLVREKTAEEHEALLATGWTETDEAPTAD |
Ga0181346_11797062 | 3300017780 | Freshwater Lake | MTRPNIQIDDLVREMTEEEHEALLAAGWTETTDETLTAD |
Ga0181346_12235902 | 3300017780 | Freshwater Lake | PNIQIDDEVREMTEEEYEALLATGWTLEGTDETPTAD |
Ga0181346_13352161 | 3300017780 | Freshwater Lake | MTRPNIQIDDEVREMTQQEYEALLATGWTLEGTNETPTAD |
Ga0181348_10008668 | 3300017784 | Freshwater Lake | MTRPLIQIDDVAREMTEDEYAALLATGWTLEASSEE |
Ga0181348_11866622 | 3300017784 | Freshwater Lake | MIKPNTQIDDAVREMTDDEYNALLASGWTETASDDLAG |
Ga0181355_10418604 | 3300017785 | Freshwater Lake | MTRPNIQIDDEVREMTQEEHEALLATGWTEATDEAPTAD |
Ga0181355_11440593 | 3300017785 | Freshwater Lake | MTRPNIQVDDEIREMTDEEYADLLATGWSETNPDEVPE |
Ga0181355_11628512 | 3300017785 | Freshwater Lake | MTRPNIQIDDLVREMTEEEYEALLATGWTEATDETLTAD |
Ga0181355_13183171 | 3300017785 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLASGWTEEGTNGLA |
Ga0181359_100387012 | 3300019784 | Freshwater Lake | MTKPNIQIDDEVREMTDEEYAELLASGWTEEPTEP |
Ga0181359_100924511 | 3300019784 | Freshwater Lake | KMTRPNIQIDDEIREMTEEEYEALLATGWTMEPKDDLAG |
Ga0181359_10321672 | 3300019784 | Freshwater Lake | MTRPNIQIGDEVREMTEEEYAELLASGWTEEGKSDLAG |
Ga0181359_10396383 | 3300019784 | Freshwater Lake | MTKPNIQIDDEVREMTDEEYAELLASGWTEEPSEP |
Ga0181359_10449923 | 3300019784 | Freshwater Lake | MTRPNIQIDDEVREMTQEEYEALLATGWTLEGTDETTTAD |
Ga0181359_10472032 | 3300019784 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLASGWTEEGTNGLAG |
Ga0181359_11247532 | 3300019784 | Freshwater Lake | MTRPNIQIDDLVREMTEEEHEALLAAGWTEGTDETPTAD |
Ga0181359_11591991 | 3300019784 | Freshwater Lake | MTRPKIQIDDLVREMTAEEHEALLATGWTEATDEAPTAD |
Ga0181359_11872572 | 3300019784 | Freshwater Lake | MTRPNIQIDDLVREMTEEEHQALLATVWTEATNETP |
Ga0207193_11017273 | 3300020048 | Freshwater Lake Sediment | MALPNIQIDDKVREMTSEEYEALLATGWSEEETAKDA |
Ga0207193_11429954 | 3300020048 | Freshwater Lake Sediment | MTRPNIQIDDEIREMTEEEYQALLATGWAEEGTSGLAG |
Ga0207193_12020532 | 3300020048 | Freshwater Lake Sediment | MARPNIQIDDEVREMTEEEYAELLASGWTEESPTTPSLPGS |
Ga0211736_103381561 | 3300020151 | Freshwater | MTNPKIQIDDEVREMTDEEHQALLATGWTMEPTDETPSPA |
Ga0211736_108814931 | 3300020151 | Freshwater | MARPNIQIDDEVREMTEAEYEALLATGWTLEATDETPSPD |
Ga0194049_10905103 | 3300020157 | Anoxic Zone Freshwater | MTRPNIQIDDEVREMTEEEYQWLLSTGWTLEGTDETPTAD |
