Basic Information | |
---|---|
Family ID | F009356 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 319 |
Average Sequence Length | 41 residues |
Representative Sequence | VPALTVALIAVGALVLANLVAALPGRIAARTPTALLLRSE |
Number of Associated Samples | 231 |
Number of Associated Scaffolds | 319 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 4.55 % |
% of genes near scaffold ends (potentially truncated) | 85.27 % |
% of genes from short scaffolds (< 2000 bps) | 85.27 % |
Associated GOLD sequencing projects | 217 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (51.411 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (13.166 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.991 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.768 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 319 Family Scaffolds |
---|---|---|
PF02687 | FtsX | 2.82 |
PF01906 | YbjQ_1 | 2.51 |
PF03461 | TRCF | 1.25 |
PF04909 | Amidohydro_2 | 1.25 |
PF00324 | AA_permease | 1.25 |
PF13450 | NAD_binding_8 | 1.25 |
PF00296 | Bac_luciferase | 1.25 |
PF09995 | MPAB_Lcp_cat | 1.25 |
PF01593 | Amino_oxidase | 0.94 |
PF16640 | Big_3_5 | 0.94 |
PF02518 | HATPase_c | 0.94 |
PF00293 | NUDIX | 0.94 |
PF00583 | Acetyltransf_1 | 0.94 |
PF00440 | TetR_N | 0.94 |
PF00589 | Phage_integrase | 0.94 |
PF03640 | Lipoprotein_15 | 0.63 |
PF00005 | ABC_tran | 0.63 |
PF14027 | Questin_oxidase | 0.63 |
PF03704 | BTAD | 0.63 |
PF12681 | Glyoxalase_2 | 0.63 |
PF01872 | RibD_C | 0.63 |
PF00171 | Aldedh | 0.63 |
PF13411 | MerR_1 | 0.63 |
PF00561 | Abhydrolase_1 | 0.63 |
PF00102 | Y_phosphatase | 0.63 |
PF12848 | ABC_tran_Xtn | 0.63 |
PF12706 | Lactamase_B_2 | 0.63 |
PF03976 | PPK2 | 0.63 |
PF01738 | DLH | 0.63 |
PF00486 | Trans_reg_C | 0.63 |
PF08818 | DUF1801 | 0.63 |
PF00547 | Urease_gamma | 0.63 |
PF06197 | DUF998 | 0.63 |
PF10604 | Polyketide_cyc2 | 0.63 |
PF12680 | SnoaL_2 | 0.31 |
PF01019 | G_glu_transpept | 0.31 |
PF01741 | MscL | 0.31 |
PF01636 | APH | 0.31 |
PF00533 | BRCT | 0.31 |
PF13565 | HTH_32 | 0.31 |
PF01740 | STAS | 0.31 |
PF01361 | Tautomerase | 0.31 |
PF01850 | PIN | 0.31 |
PF01895 | PhoU | 0.31 |
PF12826 | HHH_2 | 0.31 |
PF09922 | DUF2154 | 0.31 |
PF03706 | LPG_synthase_TM | 0.31 |
PF11288 | DUF3089 | 0.31 |
PF00009 | GTP_EFTU | 0.31 |
PF00724 | Oxidored_FMN | 0.31 |
PF13193 | AMP-binding_C | 0.31 |
PF04586 | Peptidase_S78 | 0.31 |
PF09948 | DUF2182 | 0.31 |
PF00085 | Thioredoxin | 0.31 |
PF11999 | Ice_binding | 0.31 |
PF04237 | YjbR | 0.31 |
PF00497 | SBP_bac_3 | 0.31 |
PF05239 | PRC | 0.31 |
PF01451 | LMWPc | 0.31 |
PF00271 | Helicase_C | 0.31 |
PF13460 | NAD_binding_10 | 0.31 |
PF00408 | PGM_PMM_IV | 0.31 |
PF00210 | Ferritin | 0.31 |
PF13380 | CoA_binding_2 | 0.31 |
PF12838 | Fer4_7 | 0.31 |
PF12697 | Abhydrolase_6 | 0.31 |
PF02416 | TatA_B_E | 0.31 |
PF07963 | N_methyl | 0.31 |
PF00717 | Peptidase_S24 | 0.31 |
PF00072 | Response_reg | 0.31 |
PF01804 | Penicil_amidase | 0.31 |
PF13432 | TPR_16 | 0.31 |
PF01113 | DapB_N | 0.31 |
PF14542 | Acetyltransf_CG | 0.31 |
PF14403 | CP_ATPgrasp_2 | 0.31 |
PF01041 | DegT_DnrJ_EryC1 | 0.31 |
PF01472 | PUA | 0.31 |
PF04168 | Alpha-E | 0.31 |
PF13396 | PLDc_N | 0.31 |
PF13360 | PQQ_2 | 0.31 |
PF00479 | G6PD_N | 0.31 |
PF00563 | EAL | 0.31 |
PF01381 | HTH_3 | 0.31 |
PF02811 | PHP | 0.31 |
PF11716 | MDMPI_N | 0.31 |
PF07883 | Cupin_2 | 0.31 |
PF10009 | DUF2252 | 0.31 |
PF10431 | ClpB_D2-small | 0.31 |
PF04185 | Phosphoesterase | 0.31 |
PF01814 | Hemerythrin | 0.31 |
PF03061 | 4HBT | 0.31 |
PF01297 | ZnuA | 0.31 |
PF00106 | adh_short | 0.31 |
PF01106 | NifU | 0.31 |
PF05598 | DUF772 | 0.31 |
PF01243 | Putative_PNPOx | 0.31 |
PF08379 | Bact_transglu_N | 0.31 |
PF09055 | Sod_Ni | 0.31 |
PF00664 | ABC_membrane | 0.31 |
PF03023 | MurJ | 0.31 |
PF00701 | DHDPS | 0.31 |
PF07077 | DUF1345 | 0.31 |
PF02785 | Biotin_carb_C | 0.31 |
PF13539 | Peptidase_M15_4 | 0.31 |
PF04545 | Sigma70_r4 | 0.31 |
PF08768 | THAP4_heme-bd | 0.31 |
PF13473 | Cupredoxin_1 | 0.31 |
COG ID | Name | Functional Category | % Frequency in 319 Family Scaffolds |
---|---|---|---|
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 2.51 |
COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 2.51 |
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 1.25 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 1.25 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 1.25 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 1.25 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.25 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.63 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.63 |
COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.63 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.63 |
COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.63 |
COG2453 | Protein-tyrosine phosphatase | Signal transduction mechanisms [T] | 0.63 |
COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.63 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.63 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.63 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.63 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.63 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.63 |
COG5599 | Protein tyrosine phosphatase | Signal transduction mechanisms [T] | 0.63 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.63 |
COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.31 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.31 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.31 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.31 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.31 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.31 |
COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 0.31 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.31 |
COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.31 |
COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.31 |
COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.31 |
COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.31 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.31 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.31 |
COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.31 |
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.31 |
COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
COG2307 | Uncharacterized conserved protein, Alpha-E superfamily | Function unknown [S] | 0.31 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.31 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.31 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.31 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.31 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.31 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.31 |
COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.31 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.31 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.31 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 51.41 % |
All Organisms | root | All Organisms | 48.59 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459007|GJ61VE201BFE1X | Not Available | 501 | Open in IMG/M |
3300002162|JGI24139J26690_1071342 | Not Available | 628 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100340555 | Not Available | 1381 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101416473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
3300004082|Ga0062384_100582346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 755 | Open in IMG/M |
3300004091|Ga0062387_100299018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
3300004092|Ga0062389_100952577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1042 | Open in IMG/M |
3300004152|Ga0062386_100149422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1822 | Open in IMG/M |
3300005406|Ga0070703_10470594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
3300005451|Ga0066681_10337598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
