NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F010783

Metagenome / Metatranscriptome Family F010783

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F010783
Family Type Metagenome / Metatranscriptome
Number of Sequences 299
Average Sequence Length 41 residues
Representative Sequence MTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVV
Number of Associated Samples 217
Number of Associated Scaffolds 299

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.61 %
% of genes near scaffold ends (potentially truncated) 98.33 %
% of genes from short scaffolds (< 2000 bps) 91.64 %
Associated GOLD sequencing projects 210
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.860 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(38.127 % of family members)
Environment Ontology (ENVO) Unclassified
(40.803 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(42.809 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 44.12%    β-sheet: 0.00%    Coil/Unstructured: 55.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 299 Family Scaffolds
PF00296Bac_luciferase 2.34
PF02518HATPase_c 2.34
PF02894GFO_IDH_MocA_C 2.01
PF01408GFO_IDH_MocA 1.67
PF00196GerE 1.34
PF00027cNMP_binding 1.34
PF04266ASCH 1.34
PF13649Methyltransf_25 1.34
PF11716MDMPI_N 1.34
PF10604Polyketide_cyc2 1.34
PF12680SnoaL_2 1.00
PF03737RraA-like 1.00
PF04978DUF664 1.00
PF01266DAO 1.00
PF04237YjbR 1.00
PF00300His_Phos_1 1.00
PF14464Prok-JAB 0.67
PF03795YCII 0.67
PF00583Acetyltransf_1 0.67
PF00872Transposase_mut 0.67
PF00005ABC_tran 0.67
PF13424TPR_12 0.67
PF08241Methyltransf_11 0.67
PF08044DUF1707 0.67
PF07730HisKA_3 0.67
PF14525AraC_binding_2 0.67
PF13847Methyltransf_31 0.33
PF02579Nitro_FeMo-Co 0.33
PF08281Sigma70_r4_2 0.33
PF00400WD40 0.33
PF13474SnoaL_3 0.33
PF02775TPP_enzyme_C 0.33
PF07859Abhydrolase_3 0.33
PF01636APH 0.33
PF02156Glyco_hydro_26 0.33
PF01402RHH_1 0.33
PF13302Acetyltransf_3 0.33
PF01494FAD_binding_3 0.33
PF02583Trns_repr_metal 0.33
PF01909NTP_transf_2 0.33
PF00378ECH_1 0.33
PF12706Lactamase_B_2 0.33
PF00355Rieske 0.33
PF13156Mrr_cat_2 0.33
PF06792UPF0261 0.33
PF13460NAD_binding_10 0.33
PF03861ANTAR 0.33
PF09922DUF2154 0.33
PF00324AA_permease 0.33
PF02594DUF167 0.33
PF04672Methyltransf_19 0.33
PF00406ADK 0.33
PF03704BTAD 0.33
PF10017Methyltransf_33 0.33
PF00069Pkinase 0.33
PF09594GT87 0.33
PF07883Cupin_2 0.33
PF13404HTH_AsnC-type 0.33
PF13676TIR_2 0.33
PF08240ADH_N 0.33
PF07311Dodecin 0.33
PF00857Isochorismatase 0.33
PF04116FA_hydroxylase 0.33
PF13669Glyoxalase_4 0.33
PF05973Gp49 0.33
PF01047MarR 0.33
PF13193AMP-binding_C 0.33
PF13378MR_MLE_C 0.33
PF02899Phage_int_SAM_1 0.33
PF01906YbjQ_1 0.33

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 299 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 2.34
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 2.01
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.34
COG2411Predicted RNA-binding protein, contains PUA-like ASCH domainGeneral function prediction only [R] 1.34
COG3097Uncharacterized conserved protein YqfB, UPF0267 familyFunction unknown [S] 1.34
COG4405Predicted RNA-binding protein YhfF, contains PUA-like ASCH domainGeneral function prediction only [R] 1.34
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 1.00
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 1.00
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.67
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.67
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.67
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.67
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.67
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.67
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.67
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.33
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.33
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 0.33
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.33
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.33
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.33
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.33
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.33
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.33
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.33
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.33
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.33
COG1872Uncharacterized conserved protein YggU, UPF0235/DUF167 familyFunction unknown [S] 0.33
COG1937DNA-binding transcriptional regulator, FrmR familyTranscription [K] 0.33
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.33
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 0.33
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.33
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.33
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 0.33
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.33
COG4124Beta-mannanaseCarbohydrate transport and metabolism [G] 0.33
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.33
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.33
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.33
COG5441ATP-binding helicase-inhibiting domain, Tm-1/UPF0261 familyDefense mechanisms [V] 0.33