Ga0211734_112553192 | 3300020159 | Freshwater | MSKPLIQIDDEVREMTDEEYAQLLASGWTEEGPEE |
Ga0211733_103657992 | 3300020160 | Freshwater | MTRPNIQIDDEVREMTEAEYEALLATGWTLEATNDNSEPT |
Ga0211726_101232383 | 3300020161 | Freshwater | MTRPNIQIDDEVREMTEAEYEALLATGWTLEATDETLSPD |
Ga0211726_104902532 | 3300020161 | Freshwater | MTKPNIQIDDEVREMTDEEYAALLATGWTMEPTDETPSPD |
Ga0211735_112275101 | 3300020162 | Freshwater | MTRPNIQIDDEVREMTAEEYEALLATGWTLEGADETPTAG |
Ga0211729_100784582 | 3300020172 | Freshwater | MTRPNIQIDDEVREMTEVEYEALLATGWTLEATDETPSSD |
Ga0211729_104828682 | 3300020172 | Freshwater | MTRPNIQIDNEIREMTEEEYEALLATGWTEEGTSEGPA |
Ga0211729_109319263 | 3300020172 | Freshwater | MTNPKIQIDDEVREMTDEEHEALLATGWTMEPTDETPSPD |
Ga0211729_112854603 | 3300020172 | Freshwater | MTRPNIQIDDEVREMTAEEYEALLATGWTLEGTDETPTAG |
Ga0211731_103455752 | 3300020205 | Freshwater | MTRPNIQIDDEVREMTEAEYEVLLATGWTLEATDETLSPD |
Ga0211731_110800103 | 3300020205 | Freshwater | MTRPNIQIDDEVREMTAEEYEALLATGWTLEGTDETPTAD |
Ga0211731_114367659 | 3300020205 | Freshwater | MTRPNIQTDDQVREMTEAEYEALLATGWTLEGTDETPSPA |
Ga0208091_10037843 | 3300020506 | Freshwater | MTNPNIQIDDLVREMTDEEHEALLATGWTMEPKNETLTAD |
Ga0208858_10010546 | 3300020524 | Freshwater | MTKPNIQIDDEVREMTDEEYAQLLASGWTEEPIEE |
Ga0208857_10532002 | 3300020542 | Freshwater | MTKPNIQIGDEVREMTDEEYAELLATGWTMEAKDETPSPD |
Ga0207942_10027512 | 3300020549 | Freshwater | MTNPNIQIDDLVREMTDEEHEALLATGWTMEVKDETLSPD |
Ga0208486_10427123 | 3300020556 | Freshwater | MTRPNIQIDDEVREMTEEEHEALLATGWTLEGTDETPSPA |
Ga0208852_10273692 | 3300020560 | Freshwater | MNKPLIQIDDEVREMTDEEYAQLLESGWTEEGPEE |
Ga0207909_100120011 | 3300020572 | Freshwater | MSRPNIQIDNEVREMTEEEYAELLASGWTEEGTPLGGTV |
Ga0210301_13699382 | 3300021325 | Estuarine | MTRPLIQIDDVVREMTEEEHEALLATGWTEGTDETPSPA |
Ga0213920_10595804 | 3300021438 | Freshwater | MNKPQIQIDDQIREMTDEEYQTLLDSGWTPEPSAE |
Ga0194045_10122423 | 3300021516 | Anoxic Zone Freshwater | MTRPLIQIDDELREMTEEEYEALLATGWTLEGSDDLAH |
Ga0194048_100008476 | 3300021519 | Anoxic Zone Freshwater | MTRPNIQIDDEVREMTAEEYEALIASGWTEEGTNDLAG |
Ga0194048_103018292 | 3300021519 | Anoxic Zone Freshwater | MTRPNIQIDDEVREMTEEEYEVLLASGWTEEGTSDLAG |
Ga0194059_10427101 | 3300021600 | Anoxic Zone Freshwater | MTNPLIGIDDLVREMTEEEYAELLVSGWTLEGTDETPTAD |