3300005467|Ga0070706_100012858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7748 | Open in IMG/M |
3300005538|Ga0070731_10181636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1397 | Open in IMG/M |
3300005559|Ga0066700_10351455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1041 | Open in IMG/M |
3300005591|Ga0070761_10099440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1675 | Open in IMG/M |
3300005610|Ga0070763_10662033 | Not Available | 609 | Open in IMG/M |
3300005952|Ga0080026_10010272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2194 | Open in IMG/M |
3300005995|Ga0066790_10137456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1047 | Open in IMG/M |
3300006028|Ga0070717_10756394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 883 | Open in IMG/M |
3300006057|Ga0075026_100096429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium → Cryptosporangium arvum | 1463 | Open in IMG/M |
3300006059|Ga0075017_100142952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1699 | Open in IMG/M |
3300006059|Ga0075017_100751221 | Not Available | 752 | Open in IMG/M |
3300006174|Ga0075014_100118497 | Not Available | 1257 | Open in IMG/M |
3300006354|Ga0075021_10429608 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300006605|Ga0074057_12208345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 585 | Open in IMG/M |
3300006638|Ga0075522_10134392 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300006638|Ga0075522_10452617 | Not Available | 600 | Open in IMG/M |
3300006860|Ga0063829_1401421 | Not Available | 717 | Open in IMG/M |
3300009012|Ga0066710_104453158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
3300009137|Ga0066709_100055141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4529 | Open in IMG/M |
3300009520|Ga0116214_1324215 | Not Available | 593 | Open in IMG/M |
3300009524|Ga0116225_1255338 | Not Available | 786 | Open in IMG/M |
3300009547|Ga0116136_1031233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1622 | Open in IMG/M |
3300009617|Ga0116123_1157372 | Not Available | 585 | Open in IMG/M |
3300009640|Ga0116126_1039429 | Not Available | 1922 | Open in IMG/M |
3300009640|Ga0116126_1187490 | Not Available | 672 | Open in IMG/M |
3300009640|Ga0116126_1265009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 535 | Open in IMG/M |
3300009644|Ga0116121_1275048 | Not Available | 541 | Open in IMG/M |
3300009646|Ga0116132_1056135 | Not Available | 1254 | Open in IMG/M |
3300009672|Ga0116215_1225723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
3300009683|Ga0116224_10101354 | Not Available | 1396 | Open in IMG/M |
3300009698|Ga0116216_10107213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1719 | Open in IMG/M |
3300009698|Ga0116216_10774390 | Not Available | 575 | Open in IMG/M |
3300009700|Ga0116217_10370487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 912 | Open in IMG/M |
3300009762|Ga0116130_1231962 | Not Available | 586 | Open in IMG/M |
3300009762|Ga0116130_1314185 | Not Available | 501 | Open in IMG/M |
3300009824|Ga0116219_10642295 | Not Available | 582 | Open in IMG/M |
3300010154|Ga0127503_10056955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300010341|Ga0074045_10460563 | Not Available | 820 | Open in IMG/M |
3300010341|Ga0074045_10882741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
3300010343|Ga0074044_10268408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1125 | Open in IMG/M |
3300010371|Ga0134125_12644638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
3300010373|Ga0134128_10831913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
3300010379|Ga0136449_100896878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1446 | Open in IMG/M |
3300010379|Ga0136449_100970989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii | 1372 | Open in IMG/M |
3300010379|Ga0136449_101957502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium SCGC AG-212-D09 | 868 | Open in IMG/M |
3300010379|Ga0136449_103103959 | Not Available | 645 | Open in IMG/M |
3300010379|Ga0136449_103166651 | Not Available | 637 | Open in IMG/M |
3300010379|Ga0136449_103226067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
3300010379|Ga0136449_104346363 | Not Available | 523 | Open in IMG/M |
3300010396|Ga0134126_10182882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2519 | Open in IMG/M |
3300010857|Ga0126354_1256714 | Not Available | 886 | Open in IMG/M |
3300010859|Ga0126352_1213739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 803 | Open in IMG/M |
3300010880|Ga0126350_10837841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
3300010880|Ga0126350_10944799 | Not Available | 573 | Open in IMG/M |
3300011119|Ga0105246_11431850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 646 | Open in IMG/M |
3300012011|Ga0120152_1141016 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300012285|Ga0137370_10495129 | Not Available | 748 | Open in IMG/M |
3300012350|Ga0137372_11158346 | Not Available | 526 | Open in IMG/M |
3300012351|Ga0137386_11074692 | Not Available | 569 | Open in IMG/M |
3300012353|Ga0137367_10052147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3073 | Open in IMG/M |
3300014155|Ga0181524_10397950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis rhizosphaerae | 602 | Open in IMG/M |
3300014159|Ga0181530_10558069 | Not Available | 564 | Open in IMG/M |
3300014162|Ga0181538_10497075 | Not Available | 642 | Open in IMG/M |
3300014164|Ga0181532_10034470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3471 | Open in IMG/M |
3300014168|Ga0181534_10392350 | Not Available | 766 | Open in IMG/M |
3300014169|Ga0181531_11036172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 516 | Open in IMG/M |
3300014199|Ga0181535_10643625 | Not Available | 606 | Open in IMG/M |
3300014200|Ga0181526_10190142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1314 | Open in IMG/M |
3300014200|Ga0181526_10711856 | Not Available | 633 | Open in IMG/M |
3300014200|Ga0181526_10992366 | Not Available | 528 | Open in IMG/M |
3300014201|Ga0181537_10489829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
3300014201|Ga0181537_10594131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 755 | Open in IMG/M |
3300014489|Ga0182018_10592014 | Not Available | 582 | Open in IMG/M |
3300014491|Ga0182014_10479263 | Not Available | 611 | Open in IMG/M |
3300014493|Ga0182016_10496474 | Not Available | 706 | Open in IMG/M |
3300014494|Ga0182017_10234162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium malmoense | 1164 | Open in IMG/M |
3300014495|Ga0182015_10004356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15309 | Open in IMG/M |
3300014495|Ga0182015_10411349 | Not Available | 872 | Open in IMG/M |
3300014495|Ga0182015_10440311 | Not Available | 837 | Open in IMG/M |
3300014495|Ga0182015_10670998 | Not Available | 655 | Open in IMG/M |
3300014495|Ga0182015_10999176 | Not Available | 519 | Open in IMG/M |
3300014499|Ga0182012_10401384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. G128 | 904 | Open in IMG/M |
3300014501|Ga0182024_10513389 | Not Available | 1521 | Open in IMG/M |
3300014501|Ga0182024_10684491 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300014501|Ga0182024_11634634 | Not Available | 729 | Open in IMG/M |
3300014501|Ga0182024_11691835 | Not Available | 713 | Open in IMG/M |
3300014638|Ga0181536_10117587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1466 | Open in IMG/M |
3300014638|Ga0181536_10176174 | Not Available | 1091 | Open in IMG/M |
3300014654|Ga0181525_10908941 | Not Available | 500 | Open in IMG/M |
3300014658|Ga0181519_10241319 | Not Available | 1129 | Open in IMG/M |
3300014820|Ga0120160_1045728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 773 | Open in IMG/M |
3300014838|Ga0182030_10088956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4376 | Open in IMG/M |
3300014839|Ga0182027_10219466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2193 | Open in IMG/M |
3300014839|Ga0182027_11293068 | Not Available | 728 | Open in IMG/M |