Ga0213922_10043995 | 3300021956 | Freshwater | MTKPLIQIDDEVREMTDEEYQALIDSGWTPEPKEPSDE |
Ga0222714_100662092 | 3300021961 | Estuarine Water | MEPERPNIQIDDLVRPMTDEEYEALLATGWTLESTEVTDGD |
Ga0222714_103509702 | 3300021961 | Estuarine Water | MSKPNIQTDNIVREMTDEEYAELLASGWTLESEETSDGD |
Ga0222713_100952805 | 3300021962 | Estuarine Water | MPKPNIQIDDIVREMTEEEYAELLASGWRETTDETPSPD |
Ga0222712_1000293532 | 3300021963 | Estuarine Water | MSKPNIQIDNVVREMTDEEYAELLASGWTLETVEEDE |
Ga0222712_103614613 | 3300021963 | Estuarine Water | MTRPKIQIDDEVREMTDEEYADLIASGWTLEPQEETPTE |
Ga0222712_107511251 | 3300021963 | Estuarine Water | MNRPNIQIDDDVREMTEEEYQTLLDSGWTAEPPADNE |
Ga0212031_10054272 | 3300022176 | Aqueous | MPRPNIQIDDEVREMTEEEYAALIESGWTENAPEETTEE |
Ga0212031_10201432 | 3300022176 | Aqueous | MPRPNIQIDDEVREMTDEEYEALLASGWTEEGPADEEPA |
Ga0181353_10033254 | 3300022179 | Freshwater Lake | MPRPNIQIDDEVREMTEQEYADLIASGWTETPAEEAAPE |
Ga0196905_10130222 | 3300022198 | Aqueous | MPRPNIQIDDEVREMTEEEYAALIASGWTETAPEETPTE |
Ga0181351_10105814 | 3300022407 | Freshwater Lake | MTKPNIQIDDEVREMTDEEYAELLASGWTEEPIEE |
Ga0181351_10688173 | 3300022407 | Freshwater Lake | MTRPNIQIDDLVREMTEEEHQALLATGWTEATNETPTTD |
Ga0181351_11508612 | 3300022407 | Freshwater Lake | MTRPNIQIDDEIREMTEEEYEALLATGWTMEPKDDLAG |
Ga0214919_101181592 | 3300023184 | Freshwater | MTRPKIQIDDEVREMTEEEYQWLLDTGWTEEGSDETPTVD |
Ga0244777_106715862 | 3300024343 | Estuarine | MTRPNKQIGDEIREMTEEEYAELLASGWTLEGLDDLAD |
Ga0244775_100443044 | 3300024346 | Estuarine | MTRPNIQIDDEVREMTQEEYEALLATGWTLEGTDETPTAD |
Ga0244775_105177922 | 3300024346 | Estuarine | MIMTRPNIQLGDEVREMTEEEYEALLASGWTMEEKDELP |
Ga0244775_105916381 | 3300024346 | Estuarine | MTRPNIQTDDEVREMTEEEYEALLATGWTLEGTNETLTAD |
Ga0244775_108324591 | 3300024346 | Estuarine | MTRPNIQIDDEVREMTQEEYEALLATGWTLEGTNETPIAD |
Ga0244775_115264802 | 3300024346 | Estuarine | MKRPLIQIDDEVREMTEEEYEALLATGWTEATDETPIAD |
Ga0244776_1000146634 | 3300024348 | Estuarine | MTRPNIGIDDEVREMTEEEYEALLASGWTEEGTPLGGAV |
Ga0244776_100913573 | 3300024348 | Estuarine | MTRPNIQIDDEVREMTEEEYEALLATGWTMEPQDDLAS |
Ga0244776_102972573 | 3300024348 | Estuarine | MVRPNIQINDEIREMTEEEYEALLASGWTEEGPDDLAN |
Ga0244776_103489912 | 3300024348 | Estuarine | MTKPNIQIDDLFREMTDEEYAELLATGWTEEATEPPA |
Ga0208546_10042646 | 3300025585 | Aqueous | MTKPNIQTDDEVREMTDEEYAELLATGWTLESEETSDGD |
Ga0208004_10172204 | 3300025630 | Aqueous | MPRPNIQIDDEVREMTDEEYADLIASGWTETAPEETPTE |
Ga0208004_10441403 | 3300025630 | Aqueous | MEPERPNIQIDDLVRPMTDEEYEALLASGWTLESTEVTDGD |
Ga0208147_10620841 | 3300025635 | Aqueous | MEKPNIQIDDEIREMTDEEYQALLDSGWTADAPDTNPISDPA |
Ga0208005_11628782 | 3300025848 | Aqueous | MNKPNIQIDGEVREMTDEEYQELLDQGWTPAPEPE |
Ga0208644_100608114 | 3300025889 | Aqueous | MPRPNIQIDDEVREMTEEEYADLIASGWTETPAEEAIPE |
Ga0208644_12154934 | 3300025889 | Aqueous | MTRPNIQIDDEVREMTEEEYADLIASGWTETPQEENTPE |
Ga0208916_100137963 | 3300025896 | Aqueous | MTRPNIQIDDEIREMTEEEYEALLATGWTLEGTDETPTSD |
Ga0208916_100382134 | 3300025896 | Aqueous | MTKPNIQIDDVVREMTDEEYAELLASGWTPEPTDE |
Ga0208916_101014273 | 3300025896 | Aqueous | MTKPNIQIDDLVREMTEEEYEALLATGWKRESKDETPSPD |
Ga0208306_10502382 | 3300027214 | Estuarine | MPNPNIQIDDEVREMTDDEYAALLKSGWTEEEAPSEE |
Ga0208974_10127535 | 3300027608 | Freshwater Lentic | MTRPNIQIDDEVREMTEAEYEALLATGWTLEATDETPSPD |
Ga0208974_10370913 | 3300027608 | Freshwater Lentic | MTKPNIQIDDEIREMTDEEYADLLASGWTPDDTEPPA |
Ga0208975_11012023 | 3300027659 | Freshwater Lentic | MTRPLIQIDDVVREMTEEEHEALLATGWTLEGTDEAPSPA |
Ga0208975_11704952 | 3300027659 | Freshwater Lentic | MTKPNIQIDDEVREMTDEEYAALIASGWKETTDETPSPD |
Ga0209769_11896992 | 3300027679 | Freshwater Lake | MTRPLIQIDDEVREMTEEEHEALLATGWTEATDEAPSPA |
Ga0209704_10048155 | 3300027693 | Freshwater Sediment | MSKPNIQIDDLVREMTDEEYEALLATGWTLEGTDETPSPA |
Ga0209704_10587623 | 3300027693 | Freshwater Sediment | MTRPNIQIGDEVREMTEEEYEALLATGWTLEGTNEAPTAD |
Ga0209033_10360693 | 3300027697 | Freshwater Lake | MTNPNIQINDEVREMTDEEYAELLATGWTMEPKNETPSPD |
Ga0209033_12121401 | 3300027697 | Freshwater Lake | MSDTSSKPLIQIDDEVREMTEEEYEALLATGWTLESTNEIPLGS |
Ga0209443_11246993 | 3300027707 | Freshwater Lake | MKPLIQIDDEIREMTDEEYSELLAAGWTPEGETGTTEE |
Ga0209599_100181562 | 3300027710 | Deep Subsurface | MTRPNIQIGDEVREMTEEEFAELVAGGWTLEGTNETPTAD |
Ga0209297_100126214 | 3300027733 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTEGTDDN |
Ga0209297_10399034 | 3300027733 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTLEGTDETPTAD |
Ga0209297_11592941 | 3300027733 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTEATNETFTAD |
Ga0209087_10368322 | 3300027734 | Freshwater Lake | MARPNIQIDDEVREMTEEEYAELIESGWTEEPTEPDE |