3300016404|Ga0182037_10302743 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300016702|Ga0181511_1098192 | Not Available | 584 | Open in IMG/M |
3300017925|Ga0187856_1251082 | Not Available | 623 | Open in IMG/M |
3300017933|Ga0187801_10378851 | Not Available | 585 | Open in IMG/M |
3300017940|Ga0187853_10104867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1388 | Open in IMG/M |
3300017942|Ga0187808_10418108 | Not Available | 614 | Open in IMG/M |
3300017946|Ga0187879_10378064 | Not Available | 785 | Open in IMG/M |
3300017946|Ga0187879_10745149 | Not Available | 546 | Open in IMG/M |
3300017948|Ga0187847_10282033 | Not Available | 907 | Open in IMG/M |
3300017970|Ga0187783_11334987 | Not Available | 517 | Open in IMG/M |
3300017972|Ga0187781_10061575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2583 | Open in IMG/M |
3300017973|Ga0187780_10936880 | Not Available | 630 | Open in IMG/M |
3300017974|Ga0187777_10764753 | Not Available | 688 | Open in IMG/M |
3300018001|Ga0187815_10424580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300018002|Ga0187868_1012604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 4330 | Open in IMG/M |
3300018008|Ga0187888_1264892 | Not Available | 666 | Open in IMG/M |
3300018016|Ga0187880_1077192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1695 | Open in IMG/M |
3300018017|Ga0187872_10339597 | Not Available | 647 | Open in IMG/M |
3300018019|Ga0187874_10389028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planotetraspora → Planotetraspora kaengkrachanensis | 563 | Open in IMG/M |
3300018021|Ga0187882_1301882 | Not Available | 614 | Open in IMG/M |
3300018021|Ga0187882_1347598 | Not Available | 565 | Open in IMG/M |
3300018026|Ga0187857_10366712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
3300018032|Ga0187788_10072141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1208 | Open in IMG/M |
3300018034|Ga0187863_10752097 | Not Available | 552 | Open in IMG/M |
3300018035|Ga0187875_10173530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1198 | Open in IMG/M |
3300018035|Ga0187875_10273428 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300018037|Ga0187883_10586003 | Not Available | 578 | Open in IMG/M |
3300018038|Ga0187855_10098696 | Not Available | 1766 | Open in IMG/M |
3300018038|Ga0187855_10691489 | Not Available | 594 | Open in IMG/M |
3300018038|Ga0187855_10823253 | Not Available | 542 | Open in IMG/M |
3300018038|Ga0187855_10903201 | Not Available | 516 | Open in IMG/M |
3300018040|Ga0187862_10128317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1730 | Open in IMG/M |
3300018040|Ga0187862_10223349 | Not Available | 1223 | Open in IMG/M |
3300018042|Ga0187871_10601636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
3300018042|Ga0187871_10759884 | Not Available | 540 | Open in IMG/M |
3300018043|Ga0187887_10441964 | Not Available | 767 | Open in IMG/M |
3300018043|Ga0187887_10751021 | Not Available | 576 | Open in IMG/M |
3300018044|Ga0187890_10195890 | Not Available | 1147 | Open in IMG/M |
3300018044|Ga0187890_10405804 | Not Available | 764 | Open in IMG/M |
3300018046|Ga0187851_10788840 | Not Available | 534 | Open in IMG/M |
3300018046|Ga0187851_10881359 | Not Available | 503 | Open in IMG/M |
3300018047|Ga0187859_10535334 | Not Available | 655 | Open in IMG/M |
3300018047|Ga0187859_10670261 | Not Available | 588 | Open in IMG/M |
3300018060|Ga0187765_10694289 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300018090|Ga0187770_10885842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
3300019082|Ga0187852_1191793 | Not Available | 847 | Open in IMG/M |
3300019260|Ga0181506_1007649 | Not Available | 592 | Open in IMG/M |
3300019786|Ga0182025_1222666 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
3300019787|Ga0182031_1421771 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
3300020061|Ga0193716_1098050 | Not Available | 1263 | Open in IMG/M |
3300020061|Ga0193716_1119165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
3300021180|Ga0210396_11668040 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300021181|Ga0210388_11001794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
3300021181|Ga0210388_11119513 | Not Available | 671 | Open in IMG/M |
3300021181|Ga0210388_11365132 | Not Available | 596 | Open in IMG/M |
3300021402|Ga0210385_10005918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 7361 | Open in IMG/M |
3300021432|Ga0210384_10800936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 840 | Open in IMG/M |
3300021433|Ga0210391_11187133 | Not Available | 591 | Open in IMG/M |
3300021433|Ga0210391_11218267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 582 | Open in IMG/M |
3300021478|Ga0210402_10490362 | Not Available | 1141 | Open in IMG/M |
3300021478|Ga0210402_10898350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 812 | Open in IMG/M |
3300021479|Ga0210410_11091753 | Not Available | 688 | Open in IMG/M |
3300021860|Ga0213851_1738725 | Not Available | 640 | Open in IMG/M |
3300023090|Ga0224558_1007069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 7607 | Open in IMG/M |
3300023090|Ga0224558_1228643 | Not Available | 544 | Open in IMG/M |
3300023101|Ga0224557_1136726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 927 | Open in IMG/M |
3300023259|Ga0224551_1013018 | Not Available | 1394 | Open in IMG/M |
3300024225|Ga0224572_1092828 | Not Available | 557 | Open in IMG/M |
3300024279|Ga0247692_1075632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
3300025427|Ga0208077_1020671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
3300025453|Ga0208455_1093082 | Not Available | 581 | Open in IMG/M |
3300025500|Ga0208686_1073928 | Not Available | 755 | Open in IMG/M |
3300025679|Ga0207933_1185299 | Not Available | 587 | Open in IMG/M |
3300025857|Ga0209014_10231058 | Not Available | 625 | Open in IMG/M |
3300025910|Ga0207684_10342221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1288 | Open in IMG/M |
3300025928|Ga0207700_11194246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 679 | Open in IMG/M |
3300026217|Ga0209871_1006735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2194 | Open in IMG/M |
3300026217|Ga0209871_1108894 | Not Available | 541 | Open in IMG/M |
3300026294|Ga0209839_10017980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2818 | Open in IMG/M |
3300026294|Ga0209839_10135204 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300026450|Ga0247847_1006730 | Not Available | 1741 | Open in IMG/M |
3300027568|Ga0208042_1091348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
3300027619|Ga0209330_1025134 | Not Available | 1346 | Open in IMG/M |
3300027641|Ga0208827_1109080 | Not Available | 812 | Open in IMG/M |
3300027662|Ga0208565_1121587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
3300027662|Ga0208565_1152513 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300027696|Ga0208696_1167493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
3300027745|Ga0209908_10100377 | Not Available | 715 | Open in IMG/M |
3300027768|Ga0209772_10129324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 787 | Open in IMG/M |
3300027824|Ga0209040_10095092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1696 | Open in IMG/M |
3300027824|Ga0209040_10525893 | Not Available | 519 | Open in IMG/M |
3300027826|Ga0209060_10175151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 992 | Open in IMG/M |
3300027869|Ga0209579_10121600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1387 | Open in IMG/M |
3300027894|Ga0209068_10331709 | Not Available | 859 | Open in IMG/M |
3300027905|Ga0209415_10305072 | Not Available | 1369 | Open in IMG/M |
3300027905|Ga0209415_10718101 | Not Available | 712 | Open in IMG/M |
3300027908|Ga0209006_10680553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
3300027911|Ga0209698_11138254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | 577 | Open in IMG/M |
3300027915|Ga0209069_10497722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
3300027915|Ga0209069_10546591 | Not Available | 659 | Open in IMG/M |
3300027986|Ga0209168_10309879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
3300028069|Ga0255358_1023643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 857 | Open in IMG/M |
3300028536|Ga0137415_10189621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1879 | Open in IMG/M |
3300028779|Ga0302266_10064280 | Not Available | 1586 | Open in IMG/M |
3300028806|Ga0302221_10520928 | Not Available | 519 | Open in IMG/M |
3300028808|Ga0302228_10430562 | Not Available | 584 | Open in IMG/M |
3300028867|Ga0302146_10164738 | Not Available | 888 | Open in IMG/M |
3300028879|Ga0302229_10307104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
3300028882|Ga0302154_10561663 | Not Available | 539 | Open in IMG/M |
3300029907|Ga0311329_11039905 | Not Available | 505 | Open in IMG/M |
3300029911|Ga0311361_10827599 | Not Available | 813 | Open in IMG/M |
3300029913|Ga0311362_10721849 | Not Available | 847 | Open in IMG/M |
3300029922|Ga0311363_10803787 | Not Available | 866 | Open in IMG/M |
3300029943|Ga0311340_10210570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1945 | Open in IMG/M |
3300029943|Ga0311340_10501739 | Not Available | 1085 | Open in IMG/M |
3300029951|Ga0311371_10554817 | Not Available | 1494 | Open in IMG/M |
3300029951|Ga0311371_11608927 | Not Available | 715 | Open in IMG/M |
3300029952|Ga0311346_10203395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2208 | Open in IMG/M |
3300029953|Ga0311343_10896742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. G128 | 709 | Open in IMG/M |
3300029953|Ga0311343_11070778 | Not Available | 627 | Open in IMG/M |
3300029994|Ga0302283_1231612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 671 | Open in IMG/M |
3300029999|Ga0311339_10126539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3067 | Open in IMG/M |
3300029999|Ga0311339_10563589 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300029999|Ga0311339_11639419 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300030007|Ga0311338_11300815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300030013|Ga0302178_10359671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
3300030051|Ga0302195_10326142 | Not Available | 675 | Open in IMG/M |
3300030056|Ga0302181_10307641 | Not Available | 702 | Open in IMG/M |
3300030056|Ga0302181_10366249 | Not Available | 627 | Open in IMG/M |
3300030399|Ga0311353_11410988 | Not Available | 567 | Open in IMG/M |
3300030490|Ga0302184_10117141 | Not Available | 1186 | Open in IMG/M |
3300030503|Ga0311370_11945545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
3300030518|Ga0302275_10076153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2355 | Open in IMG/M |
3300030520|Ga0311372_11300616 | Not Available | 919 | Open in IMG/M |
3300030520|Ga0311372_12808037 | Not Available | 535 | Open in IMG/M |
3300030580|Ga0311355_10004027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 20100 | Open in IMG/M |
3300030617|Ga0311356_10015133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8437 | Open in IMG/M |
3300030617|Ga0311356_10152594 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
3300030618|Ga0311354_10043495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 5286 | Open in IMG/M |
3300030618|Ga0311354_11439808 | Not Available | 612 | Open in IMG/M |
3300030618|Ga0311354_11764650 | Not Available | 539 | Open in IMG/M |
3300030659|Ga0316363_10170013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
3300030739|Ga0302311_10205642 | Not Available | 1488 | Open in IMG/M |
3300030862|Ga0265753_1107313 | Not Available | 572 | Open in IMG/M |
3300031028|Ga0302180_10200160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1075 | Open in IMG/M |
3300031234|Ga0302325_10291776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2659 | Open in IMG/M |
3300031234|Ga0302325_10738028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1407 | Open in IMG/M |
3300031234|Ga0302325_10930311 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300031234|Ga0302325_12062679 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300031234|Ga0302325_13171351 | Not Available | 526 | Open in IMG/M |
3300031236|Ga0302324_100350103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2233 | Open in IMG/M |
3300031236|Ga0302324_100543887 | Not Available | 1682 | Open in IMG/M |
3300031236|Ga0302324_101811627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
3300031236|Ga0302324_102843666 | Not Available | 581 | Open in IMG/M |
3300031261|Ga0302140_10387643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
3300031524|Ga0302320_11503850 | Not Available | 662 | Open in IMG/M |
3300031524|Ga0302320_11677318 | Not Available | 614 | Open in IMG/M |
3300031525|Ga0302326_10688948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1497 | Open in IMG/M |
3300031525|Ga0302326_10773383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1389 | Open in IMG/M |
3300031525|Ga0302326_11317500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
3300031525|Ga0302326_11955389 | Not Available | 760 | Open in IMG/M |
3300031525|Ga0302326_13388906 | Not Available | 533 | Open in IMG/M |
3300031525|Ga0302326_13590267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
3300031543|Ga0318516_10031443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2804 | Open in IMG/M |
3300031543|Ga0318516_10559867 | Not Available | 654 | Open in IMG/M |
3300031545|Ga0318541_10355724 | Not Available | 818 | Open in IMG/M |
3300031640|Ga0318555_10310086 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300031670|Ga0307374_10640023 | Not Available | 527 | Open in IMG/M |
3300031708|Ga0310686_102200475 | Not Available | 557 | Open in IMG/M |
3300031708|Ga0310686_117475226 | Not Available | 657 | Open in IMG/M |
3300031744|Ga0306918_10542528 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300031753|Ga0307477_10280507 | Not Available | 1152 | Open in IMG/M |
3300031769|Ga0318526_10022685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2213 | Open in IMG/M |
3300031797|Ga0318550_10005275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4592 | Open in IMG/M |
3300031903|Ga0307407_11213973 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300031910|Ga0306923_12268378 | Not Available | 542 | Open in IMG/M |
3300032160|Ga0311301_10756502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 1348 | Open in IMG/M |
3300032160|Ga0311301_11227882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300032164|Ga0315283_10139113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 2582 | Open in IMG/M |
3300032164|Ga0315283_11310945 | Not Available | 750 | Open in IMG/M |
3300032180|Ga0307471_102259324 | Not Available | 686 | Open in IMG/M |
3300032805|Ga0335078_10317588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2085 | Open in IMG/M |
3300032805|Ga0335078_10581502 | Not Available | 1417 | Open in IMG/M |
3300032893|Ga0335069_10806517 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300032895|Ga0335074_10065738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4923 | Open in IMG/M |
3300032895|Ga0335074_10598455 | Not Available | 1102 | Open in IMG/M |
3300032895|Ga0335074_10790489 | Not Available | 888 | Open in IMG/M |
3300032896|Ga0335075_11462388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
3300032896|Ga0335075_11682952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
3300032898|Ga0335072_10698651 | Not Available | 993 | Open in IMG/M |
3300033134|Ga0335073_10141945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3052 | Open in IMG/M |
3300033402|Ga0326728_10020211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12752 | Open in IMG/M |
3300033405|Ga0326727_10236217 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
3300033755|Ga0371489_0450819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
3300033887|Ga0334790_020188 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