Ga0209190_100174413 | 3300027736 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYAELLESGWTEGTDETPTAD |
Ga0209190_100561210 | 3300027736 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTLEGTDETPIAN |
Ga0209190_10106806 | 3300027736 | Freshwater Lake | MIKPNIQIDDAIREMTDDEYNALLASGWTETASDDLAG |
Ga0209190_10152325 | 3300027736 | Freshwater Lake | MTRPNIQMDDEVREMTEEEYEALLATGWTWGEPDETPTAD |
Ga0209190_12766372 | 3300027736 | Freshwater Lake | MTRPNIQIDDEVREMTEQEYADLLATGWTLEGKNETPTAD |
Ga0209597_100163312 | 3300027746 | Freshwater Lake | MSNPNIQIDDEIREMTDEEYAELLASGWTPEPTDE |
Ga0209597_100169112 | 3300027746 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYEALLATGWTEGTDETPTAD |
Ga0209596_10806522 | 3300027754 | Freshwater Lake | MIKPNIQIDDAVREMTDDEYNALLASGWTETASDDLAG |
Ga0209296_100199713 | 3300027759 | Freshwater Lake | MTRPNIQIDDEVREMTEAEYEALLATGWTLEGTDETPTAG |
Ga0209296_100329810 | 3300027759 | Freshwater Lake | MPRPNIQIDDEVREMTEEEYATLLESGWTPEEPNEK |
Ga0209296_10622466 | 3300027759 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYQALLATGWTLEGKDETPTAD |
Ga0209134_101671362 | 3300027764 | Freshwater Lake | MTRPNIQIDDEVREMTEQEYADLVARGWTLEPTYEMPTTGV |
Ga0209770_101408702 | 3300027769 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYANLLATGWTLESTDEVPSTGV |
Ga0209246_102096163 | 3300027785 | Freshwater Lake | MTRPNIQIDDEVREMTEEEYQALLATGWTLEGTDETPSPA |
Ga0209107_100134553 | 3300027797 | Freshwater And Sediment | MTRPNIQIDDEVREMTEAEYEALLATGWTLETPDETPSPA |
Ga0209107_100224244 | 3300027797 | Freshwater And Sediment | MTRPLIQIDDVVREMTEEEHEALLATGWTESTDETPSPA |
Ga0209353_103128161 | 3300027798 | Freshwater Lake | MTRPNIQIGDEVREMTEEEHEALLATGWTEATDEAPTAD |
Ga0209354_102448861 | 3300027808 | Freshwater Lake | MTRPLIQIDDEVREMTEEEYEALLATGWTLEGTDETPSPA |
Ga0209354_102902773 | 3300027808 | Freshwater Lake | MTRPNIQIDDQVREMTEEEYEALLATGWTEEGTDETPSPA |
Ga0209354_103358682 | 3300027808 | Freshwater Lake | IMTRPNIQIGDEVREMTEEEYAELLASGWTEEGKSDLAG |
Ga0209990_100139225 | 3300027816 | Freshwater Lake | MAKPNIQIDDEVREMTDEEYQALLDSGWTPEPKEPDNE |
Ga0209820_10401421 | 3300027956 | Freshwater Sediment | MSKPLIQIDDLVREMTDEEYEALLATGWTLEGTDETPSAD |
Ga0209079_102880232 | 3300027972 | Freshwater Sediment | MSKPNIQIDDEIREMTDEEYQTLLDSGWTLEGTDETPSPA |
Ga0247723_100139812 | 3300028025 | Deep Subsurface Sediment | MARPNIQIDDEVREMTEEEYEALLASGWTEEGSDGLAD |
Ga0247723_100250312 | 3300028025 | Deep Subsurface Sediment | MKRPNIQIDELVREMTEEEYADLLATGWTLESEDETPTSK |
Ga0247723_100387710 | 3300028025 | Deep Subsurface Sediment | MTYPNIQIDDEVREMTKEEYDALLATGWTEEATEPPA |
Ga0247723_10176522 | 3300028025 | Deep Subsurface Sediment | MTRPKIQIDDLVREMTEEEYSELLATGWTLEPTDEVPPTGV |
Ga0247723_10312942 | 3300028025 | Deep Subsurface Sediment | MTRPNIQIDDEVREMTEEEYEALLASGWTEEGTTEGPA |
Ga0247723_10401933 | 3300028025 | Deep Subsurface Sediment | MTRPNIQIDDEVREMTEEEYADLLASGWTEFPDAS |
Ga0247723_11488532 | 3300028025 | Deep Subsurface Sediment | MTRPNIQIDEKVREMTEEEYEALLATGWTLEGTNETPTAN |
Ga0315907_104541893 | 3300031758 | Freshwater | MARPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAG |
Ga0315900_104221552 | 3300031787 | Freshwater | MKPNIQIDDEVREMTDEEYEALLASGWSPESVEELP |
Ga0315909_1000461613 | 3300031857 | Freshwater | MARPNIQIDDEVREMTEEEYAALLAGGWTEEGPSDLA |
Ga0315909_100072122 | 3300031857 | Freshwater | MTKPLIQIDDEVREMTEEEYEALLASGWTMEPKDDLAD |
Ga0315909_100354952 | 3300031857 | Freshwater | MPNPNIQIDDVVREMTDEEYEALLASGWTEEAPVEEPA |
Ga0315909_100633633 | 3300031857 | Freshwater | MTRPNIQIDDEVREMTEEEYEELLASGWTEEGTNDLAP |
Ga0315909_101245884 | 3300031857 | Freshwater | MTRPNIQIDDEIREMTEEEYEALLASGWTEQGSDVVAS |
Ga0315909_106314502 | 3300031857 | Freshwater | MARPNIQIDDEVREMTEEEYEALLASGWTEEGPDDLAD |
Ga0315904_1000603519 | 3300031951 | Freshwater | MTRPNIQIDDEVREMTEEEYEELLASGWTEEGSNALEG |
Ga0315904_100459284 | 3300031951 | Freshwater | MTRPNIQIDDEVREMTEEEYAELIASGWTEEGKDDLAG |
Ga0315294_108167582 | 3300031952 | Sediment | RPNIQIDDEVREMTEEEYETLLASGWTDVEPVEEL |
Ga0315294_108644012 | 3300031952 | Sediment | MTRPNIQIDDEVREMTEEEYEVLLASGWTLEGTSEGPA |
Ga0315294_110978671 | 3300031952 | Sediment | MTRPKIQIDNEVRKMTEQKYADLLATGWTLEPTDEMPTTGV |
Ga0315274_106658513 | 3300031999 | Sediment | MTRPNIQIDDEVREMSEEEYEALLATGWTLEATDETPSPT |
Ga0315289_114502851 | 3300032046 | Sediment | MTRPNIQIGDLVREMTEEEYADLLASGWKLESKDETTNVG |
Ga0315906_102084212 | 3300032050 | Freshwater | MTRPNIQIDNEVREMTEEEYAALIESGWTEQGETPE |
Ga0315906_107927772 | 3300032050 | Freshwater | MTRPNIQIDDEVREMTEEEYEELLASGWTEEGTNDLA |
Ga0315284_107274433 | 3300032053 | Sediment | MTRPNIQIDDEVREMTEEEYAQLLANGWTLETPDEDTK |