3300033982|Ga0371487_0035195 | Not Available | 3112 | Open in IMG/M |
3300033982|Ga0371487_0047551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2530 | Open in IMG/M |
3300033983|Ga0371488_0168380 | Not Available | 1131 | Open in IMG/M |
3300034091|Ga0326724_0471245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 649 | Open in IMG/M |
3300034124|Ga0370483_0255781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. DBS9H8 | 600 | Open in IMG/M |
3300034124|Ga0370483_0261487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
3300034199|Ga0370514_018099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1696 | Open in IMG/M |
3300034199|Ga0370514_139709 | Not Available | 624 | Open in IMG/M |
3300034282|Ga0370492_0122707 | Not Available | 1062 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 13.17% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.91% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.96% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.02% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.39% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.45% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.13% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.82% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.82% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.19% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.19% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.88% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.88% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.57% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.57% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.57% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.57% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.57% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.57% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.25% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.25% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.94% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.94% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.31% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.31% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.31% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.31% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.31% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.63% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.63% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.63% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.63% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
3300002162 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-21A | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300014820 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0.25M | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026450 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T25 | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
L02_06543590 | 2170459007 | Grass Soil | PIVPTLTVVLIGVGGVVLANLVAAIPARSAAKTPTSVLLRAE |
JGI24139J26690_10713422 | 3300002162 | Arctic Peat Soil | PATTILLVAVGALILANLVAVLPGRIAARTPTAVLLRAE* |
JGIcombinedJ26739_1003405551 | 3300002245 | Forest Soil | VPEPTVPGLWVILIVVGAVLLANLVAVVPGRVAARTPTALLLRAE* |
JGIcombinedJ26739_1014164731 | 3300002245 | Forest Soil | PEPTVPGLWVILIVVGAVLLANLVAVVPGRIAARTPTALLLRAE* |
Ga0062384_1005823461 | 3300004082 | Bog Forest Soil | IYAVPDPSVPVVEVLVVALGALVLANLVAAVPGRMAARTHTALVLRAE* |
Ga0062387_1002990182 | 3300004091 | Bog Forest Soil | SPAVTAIPIVAIAVGALALGNLVAAVPGRIAARTPAALLLRAE* |
Ga0062389_1009525772 | 3300004092 | Bog Forest Soil | VSVASIVLVAVGTLVLANVVAAFPARTAARTPTAIMLRAE* |
Ga0062386_1001494221 | 3300004152 | Bog Forest Soil | VPDPTVPVLSLLLVAVGALLFANVVAAFPGRAAARTPTALLLRAE* |
Ga0070703_104705941 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | RPTVPALPLACIGLGALVLANVAAALPGRYAARTPTALVLRTE* |
Ga0066681_103375981 | 3300005451 | Soil | ELHAVARPSVPTLSIVLVAIGALVLANVVAAVPGRIAARTPTALLLRAQ* |
Ga0070706_1000128587 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVPLVVYVGLGALVLANAVAALSARYAARTPAALVLRAE* |
Ga0070731_101816363 | 3300005538 | Surface Soil | LLVTAIGLAAIVLANLVAVVPGRIAARTQTGLLLRTE* |
Ga0066700_103514551 | 3300005559 | Soil | SVILVALGALVLANLVAALPGRSAAGTPAAAVLRTS* |
Ga0070761_100994403 | 3300005591 | Soil | TVPVVTLVLIALGALLLANVVAALPGRIAARTPTALLLRAE* |
Ga0070763_106620331 | 3300005610 | Soil | GSMALAAVAALVLANLVAAVPGRQAARTPAAEVLRTE* |
Ga0080026_100102721 | 3300005952 | Permafrost Soil | AWTVVLIAVGALVLANVVAAFPARVAARTPTALLLRAE* |
Ga0066790_101374563 | 3300005995 | Soil | PTVPVWPVILIALGALVLANVAAAVPGRIAARTPAAGLLRAQ* |
Ga0070717_107563942 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PLACIGLGALVLANVAAALPGRYAARTPTALVLRTE* |
Ga0075026_1000964291 | 3300006057 | Watersheds | FPSIVLVAVGALVLANVVAAIPARNAARTSATLLLRAE* |
Ga0075017_1001429521 | 3300006059 | Watersheds | IALIAVGALVLANLVAAVPGRQAARTKTAVLLRAE* |
Ga0075017_1007512213 | 3300006059 | Watersheds | VPIVPALSIVVIAVGALVLGNLVATLPGLIAARTKAAQLLRAE* |
Ga0075014_1001184971 | 3300006174 | Watersheds | VLVGVGALIFANVVAALPGRMASRTPTALVLRAE* |
Ga0075021_104296082 | 3300006354 | Watersheds | PTVPVVTVVAIVVGALVLANIVAAIPGRVAARTPTALLLRAE* |
Ga0074057_122083451 | 3300006605 | Soil | ILIVLGALVLANIAAAIPGRIAARTPAAGLLRAQ* |
Ga0075522_101343921 | 3300006638 | Arctic Peat Soil | ILSVALVAAGALLFTNVVAALPGRSAARIPIGLVLRAE* |
Ga0075522_104526172 | 3300006638 | Arctic Peat Soil | LLYIAVGALVLANLVAAIPGRIASRTSTALVLRAE* |
Ga0063829_14014212 | 3300006860 | Peatlands Soil | VLIAFGALVFATIAAAIPGRIAARTPTALLLRSE* |
Ga0066710_1044531581 | 3300009012 | Grasslands Soil | LPVIPRPSVPTLSIVLIATGALVLANVVASIPGRIAARTPAALLLRAE |
Ga0066709_1000551413 | 3300009137 | Grasslands Soil | MSIVLIAVAALVLANIVAAIPGRHAARTTTALLLRAE* |
Ga0116214_13242152 | 3300009520 | Peatlands Soil | VLIALGALVFANLAAAVPGRIAARTSTALLLRTE* |
Ga0116225_12553382 | 3300009524 | Peatlands Soil | SIVLIAVGALVLANVVAAAPGRIAARTPTALLLRSE* |
Ga0116136_10312332 | 3300009547 | Peatland | VPALEVVLVALGALVLANLVAAVPGQMAARTPTALILRAE* |
Ga0116123_11573721 | 3300009617 | Peatland | SVPVVSVSLIALGAIVLANVVAALPGRLAARTPTALLLHSE* |
Ga0116126_10394293 | 3300009640 | Peatland | PVVSVTLIALGALVLANVVAAPPGRLAARTPTALLLHSE* |
Ga0116126_11874901 | 3300009640 | Peatland | ALAIVAIALGALGLGNLVAAIPGRIAARTPAALLLRTE* |
Ga0116126_12650092 | 3300009640 | Peatland | PTVPALAIVAITFGGLVLGNLVAAIPGRIAARTPVALLLRTE* |
Ga0116121_12750481 | 3300009644 | Peatland | LPLVLVGVGALLLANVIAALPGRYASRTPTALVLRAE* |
Ga0116132_10561352 | 3300009646 | Peatland | PLATVPALPLVCVGLGALVLANIVAAIPGRYAARAPTALVLRAE* |
Ga0116215_12257231 | 3300009672 | Peatlands Soil | PIFAIALGALVLGNLVAAVPGRIAARTPAALLLRTE* |
Ga0116224_101013542 | 3300009683 | Peatlands Soil | YAVPLPTVPVLEIVLVALGALVLANLVAAVPGQMAARTPTALVLRAE* |
Ga0116216_101072133 | 3300009698 | Peatlands Soil | PDPTVPVASMVLIALGALVFANLAAAVPGRIAARTSTALLLQTE* |
Ga0116216_107743901 | 3300009698 | Peatlands Soil | ALSMVLIALGALCFANVVAAIPGRIAARTPITLVLHSE* |
Ga0116217_103704872 | 3300009700 | Peatlands Soil | QVVLVAVGAVVLANLVAAVPGRMAARTRTALLLRTE* |
Ga0116130_12319622 | 3300009762 | Peatland | PVLEVLMVALATIVLANLVAAIPGRMAARTPTALVLRAE* |
Ga0116130_13141851 | 3300009762 | Peatland | TVPLLALVLLAIGALVLVNLAAAIPGRIAARMPTALLLREE* |
Ga0116219_106422951 | 3300009824 | Peatlands Soil | GTVLLVGMAALALANLAAALPGRLAARTPTALLLRAE* |
Ga0127503_100569551 | 3300010154 | Soil | LACIGLGALVLANAAAALPGRYAARTPTALVLRTE* |
Ga0074045_104605631 | 3300010341 | Bog Forest Soil | PTVPVVAVILVGVGALVFANVVAALPGQLAARTPTALVLSAE* |
Ga0074045_108827412 | 3300010341 | Bog Forest Soil | VPSVLIAGMVVGALALANIVAAVPGRIAARTPTSLLLRAE* |
Ga0074044_102684082 | 3300010343 | Bog Forest Soil | APAVPAAAIVFLALGALLLANIVAAVPGRLAARTPPASLLRAE* |
Ga0134125_126446382 | 3300010371 | Terrestrial Soil | VALIAVGAVVLANIIAALPARIAARTPTAVLLRSE* |
Ga0134128_108319131 | 3300010373 | Terrestrial Soil | ITVITLGAIVLANIVAAAPGRSAARTSTAVLLRAE* |
Ga0136449_1008968782 | 3300010379 | Peatlands Soil | VPDPNVPALSIVLVALGALVFANLVAIIPGRAAARTPTAVLLRTE* |
Ga0136449_1009709891 | 3300010379 | Peatlands Soil | VPLPTVPILEVVLVALGALVLANLVAAVPGQMAARTPTALVLRAE* |
Ga0136449_1019575022 | 3300010379 | Peatlands Soil | LVLVGLGTLLLANLVAALPGRYASRTPTALVLRAE* |
Ga0136449_1031039592 | 3300010379 | Peatlands Soil | ALTVTAIAIGSLVLANVVAALPGRIAARTPAGLLLRAE* |
Ga0136449_1031666511 | 3300010379 | Peatlands Soil | TTTPAIPAPTIAVASIIIVVFGAIVLANIVAAVPGRIAARTRTALLLRSE* |
Ga0136449_1032260672 | 3300010379 | Peatlands Soil | MTRVTAPTVSALSVVLITLGALVVANVVASIPRRIAARTPMALLLQAE* |
Ga0136449_1043463632 | 3300010379 | Peatlands Soil | FAVSDPTVPVLQVVLGALVLANLVAAIPGRIAARTPTALLLRIQ* |
Ga0134126_101828823 | 3300010396 | Terrestrial Soil | VFIALGAMALANAVAFVPGRIAARTPTAQLLRQE* |
Ga0126354_12567143 | 3300010857 | Boreal Forest Soil | SGITLIAIGALVLANLVAAFPGLQAARTRTAVLLRAE* |
Ga0126352_12137391 | 3300010859 | Boreal Forest Soil | MPTVPAVTVVLIALGALILANLVAAVPGRLAARTPTAVLLRSE* |
Ga0126350_108378412 | 3300010880 | Boreal Forest Soil | VEIVLVALGALVLANAVAAIPGRIAARTSTAFILRAE* |
Ga0126350_109447991 | 3300010880 | Boreal Forest Soil | LPAVPVGAVAAIGAGSLVFANVAAALPGRLAARTSTASLLHAE* |
Ga0105246_114318502 | 3300011119 | Miscanthus Rhizosphere | ACIGLGALVLANVAAALPGRYAARTPTALVLRTE* |
Ga0120152_11410162 | 3300012011 | Permafrost | PLSIALIAGGALVLANIVAAIPARSAARTPTALLLRAE* |
Ga0137370_104951291 | 3300012285 | Vadose Zone Soil | NVPIAPVALVAIGAVVLANVVAAIPGRVAARTPAALALRTE* |
Ga0137372_111583461 | 3300012350 | Vadose Zone Soil | LTIMLVAVIALVLANVVAAIPALEAARTRTAMLLHAE* |
Ga0137386_110746921 | 3300012351 | Vadose Zone Soil | PVILISFGALALANIVAAVPGRVAARTPTALLLRAE* |
Ga0137367_100521471 | 3300012353 | Vadose Zone Soil | KIPWVALVLIVPGVIALANLIALVPGRIAARTEAARILRSE* |
Ga0181524_103979501 | 3300014155 | Bog | LLVALGTLVLANVVAAVPARDAARTPTALMLRAE* |
Ga0181530_105580691 | 3300014159 | Bog | VPDPTVPVLSVVLVAFGALLFANVVAALPGRIAARTPTALVLRAE* |
Ga0181538_104970752 | 3300014162 | Bog | LILVGLGALLLANVVAALAGRYASRTPTALVLRAE* |
Ga0181532_100344705 | 3300014164 | Bog | LQVFVVGVAALVLANLVAAVPGRMAARTPTALVLRAE* |
Ga0181534_103923502 | 3300014168 | Bog | VIVAIAFGALVLGNLVAALPGRTAARTPAALLLRTE* |
Ga0181531_110361722 | 3300014169 | Bog | EINAVAAPSVPALLVVLIAAGGLVVANLVAAVPGRIAARTPTAVVLRSE* |
Ga0181535_106436252 | 3300014199 | Bog | TVLSVVLVVLGALVFGNLVAAFPGRSASRTPTALVLRTE* |
Ga0181526_101901423 | 3300014200 | Bog | YAVPRPSVPALEVLVVVGVTIVLANLVAALPGRMAARTATALVLRAE* |
Ga0181526_107118561 | 3300014200 | Bog | AVVDPTVPLLPLLLVAVGALVLANLVAALPGHRAARTPTALVLRAE* |
Ga0181526_109923662 | 3300014200 | Bog | VPAAVIAAIAVGALVLGNLVAAIPGRIAARTPAALLLRTE* |
Ga0181537_104898292 | 3300014201 | Bog | VPNTSIPAIAIVVVGVGTVVFANVVAAIPGRIAATTSTALVLRTE* |
Ga0181537_105941311 | 3300014201 | Bog | VAAPSVPALLVVLIAAGGLVVANLVAAVPGRIAARTPTAVVLRSE* |
Ga0182018_105920141 | 3300014489 | Palsa | VPAPSVPTLSVVLIALGALVLANVVAVLPGRMAARTPTALLLRAE* |
Ga0182014_104792631 | 3300014491 | Bog | VVLVVLGALIFANLVAAFPGRTASHTPTALVLRTE* |
Ga0182016_104964742 | 3300014493 | Bog | PAPSIPVLSIVLIALGALLLANVVAAIPGRIAARTPTALILRAE* |
Ga0182017_102341621 | 3300014494 | Fen | VLEVVVVALAALVLANLVAAIPGRMAARTPTALVLRAE* |
Ga0182015_100043568 | 3300014495 | Palsa | VPHPTVPVLEVVLVAVVTIVPMNLVAAIPGRMAARTPTGLALRAE* |
Ga0182015_104113492 | 3300014495 | Palsa | LSVTLIILGGLVLANVVAAIPGRIAARTPTSLMLRAE* |
Ga0182015_104403112 | 3300014495 | Palsa | AVPIVLVVVGTLVLANLVAAIPGRNAARTPTALVLRAE* |
Ga0182015_106709983 | 3300014495 | Palsa | DPSVPVLSVVLIAIGALVLANLVAAVPGRIAARTQTALLLQSE* |
Ga0182015_109991761 | 3300014495 | Palsa | VYIALGALVLANLVAAVPGRIAARTSTAIVLHAE* |
Ga0182012_104013841 | 3300014499 | Bog | PAPSVPAQVIALIVIGALVLANLVAAVPGRLAARTPTALLLRAE* |
Ga0182024_105133893 | 3300014501 | Permafrost | VPDPTVPVLSVVLVALGALVFANVVAAIPGRIAARTPTALVLRAE* |
Ga0182024_106844911 | 3300014501 | Permafrost | PNVPAITVVLIAVGALILANVVAAIPGRIAARTPTALVLRSE* |
Ga0182024_116346342 | 3300014501 | Permafrost | VVVLIALGAIVLGNLVAALPARMAARTSTALLSRAE* |
Ga0182024_116918352 | 3300014501 | Permafrost | SIVLIALAALVLANVVAAIPGRVAARTPTALVLRAE* |
Ga0181536_101175871 | 3300014638 | Bog | ILVAVAALALANVVAAVPARIAARTPTALMLRAE* |
Ga0181536_101761743 | 3300014638 | Bog | LYVVAIAAGAVVLSNVVAAVPARIAAHTPTAVLLRSE* |
Ga0181525_109089411 | 3300014654 | Bog | IVLIVVGGLVLANIVAGMPGRIAARTPTALLLRAE* |
Ga0181519_102413192 | 3300014658 | Bog | APSVPVLTVVLIAVGTMVLGNIVAALPARLAARTQTALLLRAE* |
Ga0120160_10457281 | 3300014820 | Permafrost | PAPSLAAIAFAALVLANVVAAIPGRIAARTPTALLLRTQ* |
Ga0182030_100889561 | 3300014838 | Bog | PSPSVPILSVALIVVSAMVLANLVAAIPGRVAAKTSTALLLRAE* |
Ga0182027_102194662 | 3300014839 | Fen | VPVLEVVLVAVVTIVLANLVAAIPGRMAARTPTGLALRAE* |
Ga0182027_112930682 | 3300014839 | Fen | VSLIALGAIVLANVVAALPGRLAARTPTALLLHSE* |
Ga0182037_103027431 | 3300016404 | Soil | TVVLIAAGALVLANIVAAVPGRMAGRTPTALLLHAE |
Ga0181511_10981922 | 3300016702 | Peatland | PTPTVPATTILLVAVGALILANLVAVLPGRIAARTPTAVLLRAE |
Ga0187856_12510821 | 3300017925 | Peatland | SVPVVSVSLIALGAIVLANVVAALPGRLAARTPTALLLHSE |
Ga0187801_103788511 | 3300017933 | Freshwater Sediment | NAVPAPMTPVPQVLLIALGALVIANVVAAFPGRLAAQTPVALVLRGE |
Ga0187853_101048671 | 3300017940 | Peatland | PTVPVLSMVLVALGGLVFANLVAAVPGRIAARTPTALLHRSE |
Ga0187808_104181082 | 3300017942 | Freshwater Sediment | VSALTIAAIAAGALVLGNLVAAVPGRIAARTPAALLLRTE |
Ga0187879_103780642 | 3300017946 | Peatland | VLLVGLGALIFANLVAAIPGRTASRTPTALVLRTE |
Ga0187879_107451492 | 3300017946 | Peatland | YAVPSPTVPIASVLLIVASAMVLANIVAAIPGRVAAKTSTALLLRAE |
Ga0187847_102820332 | 3300017948 | Peatland | PVLPVILVALGALVLANIAAAIPGRLAAGTPAAGLLQAQ |
Ga0187847_108060282 | 3300017948 | Peatland | AQQIYAVPRATVPALSLVYVALGALVLANLVAALPGRHASRTPAAIVLRTE |
Ga0187783_113349872 | 3300017970 | Tropical Peatland | IYAVPHVSVPVATVVLIAVGALALANVVALIPGHVARKTPTALLLRSE |
Ga0187781_100615751 | 3300017972 | Tropical Peatland | VVPEPTVPGVPVILIVVGALVLANIVALVPGRVAGRTPAALLLRAE |
Ga0187780_109368802 | 3300017973 | Tropical Peatland | IPPLSVLAVALGALVLANVVAAVPARLAARTPTATLLRAE |
Ga0187777_107647532 | 3300017974 | Tropical Peatland | GAAMVAIALGAVVLANLVAAIPARLAARTRTAVLLRAE |
Ga0187815_104245802 | 3300018001 | Freshwater Sediment | TVPALLLVVVALGAVALANLVAALPGRIAARTSPAIVLRSE |
Ga0187868_10126043 | 3300018002 | Peatland | VPALEVVLVALGALVLANLVAAVPGQMAARTPTALILRAE |
Ga0187888_12648922 | 3300018008 | Peatland | AVPEPSVPVLTVVLVALGALTFANLVATFPGRIAARTPTALLLRAE |
Ga0187880_10771924 | 3300018016 | Peatland | YAVPRPTVPVLEVLMVALATIVLANLVAAIPGRMAARTPTALVLRAE |
Ga0187872_103395972 | 3300018017 | Peatland | PDPTVPALSMVLIALGALCFANVVAAVPARIAARTPTALVLHSE |
Ga0187874_103890282 | 3300018019 | Peatland | VPALSLVYVAFGALVLANLVAALPGRHASRTPAAIVLRTE |
Ga0187882_13018821 | 3300018021 | Peatland | PTVPVLEVVLVGLAALVLANLVAAVPGRMAARTPTALVLRAE |
Ga0187882_13475982 | 3300018021 | Peatland | PEPTVPVVSVILVAVAALALANVVAAVPARIAARTPTALMLRVE |
Ga0187857_103667122 | 3300018026 | Peatland | ALIAVMVVGALVLANVVAAVPARIAARTPTALLHRSE |
Ga0187788_100721411 | 3300018032 | Tropical Peatland | IVPIALIALGALALANLLAVIPGRIAARTPAAILLRAE |
Ga0187863_107520972 | 3300018034 | Peatland | DPTIPTVSIVLIAVAAVILANLVAAVPGRVAANTPTAQLLRSE |
Ga0187875_101735301 | 3300018035 | Peatland | TVPAPEVPVVSVALIALGALVLANVVAVVPGRLAARTPTALLLRSE |
Ga0187875_102734283 | 3300018035 | Peatland | SPAVPVFPIVLIALGAFVLANVVAAIPGRIAARTRAALLLRSE |
Ga0187883_105860031 | 3300018037 | Peatland | VPLPTVPALEIVLVALGALVLANLVAAVPGQMAARTPTAVVLRAE |
Ga0187855_100986963 | 3300018038 | Peatland | HVVPAPTVPTVSIVLIAVGALVLANVVATLPARAAARTPTALVLRAE |
Ga0187855_106914891 | 3300018038 | Peatland | IAVVVVGALLVANVVAAVPGRIAARTPTSLLLRAE |
Ga0187855_108232531 | 3300018038 | Peatland | APTVPVVSVMLIALGALVLANLVAAFPARVAARAPTALLLRTE |
Ga0187855_109032011 | 3300018038 | Peatland | AGVVLVVLVTLVLANLVAAIPGRMAAGTPTALVLRAE |
Ga0187862_101283175 | 3300018040 | Peatland | PAPDVPVLSVTLIALGALALANVVAAVPGRLAARTPTALLLRSE |
Ga0187862_102233491 | 3300018040 | Peatland | PVLSVALVALGALVLANVVAALPGLVAARTPTALLLRAD |
Ga0187871_106016362 | 3300018042 | Peatland | IYAVPLATVPVLALVVVGLGALALANAVAVLPGRYAARTPTALLLRAE |
Ga0187871_107598842 | 3300018042 | Peatland | VVAIGLGSLVLANLVAAVPGRVAARTPTALVLRAD |
Ga0187887_104419642 | 3300018043 | Peatland | DPTVPVVSVVLVALGALVFANVVAAIPGRVAARTPTAMVLRAE |