Ga0315903_104770441 | 3300032116 | Freshwater | LRIPKGITMARPNIQIDDEVREMTEEEYEALLASGWTEEGTSDLAG |
Ga0315903_112372062 | 3300032116 | Freshwater | MTRPNIQIDDEVREMTEEEYEALLASGWTEEGSDGLAD |
Ga0315268_103105624 | 3300032173 | Sediment | MTRPNIQIDDEVREMTQEEYDALLATGWTEATYETPTAD |
Ga0316625_1020130703 | 3300033418 | Soil | MTRPLIQIDDEVREMTDDEYAALLEQGWTPGEEPTDD |
Ga0334992_0124479_1157_1264 | 3300033992 | Freshwater | MTRPNIQIDDEVREMTEEEYADLLASGWTEVPDAS |
Ga0334994_0357956_361_486 | 3300033993 | Freshwater | MARPNIQIDDEIREMTKEEYEALLATGWTEEAAEATRDLAD |
Ga0334994_0405816_389_535 | 3300033993 | Freshwater | MTNPLIRIDDELREMTDEEYAELLARGWTMEGTNEATIPDADTGISPE |
Ga0334996_0228975_552_674 | 3300033994 | Freshwater | MTKPNIQIDNEVREMTDEEYAELLATGWTLEGTDETPSAD |
Ga0334979_0005222_1407_1526 | 3300033996 | Freshwater | MTRPNIQIDDEVREMTEEEYEALLATGWTEGKDETPSPD |
Ga0334979_0026001_2_109 | 3300033996 | Freshwater | MTKPNIQIDDEVREMTDEEYAELIASGWKETTDETP |
Ga0334979_0041939_889_1005 | 3300033996 | Freshwater | MTKPNTQTDNEVREMTDEEYAELLATGWTETNETPSPD |
Ga0334979_0324100_91_213 | 3300033996 | Freshwater | MTKPNIQIDDEVREMTDEEYAELLATGWTMEAKDETPSPD |
Ga0334979_0367274_1_108 | 3300033996 | Freshwater | MTKPNTQTDNEVREMTDEEYAELLATGWTETNETPS |
Ga0334979_0371619_185_304 | 3300033996 | Freshwater | MTKPNIQIDDEVREMTDEEYAELIASGWKETTDETPSSD |
Ga0334979_0390220_614_736 | 3300033996 | Freshwater | MTKPNIQIDNEVREMTDEEYAELLATGWTLEGTDETPSPA |
Ga0334979_0515831_419_535 | 3300033996 | Freshwater | MTKPNIQIDDEVREMTDEEYAALLATGWTETDETPSPA |
Ga0334991_0196732_74_187 | 3300034013 | Freshwater | MTRPLIQIGDEVREMTEEEYAALEATGWKEFPDDLAD |
Ga0335004_0233721_693_809 | 3300034021 | Freshwater | MTRPNIQIDDEVREMTEEEYEALLASGWTEEGSDDLAD |
Ga0335005_0002300_3062_3184 | 3300034022 | Freshwater | MTRPNIQIDDEVREMTQEEYEALLATGWTSEGTDETPTAN |
Ga0334987_0014035_1834_1962 | 3300034061 | Freshwater | MTRPKIQIDDIGTTREMTDEEYEALLATGWTMEATDETPSPD |
Ga0334987_0734347_161_283 | 3300034061 | Freshwater | MTKPNIQIDDEVREMTDEEYAELLATGWTMEPKNETPSPD |
Ga0334995_0009812_8780_8902 | 3300034062 | Freshwater | MTRPNIQIDDIGTVREMTEEEYEALLAGGWTETNETPSPD |
Ga0334995_0217250_1039_1161 | 3300034062 | Freshwater | MTRPNIQIDDEVREMTEEEYEALLASGWTLEGTDETPTAS |
Ga0334995_0726783_239_355 | 3300034062 | Freshwater | MTRPNIQIDDEVREMTEEEYEALLASGWTEEGTNDLAG |