Ga0187887_107510212 | 3300018043 | Peatland | PVPTVPVLSIALIGIGAVVLANVVAALPGRLAARTPTAPALRAE |
Ga0187890_101958903 | 3300018044 | Peatland | VPAPSVPVVSVTLIALGALVLANVVAALPGRLAVRTPTALLLHSE |
Ga0187890_104058043 | 3300018044 | Peatland | VPVPSVPALSVALIAVGSLVLANLVAALPGRLAARTPAALLLRSE |
Ga0187851_105398612 | 3300018046 | Peatland | LSLVLVAAAAFVLANAVAGFPGAYAARTPAALVLRAE |
Ga0187851_107888401 | 3300018046 | Peatland | SVPVAQVVLIALGALVLANVIAAIPGRLAARTPTALVLRSE |
Ga0187851_108813592 | 3300018046 | Peatland | APSVPVGQVVLIAAGALVLANVIAAVPGRLAARTPTALVLRSE |
Ga0187859_105353341 | 3300018047 | Peatland | DPTIPTVSVVLIGVGAVILANLVAAVPGRIAANTPTAQLLRSE |
Ga0187859_106702611 | 3300018047 | Peatland | IYAVPSPSVPVLDIAVIALGTLILANLAAVIPGRMAARTPTALVLRAE |
Ga0187765_106942892 | 3300018060 | Tropical Peatland | VLLITVGALVLANVVAAVPGRMAGRTPTALLLRAE |
Ga0187772_103391702 | 3300018085 | Tropical Peatland | SVALAAVAALVLANLVAAVPGRQAARTPAALMLRAE |
Ga0187769_115453351 | 3300018086 | Tropical Peatland | DDIHAVPAPSVPAVELVLIAVAGLALANLVAALPGRLAARTPTATLLRFE |
Ga0187770_108858421 | 3300018090 | Tropical Peatland | PSVPVLQVLLIAAGALVLANLVAALPARVAARTPTALVLRSE |
Ga0190275_108074991 | 3300018432 | Soil | WALVIVVVAALVLANLIAWFPARLAARTPAASGLRSE |
Ga0187852_11917931 | 3300019082 | Peatland | EIYAVPLATVPVLPLVLVGLSALVLANAVAGLPGRYAARTPTALVLRAE |
Ga0181506_10076491 | 3300019260 | Peatland | PTVPALTVVLIGVIALALANVVAAVPGRIAARTPTALLLRSE |
Ga0182025_12226662 | 3300019786 | Permafrost | QPSVPVLSVALVALGTLVLANVVAALPGLIAARTPTALLLRSE |
Ga0182031_14217714 | 3300019787 | Bog | VLSIVLIALGALLLANVVAAIPGRIAARTPTALILRAE |
Ga0193716_10980501 | 3300020061 | Soil | SLLLVAVGALVLANLVAALPGRSAARTPTAQVLRAN |
Ga0193716_11191651 | 3300020061 | Soil | VPQPSVPTLSIVLISVGALVLANVVAAIPGRHAARTPTALLLRTE |
Ga0210396_116680401 | 3300021180 | Soil | IHAVPQPTVPALSIVLIVVGAMLLANVVAAVPGRVAARTPTALLLRAE |
Ga0210388_110017941 | 3300021181 | Soil | QINVVPEPTVPGLWVILIVAGAILLANLVAVVPGRVAARTPTALLLRAE |
Ga0210388_110533362 | 3300021181 | Soil | TVSVLALSLVVLGTLALANAIAAVPARTAARTPTAFLLRSD |
Ga0210388_111195132 | 3300021181 | Soil | TVPILSVVAIVLSALVLANLVAAIPGRLAARTSTALLLRAE |
Ga0210388_113651322 | 3300021181 | Soil | LFLVAAGVLVLANLVAAIPAHLAARTPAAQALRAE |
Ga0210385_100059185 | 3300021402 | Soil | VPILPLCYVGLGALVLANLVAAFPGRRASRTPAALILRAE |
Ga0210384_108009361 | 3300021432 | Soil | LLVIARCAFVLANIVAYLPGRAAAATPAALLLRAE |
Ga0210391_111871333 | 3300021433 | Soil | SVPGLVILLIALGALVLANVVASVPGRMAARTSTALVLREE |
Ga0210391_112182671 | 3300021433 | Soil | IGSVALVILGALVLANVVAAIPGRIASRTRTALLLRAE |
Ga0210402_104903621 | 3300021478 | Soil | PVWPVILIVFGAIVLANIAAAIPGRIAARTPAAGLLRAR |
Ga0210402_108983503 | 3300021478 | Soil | LVCIGLGALVLANAAAALPGRYAARTPAALVLRTE |
Ga0210410_110917531 | 3300021479 | Soil | PEPTVPVLAIVGVAIGTFLLANIVAALPGSLAARTPTALVLRAE |
Ga0213851_17387252 | 3300021860 | Watersheds | VPALTVALIAVGALVLANLVAALPGRIAARTPTALLLRSE |
Ga0224558_10070696 | 3300023090 | Soil | LEVVLVALGALVLANLVAAVPGQMAARTPTALVLRAE |
Ga0224558_12286431 | 3300023090 | Soil | SYAVPEPSMPVLEVVVVAFAALVLANLVVAIPGRMAARTPTALVLRAE |
Ga0224557_11367261 | 3300023101 | Soil | VPVLSVVLVALGALVFANVVAALPGWIAARTPTALVLRAE |
Ga0224551_10130182 | 3300023259 | Soil | ESPTVPMASVVLIIAGALVLANVVAAIPGRVAANTPTALLLRNE |
Ga0224572_10928282 | 3300024225 | Rhizosphere | PALTLVLIGVGALVFANLVAAIPGRIAARTSTALVLRAE |
Ga0247692_10756321 | 3300024279 | Soil | PTVPALPLACIGLGALVLANVAAALPGRYAARTPTALVLRTE |
Ga0208077_10206711 | 3300025427 | Arctic Peat Soil | SVVLIVAVALVLANLVAAIPGRVAARTSTALLLRAE |
Ga0208455_10930822 | 3300025453 | Peatland | LATVPALPLVLVGIGALALANVVAALPGRYAARTPTALVLRAE |
Ga0208686_10739281 | 3300025500 | Peatland | IAVMVVGALALANIVAAVPGRIAARTPTSLLLRAE |
Ga0207933_11852992 | 3300025679 | Arctic Peat Soil | TVVLVAVGALVLANVVAAVPGRMAARTPAALALRDE |
Ga0209014_102310582 | 3300025857 | Arctic Peat Soil | PTVPVLPVILIALGALVLANIAAAIPGRLAARTPAAGLLRAQ |
Ga0207684_103422212 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVPLVVYVGLGALVLANAVAALSARYAARTPAALVLRAE |
Ga0207700_111942462 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VPALPVVLIGLGALVLANVVAAVPGRYAARTPSALVLRAE |
Ga0209871_10067351 | 3300026217 | Permafrost Soil | AWTVVLIAVGALVLANVVAAFPARVAARTPTALLLRAE |
Ga0209871_11088941 | 3300026217 | Permafrost Soil | PSVPVLSIALIAAGALVLANVIAFFPGRVAARTPTALLLRAE |
Ga0209839_100179801 | 3300026294 | Soil | PQPSVPAWTVVLIAVGALVLANVVAAFPARVAARTPTALLLRAE |
Ga0209839_101352041 | 3300026294 | Soil | QPTVPAMPVILITFGALALANIIAALPGRLAARTPTALLLRAE |
Ga0247847_10067303 | 3300026450 | Soil | VPVVSVTLIALGAIVLANVVAALPGRLAARTPTALLLHSE |
Ga0208042_10913482 | 3300027568 | Peatlands Soil | ALVIGAIAVGALVLGNLVAAIPGRMAARTPAALLLRSE |
Ga0209330_10251343 | 3300027619 | Forest Soil | EPTVPGLWVILIVVGAVLLANLVAVVPGRIAARTPTALLLRAE |
Ga0208827_11090801 | 3300027641 | Peatlands Soil | DPTVPTLSIVLVAAGAVLFANLVAAVPGRVAARTPTAVLLRAE |
Ga0208565_11215871 | 3300027662 | Peatlands Soil | PIFAIALGALVLGNLVAAVPGRIAARTPAALLLRTE |
Ga0208565_11525131 | 3300027662 | Peatlands Soil | LLLVALGTLVLANVVAAVPARSAARTPTALMLRAE |
Ga0208696_11674931 | 3300027696 | Peatlands Soil | IFAIALGALVLGNLVAAVPGRIAARTPAALLLRTE |
Ga0209908_101003771 | 3300027745 | Thawing Permafrost | GLSIVVVVAAALILANVVAAIPGRIAARTPTALMLRAE |
Ga0209772_101293243 | 3300027768 | Bog Forest Soil | MSRRRLRVIAIGALVLANVVAALPGRIAARTPTALLLRAD |
Ga0209040_100950921 | 3300027824 | Bog Forest Soil | VPEPTVPGLPVILITAGALVLANLVATVPGRVAARTPAGLLLRAE |
Ga0209040_105258932 | 3300027824 | Bog Forest Soil | VPDPTVPVLSLLLVAVGALLFANVVAAFPGRAAARTPTALLLRAE |
Ga0209060_101751511 | 3300027826 | Surface Soil | EVVVIALVALALANVVAALPGRAGARTPVAGVLRAE |
Ga0209579_101216001 | 3300027869 | Surface Soil | LLVTAIGLAAIVLANLVAVVPGRIAARTQTGLLLRTE |
Ga0209275_102471552 | 3300027884 | Soil | VLSLVLVGVGTLALANVIAAVPAWTAARTPTAFLLRSE |
Ga0209068_103317092 | 3300027894 | Watersheds | HEIGAVPQPTVPVVTVVAIVVGALVLANIVAAIPGRVAARTPTALLLRAE |
Ga0209624_102502152 | 3300027895 | Forest Soil | VPQPTVSAWSVVLVAAGALVLACVVASIPARLAARTETSVLLRAE |
Ga0209415_103050723 | 3300027905 | Peatlands Soil | QAIVGVALGGVVLANIVAAVPGRLAARTPTALVLRAE |
Ga0209415_107181011 | 3300027905 | Peatlands Soil | FAENIHAVPAPSVPVFSVLLIAIGALVLANAVAAFPGRLAARTPTALLLRSE |
Ga0209006_106805532 | 3300027908 | Forest Soil | VVLVAAGALVLACVVASIPARLAARTETSVLLRAE |
Ga0209698_111382542 | 3300027911 | Watersheds | IPIVGITVGALVLANLVAAVPGRIAARTPAALLLRTE |
Ga0209069_104977222 | 3300027915 | Watersheds | VPWPQIALLSLAALLLANAAALIPGRAAARTPTALLLKAE |
Ga0209069_105465911 | 3300027915 | Watersheds | LTIFLVAIGGLVLANIVAALPGRVAARTPAALALQAE |
Ga0209168_103098792 | 3300027986 | Surface Soil | LWTMFATGIDAVPRPTVPALVLVLVGVGALVLANVVAWFPGRVAARTSTAEHLRAE |
Ga0255358_10236431 | 3300028069 | Soil | PSPTVPALAIVAITFGGLVLGNLVAAIPGRIAARTPVALLLRTE |
Ga0137415_101896213 | 3300028536 | Vadose Zone Soil | SVLLVVIGALVLANVVAAIPGRSAAHTPTALLLRAE |
Ga0265318_100848392 | 3300028577 | Rhizosphere | IVVLVIAGALVAANLVAAIPGRAAARVPAAALLRTE |
Ga0302266_100642801 | 3300028779 | Bog | PGLVIILIVVGALLLANVVAAIPGRMAAKTSTALVLREE |
Ga0302221_105209281 | 3300028806 | Palsa | SVVLIGVGAMIVANLVAAVPGRIAARTPTAQLLRSE |
Ga0302228_104305622 | 3300028808 | Palsa | IYAVPSPSVPVLDIAVIALGTLILANLAAVIPGRMAARTPTALVLRTE |
Ga0302146_101647382 | 3300028867 | Bog | HEIDVIPTPTVPALTVVLIGVIALALANVVAAVPGRIAARTPTALLLRSE |
Ga0302229_103071041 | 3300028879 | Palsa | NAVQQPTVPVVTVALIALGALVLANVVAALPGRLAARTPTALLLRAE |
Ga0302154_105616632 | 3300028882 | Bog | LSVVLVALGTLVVANLVAFVPGRMAARTPTALLLRAE |
Ga0311329_110399052 | 3300029907 | Bog | VLALVLVAAGALVLANVVAAGPARAASRTPTAVLLRAE |
Ga0311361_108275991 | 3300029911 | Bog | PTLTVALIAVGALVLANLVAALPGRIAARTPTALLLRSE |
Ga0311362_107218492 | 3300029913 | Bog | IPTPTVPALTVVLIGVIALALANVVAAVPGRIAARTPTALLLRSE |
Ga0311363_108037871 | 3300029922 | Fen | PSVPALLVVLIAAGGLVVANLVAAVPGRIAARTPTAVVLRSE |
Ga0311340_102105701 | 3300029943 | Palsa | LPSVPILSIVLIALAALVLANVVAAIPGRVAARTPTALVLRAE |
Ga0311340_105017391 | 3300029943 | Palsa | SVPVLDIAVIALGTLILANLAAVIPGRMAARTPTALVLRTE |
Ga0311371_105548171 | 3300029951 | Palsa | SPSVPVLDIAVIALGTLILANLAAVVPGRMAARTPTALVLRAE |