Ga0335019_0081461_1303_1422 | 3300034066 | Freshwater | MTRPNIQIDDEIREMTEEEYEALLATGWTEGTDETPSPA |
Ga0310130_0002366_8298_8423 | 3300034073 | Fracking Water | MTKPYIQVDEVVREMTDEEYSELVASGWTEEGTGDLTSIIQ |
Ga0310130_0019561_627_746 | 3300034073 | Fracking Water | MPRPNIQIDDEVREMTDEEYAALIESGWTETTPEEATPE |
Ga0310130_0032445_449_568 | 3300034073 | Fracking Water | MPRPNIQIDDEVREMTEEEYAVLIESGWTEIAPEEAPTE |
Ga0310130_0087979_195_314 | 3300034073 | Fracking Water | MPRPNIQIDDEVREMTEEEYADYLAALPTDIYPQEAPTE |
Ga0335020_0000090_37412_37543 | 3300034082 | Freshwater | MTRPNIQIDDEVREMTEEEYADLLASGWTEVAENNIAEEWTGE |
Ga0335020_0001785_3332_3448 | 3300034082 | Freshwater | MTRPNIQIDNEVREMTEEEYEALLASGWTEEGTTEGLV |
Ga0335010_0485930_36_152 | 3300034092 | Freshwater | MTRPQIQIADEVREMTEEEYEALLASGWTEEGTDDLAG |
Ga0335022_0057880_1502_1621 | 3300034095 | Freshwater | MTKPNIQIDDEVREMTDEEYAELLASGWKETTDETPSPD |
Ga0335027_0018607_4623_4739 | 3300034101 | Freshwater | MARPNIQIDDEVREMTEEEYEALLASGWTEEGKDDLAG |
Ga0335027_0363249_496_621 | 3300034101 | Freshwater | MTRPLIGIDGETREMTEEEYADLLATGWTLEERDETPTPNS |
Ga0335027_0506389_135_275 | 3300034101 | Freshwater | MTLPDPQTRPNIQIDDIIREMTEEEYAQLLESGWTLEGTDETPTAS |
Ga0335029_0002266_4601_4717 | 3300034102 | Freshwater | MAKPFIQIDDLLREMTEEEYEALLASGWTEEGLDDLAG |
Ga0335029_0081395_1038_1154 | 3300034102 | Freshwater | MTRPNIQIDDLVREMTEEEYEALLASGWTEEGTTEGLA |
Ga0335029_0195103_1049_1168 | 3300034102 | Freshwater | MTRPNIQIDDEVREMTEEEYSALIESGWTETPPEEATEE |
Ga0335029_0415203_398_520 | 3300034102 | Freshwater | MTKPNIQIGDEVREMTDEEYAELLATGWTLEGTDETPSPD |
Ga0335036_0000203_40093_40206 | 3300034106 | Freshwater | MTKPNIQIDDEIREMTDEEYAELLASGWTLEASEETE |
Ga0335036_0210326_1158_1280 | 3300034106 | Freshwater | MTMARPNIQIDDEVREMTEEEYAALLAGGWTEEGTDDLAP |
Ga0335036_0245264_3_116 | 3300034106 | Freshwater | PNIQIDDLVREMTDEEHEALLGTGWTMEVKDETLSPD |
Ga0335036_0443618_665_778 | 3300034106 | Freshwater | MTRPLIQIDDEVREMTDDEYAALLETGWTPGEEPTDD |
Ga0335037_0007855_4196_4318 | 3300034107 | Freshwater | MTRPNIQIDDEVREMTEEEYEALLASGWALEGTDETPLAD |
Ga0335007_0596823_40_150 | 3300034283 | Freshwater | MTRPNIQIDDEVREMTQEEYEALLATGWTEETPSTE |
Ga0335013_0224363_705_821 | 3300034284 | Freshwater | MTKPNTQTDNEVREMTDEEYAELLATGWTETNETLSPD |
Ga0335013_0748108_338_454 | 3300034284 | Freshwater | MTKPNIQIDDEVREMTDEEYAALLATGWTETDETPSPD |
⦗Top⦘ |