Ga0311371_116089272 | 3300029951 | Palsa | PVLSIVLIALAALVLANVVAAIPGRVAARTPTALVLRAE |
Ga0311346_102033955 | 3300029952 | Bog | WPIVFIAVGAFILANIVATVPGRMAAHTPTALLLRAE |
Ga0311343_108967421 | 3300029953 | Bog | IYVVPAPTVPAPVIGLIVVGSLVLANVVAAVPGRLAARTPTALLLRAE |
Ga0311343_110707781 | 3300029953 | Bog | QINAVPDPTIPTASVVLIGVGALILANLVAAVPGRLAARTPTAQLLRSE |
Ga0302283_12316121 | 3300029994 | Fen | ALLVVLIAAGGLVVANLVAAVPGRIAARTPTAVVLRSE |
Ga0311339_101265395 | 3300029999 | Palsa | VPVPTVPVLSIVLIGIGAVALANIVAALPGRLAARTPTALALRAE |
Ga0311339_105635891 | 3300029999 | Palsa | IILVAAGALVLANLVAAVPGRVAASTPAAIILRGE |
Ga0311339_116394191 | 3300029999 | Palsa | VRGHVSLVVLIAILGGLALASVVAVLPGRSAARTSTALVLRAE |
Ga0311338_113008152 | 3300030007 | Palsa | VALIAVGVLVPADVVAVIPARIAARTSTALMLRAE |
Ga0302178_103596712 | 3300030013 | Palsa | PALSILLVAVGALLLANLVAALPGWSAARTPTALVLRVE |
Ga0302195_103261422 | 3300030051 | Bog | TVPIASVLLIVASAMVLANVVAAIPGRVAAKTSTALLLRAE |
Ga0302181_103076411 | 3300030056 | Palsa | VVPSPTVPALSIVLIAFGALVLANLVAAVPGVMAARTKTASLLRAE |
Ga0302181_103662492 | 3300030056 | Palsa | IPAVSIILIGVAALILANLVAAVPGRIAANTPTAQLLRTE |
Ga0311353_114109881 | 3300030399 | Palsa | VLDIAVIALATLILANLAAVIPGRMAARTPTALVLRAE |
Ga0302184_101171412 | 3300030490 | Palsa | DPTIPGVSILLIAAAAIVLANVVAAVPGRIAARTPTARLLRTE |
Ga0311370_119455452 | 3300030503 | Palsa | VALIALGALVLANVVAALPGRLAARTPTALLLRAE |
Ga0302275_100761531 | 3300030518 | Bog | AVPSPTVPIASVLLIIASAMVLANIVAAIPGRVAAKTSTALLLRAE |
Ga0311372_113006161 | 3300030520 | Palsa | SVAPSSSVPVITVALIVAGAELLGNVVATFPARIAARTPTALLLRAE |
Ga0311372_128080372 | 3300030520 | Palsa | TVLVAIGALVIANVVAAVPGRLAARTPTALVLRAE |
Ga0311355_100040271 | 3300030580 | Palsa | ARDINAVPVPTVPVPSILLIGAGAIVLANIVAALPGRLAARTPTALALRAE |
Ga0311356_100151331 | 3300030617 | Palsa | LLLIAVGTFVLANIVAAIPGRIAAHTPTASMLRGE |
Ga0311356_101525943 | 3300030617 | Palsa | VPEPSVPVLTVALVALGALTFANLVATFPGRIAARTPTSLLLRAE |
Ga0311354_100434957 | 3300030618 | Palsa | PTVPVPSILLIGAGAIVLANIVAALPGRLAARTPTALALRAE |
Ga0311354_114398081 | 3300030618 | Palsa | LSIVLIGIGAVALANIVAALPGRLAARTPTALALRAE |
Ga0311354_117646501 | 3300030618 | Palsa | PTIPALSIVVIGVAAIVLANAVAAVPGRIAARTPTAQLLRSE |
Ga0316363_101700133 | 3300030659 | Peatlands Soil | VPVLAVVVVGVGALVLANLVAAVPGQVAARTATAHVLRAE |
Ga0302311_102056421 | 3300030739 | Palsa | SPSVPVLDIAVIALGTLILANLAAVVPGRMAARTPTALVLRA |
Ga0265753_11073131 | 3300030862 | Soil | VIVLIVVGALVLANVVAAIPGRMAAGTSTALVLREE |
Ga0302180_102001602 | 3300031028 | Palsa | ALSIVVIGVAAIVLANAVAAVPGRIAARTPTAQLLRSE |
Ga0302325_102917761 | 3300031234 | Palsa | ADSDPPVPVAQVALVAVGALVLANLVAAVPGRIAARSSTALLLRAD |
Ga0302325_107380283 | 3300031234 | Palsa | PSVPLSIILVGAGALVLANLVAAVPGRVAASTPAAIILRGE |
Ga0302325_109303112 | 3300031234 | Palsa | VVPVSSVPVVEVVVVAHGALVLANLVAAIPGRMAARLPTALVLRAE |
Ga0302325_120626792 | 3300031234 | Palsa | EINAIPAPTVPVALIVLIVVGGIVLANIVAAVPGRIAARTPAALLLRAE |
Ga0302325_131713512 | 3300031234 | Palsa | TVPSALIAGMIVGALVLANIVAAVPGRIAARTPTSLLLRAE |
Ga0302324_1003501031 | 3300031236 | Palsa | VPSSTVPALAIVAIALGALVLGNLVAALPGRLAAHTPAALLLRTE |
Ga0302324_1005438873 | 3300031236 | Palsa | PVLSVILVAIGALVFANVVAAIPGRLAARTPTALALRTE |
Ga0302324_1018116272 | 3300031236 | Palsa | VTTIVLIALGAVFLGNIVAAFPARIAARTPTALLLRAE |
Ga0302324_1028436661 | 3300031236 | Palsa | GTGPLLMPTVRALEIVLVALGALVLANLVAAVPGQMAARTPTAVVLRAE |
Ga0302140_103876432 | 3300031261 | Bog | SIAPLTIVVVGLGTVVFANIVAAIPGRIAARTSTALVLRTE |
Ga0265316_108626601 | 3300031344 | Rhizosphere | VPVLIVVLVIAGALVAANLVAAIPGRAAARVPAAALLRTE |
Ga0302320_115038502 | 3300031524 | Bog | ILSVALIVVSAMVLANLVAAIPGRVAAKTSTALLLRAE |
Ga0302320_116773182 | 3300031524 | Bog | FAHEIDVIPTPTVPALTVVLIGVIALALANVVAAVPGRIAARTPTALLLRSE |
Ga0302326_106889482 | 3300031525 | Palsa | TVVLIALGALVLANIVAAIPGRIAARTPTALILRAE |
Ga0302326_107733831 | 3300031525 | Palsa | TVPVALIVLIVVGGIVLANIVAAVPGRIAARTPAALLLRAE |
Ga0302326_113175002 | 3300031525 | Palsa | MYRSFQFVLIALGALVLAKLVAAVPGRIAARTATALLLRAE |
Ga0302326_119553892 | 3300031525 | Palsa | IVEVVAVALAALVLANLVAAIPGGMAARTRAALVLRAE |
Ga0302326_133889061 | 3300031525 | Palsa | DATIPALSVFLVGVGALLFANLVATVPGRHAAHTPTALVLRAE |
Ga0302326_135902672 | 3300031525 | Palsa | ALTVVLTAVVALLLANAVAAIPGRIAARTPTALILRSE |
Ga0318516_100314433 | 3300031543 | Soil | VVLIAAGALVLANIVAAVPGRMAGRTPTALLLHAE |
Ga0318516_105598671 | 3300031543 | Soil | VLSLVLVAVGTLVLANVVAAVPARTAARTPTAIMLRAE |
Ga0318541_103557242 | 3300031545 | Soil | REISVVPEPAVPGPAVFLIAVGALVLANVVAAVPGRIAGRTPTALLLRTE |
Ga0318555_103100862 | 3300031640 | Soil | VPGPTVVLIAVGALVLANIVAAVPGRMAGRTPTALLLHAE |
Ga0307374_106400232 | 3300031670 | Soil | EVVLVALGALVLANVVAAIPGRIAARTSTALVLRAQ |
Ga0310686_1022004751 | 3300031708 | Soil | PVLSVVLVAAGALVFANVVAAIPGRIAARTPTAMVLRAE |
Ga0310686_1174752262 | 3300031708 | Soil | VTLVGIGALVFANLVAALPGRIAARTPTALVLRAE |
Ga0307476_108746091 | 3300031715 | Hardwood Forest Soil | LVLVGLGTLVLANVIAAVPARTAARTQTALLLRSE |
Ga0306918_105425282 | 3300031744 | Soil | EPTVPGPTVVLIAVGALVLANIVAAVPGRMAGRTPTALLLHAE |
Ga0307477_102805073 | 3300031753 | Hardwood Forest Soil | PVVSLILVALGALLFANLVAALPARSAADTPAALLL |
Ga0318526_100226853 | 3300031769 | Soil | PTVVLIAAGALVLANIVAAVPGRMAGRTPTALLLHAE |
Ga0318550_100052755 | 3300031797 | Soil | INVVPEPTVPGPTVVLIAVGALVLANIVAAVPGRMAGRTPTALLLHAE |
Ga0307407_112139732 | 3300031903 | Rhizosphere | LLAVLIAVPTALFLVNVVAALPGRIAARTQPGLVLRSE |
Ga0306923_122683781 | 3300031910 | Soil | SLVLVAAGTVMLANIVAAVPARSAARTPTAMMLRAE |
Ga0311301_107565021 | 3300032160 | Peatlands Soil | RQIHAVPTPSVPAAAIVLVALGGVVLANIVAAVPGHLAARTPTALVLRAE |
Ga0311301_112278821 | 3300032160 | Peatlands Soil | VPSPTVPALVIGAIAVGALVLGNLVAAIPGRMAARTPAALLLRTE |
Ga0315283_101391131 | 3300032164 | Sediment | VPLGPIALVAIGALVVANLVAAVPGWIAAGTPTAEILR |
Ga0315283_113109452 | 3300032164 | Sediment | QQLFVVVRPSVPLGPIALVAIGALVVANLVAAVPGWIAAGTPTAEILRGN |
Ga0307471_1022593241 | 3300032180 | Hardwood Forest Soil | WSVVLVAVAALVLANVVAAVPARLAARTSAALGLRAD |
Ga0335078_103175882 | 3300032805 | Soil | VALAALGALVFANLAAAGPGRAASKSPTALVLRAE |
Ga0335078_105815021 | 3300032805 | Soil | VPTLGVVTIGVGALVLANLVAALPGPIAAHTSTAVLLRAE |
Ga0335069_108065172 | 3300032893 | Soil | VAEVVLVAGLALVLANVVAVLPGRMAARTRTAELFRAE |
Ga0335074_100657383 | 3300032895 | Soil | LGPHLLIAVGALVLASVVATAPGRVAARSLIALLLSAG |
Ga0335074_105984553 | 3300032895 | Soil | PSPSVPALSIIAVGIGAIVLGNLVAAVPGRIARRTSTALLFRVD |
Ga0335074_107904891 | 3300032895 | Soil | IDVVPEPTVPGLWVILIAGGALALANLVAVLPGRVAARTPTALLLRAE |
Ga0335075_114623882 | 3300032896 | Soil | VAASGQMNVVPEPTVPSLWVILIVVGAVLLASLVAVMPGRVAARTPTALLLRAG |
Ga0335075_116829521 | 3300032896 | Soil | MLPIVVVALGALLVANVVATVPGRSAARIPTASLLRTE |
Ga0335072_106986511 | 3300032898 | Soil | WVILIAAGALALANLVAALPGRVAARTPTALLLRAE |
Ga0335073_101419453 | 3300033134 | Soil | VVPEPTVPGLWVILIAAGALALANLIAALPGRVAASTPTALLLRAE |
Ga0326728_1002021123 | 3300033402 | Peat Soil | VPGLTIVLIVLGAFVLTNVVAAVPGRMAARTPTALVLRTE |
Ga0326727_102362173 | 3300033405 | Peat Soil | MVLITIGALVLANLVAAVPGRIAARTQTALLLQTE |
Ga0371489_0450819_466_579 | 3300033755 | Peat Soil | MSIVFVALGALVLANLVAFFPGRVAGRTQTALMLRTE |
Ga0334790_020188_1_111 | 3300033887 | Soil | SVALIVVSAMVLANLVAAIPGRVAAKTSTALLLRAE |
Ga0371487_0035195_2897_3010 | 3300033982 | Peat Soil | MSVVLIAVGALVLANLVAAVPARVAARAPTALLLRAE |
Ga0371487_0047551_657_797 | 3300033982 | Peat Soil | VASVALIALGALVLANMVAALPGRLASRTPTALLLHSEWREGAGAS |
Ga0371488_0168380_1014_1121 | 3300033983 | Peat Soil | MVLIALGALCFANFVAAVPARIAARTPTALVLHSE |
Ga0326724_0471245_1_114 | 3300034091 | Peat Soil | LEVVVVALAALVLANLVAAIPGRMAARTPTALVLRAE |
Ga0370483_0255781_337_459 | 3300034124 | Untreated Peat Soil | LSALAIVAIALGALVLGNLVAALPGRIAARTPAALLLRTE |
Ga0370483_0261487_477_593 | 3300034124 | Untreated Peat Soil | PLTIVIVGLGTVAFANIVAAIPGRIAARTSTALVLRTE |
Ga0370514_018099_1559_1696 | 3300034199 | Untreated Peat Soil | VPEPTVPVLSLVLVAAGALVLANVVAAVPARAASRTPTALLLRAE |
Ga0370514_139709_2_124 | 3300034199 | Untreated Peat Soil | IPTASIVLIGVGAVILANLVAAVPGRIAARTPTAQLLRSE |
Ga0370492_0122707_946_1062 | 3300034282 | Untreated Peat Soil | VVSIVLIALGALLLANLVAAVPGVIAARTKTASLLRAE |
⦗Top⦘ |