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.86 %
UnclassifiedrootN/A42.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_116116489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300001593|JGI12635J15846_10337550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii928Open in IMG/M
3300004092|Ga0062389_104650586Not Available517Open in IMG/M
3300004268|Ga0066398_10044059All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300005330|Ga0070690_101743253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300005332|Ga0066388_100058434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales4055Open in IMG/M
3300005332|Ga0066388_104989799Not Available674Open in IMG/M
3300005332|Ga0066388_107651767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300005363|Ga0008090_15296063Not Available616Open in IMG/M
3300005434|Ga0070709_10675651Not Available802Open in IMG/M
3300005434|Ga0070709_11482540Not Available550Open in IMG/M
3300005436|Ga0070713_100212097All Organisms → cellular organisms → Bacteria1753Open in IMG/M
3300005471|Ga0070698_101282610Not Available682Open in IMG/M
3300005548|Ga0070665_100282493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. YR5271662Open in IMG/M
3300005591|Ga0070761_11105114All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005602|Ga0070762_10693290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii683Open in IMG/M
3300005610|Ga0070763_10867387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300005617|Ga0068859_100602291All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300005764|Ga0066903_105801841Not Available648Open in IMG/M
3300005921|Ga0070766_10285645Not Available1056Open in IMG/M
3300006028|Ga0070717_10480796Not Available1121Open in IMG/M
3300006028|Ga0070717_10891601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jejuensis810Open in IMG/M
3300006041|Ga0075023_100623407Not Available505Open in IMG/M
3300006059|Ga0075017_100036596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3254Open in IMG/M
3300006059|Ga0075017_100845545Not Available709Open in IMG/M
3300006173|Ga0070716_100471596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas920Open in IMG/M
3300006174|Ga0075014_100975822Not Available512Open in IMG/M
3300006176|Ga0070765_100042657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3644Open in IMG/M
3300006572|Ga0074051_10008430All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300006755|Ga0079222_10634642All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300006903|Ga0075426_10131190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1805Open in IMG/M
3300006904|Ga0075424_102122590All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300006914|Ga0075436_101544464All Organisms → cellular organisms → Bacteria → Terrabacteria group504Open in IMG/M
3300006954|Ga0079219_11599475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella lactea597Open in IMG/M
3300006954|Ga0079219_11675038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus588Open in IMG/M
3300009038|Ga0099829_10233850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1495Open in IMG/M
3300009088|Ga0099830_11310225Not Available602Open in IMG/M
3300009137|Ga0066709_101299011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1067Open in IMG/M
3300009522|Ga0116218_1234027All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300009551|Ga0105238_12876781Not Available517Open in IMG/M
3300009624|Ga0116105_1180429Not Available574Open in IMG/M
3300009698|Ga0116216_10371068All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300009700|Ga0116217_10420278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia847Open in IMG/M
3300009764|Ga0116134_1073075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1271Open in IMG/M
3300009792|Ga0126374_10215769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1226Open in IMG/M
3300010043|Ga0126380_10011559Not Available3984Open in IMG/M
3300010043|Ga0126380_10738121Not Available797Open in IMG/M
3300010046|Ga0126384_11862300Not Available572Open in IMG/M
3300010048|Ga0126373_10070170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3164Open in IMG/M
3300010048|Ga0126373_10276811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1663Open in IMG/M
3300010048|Ga0126373_10455407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1315Open in IMG/M
3300010048|Ga0126373_11775925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2575680Open in IMG/M
3300010048|Ga0126373_11902732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300010048|Ga0126373_12144693Not Available620Open in IMG/M
3300010358|Ga0126370_12297497Not Available533Open in IMG/M
3300010359|Ga0126376_11140596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia790Open in IMG/M
3300010360|Ga0126372_10684879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia998Open in IMG/M
3300010360|Ga0126372_11355091Not Available742Open in IMG/M
3300010360|Ga0126372_12321722Not Available586Open in IMG/M
3300010361|Ga0126378_10471859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1369Open in IMG/M
3300010361|Ga0126378_11389515All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300010366|Ga0126379_13588675Not Available520Open in IMG/M
3300010376|Ga0126381_100849947All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300010376|Ga0126381_101718897Not Available906Open in IMG/M
3300010376|Ga0126381_102496647Not Available740Open in IMG/M
3300010379|Ga0136449_102659553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia712Open in IMG/M
3300010403|Ga0134123_12202515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus613Open in IMG/M
3300010867|Ga0126347_1488843Not Available538Open in IMG/M
3300010880|Ga0126350_12220272Not Available508Open in IMG/M
3300012189|Ga0137388_10548560Not Available1074Open in IMG/M
3300012198|Ga0137364_10449706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria966Open in IMG/M
3300012207|Ga0137381_10865024All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300012210|Ga0137378_10693894Not Available929Open in IMG/M
3300012210|Ga0137378_11813737Not Available514Open in IMG/M
3300012211|Ga0137377_11152633Not Available705Open in IMG/M
3300012350|Ga0137372_10747493Not Available705Open in IMG/M
3300012359|Ga0137385_10782856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter793Open in IMG/M
3300012362|Ga0137361_10764294Not Available881Open in IMG/M
3300012363|Ga0137390_10278011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1658Open in IMG/M
3300012930|Ga0137407_10031633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4131Open in IMG/M
3300012987|Ga0164307_11486158All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300014155|Ga0181524_10119434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1426Open in IMG/M
3300014657|Ga0181522_10061315Not Available2130Open in IMG/M
3300015371|Ga0132258_11224053All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300015372|Ga0132256_101212863All Organisms → cellular organisms → Bacteria → Terrabacteria group868Open in IMG/M
3300016294|Ga0182041_12336332Not Available500Open in IMG/M
3300016357|Ga0182032_10971743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia724Open in IMG/M
3300016387|Ga0182040_10100036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1965Open in IMG/M
3300016422|Ga0182039_10350804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1239Open in IMG/M
3300016445|Ga0182038_10880368All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300017928|Ga0187806_1029397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1623Open in IMG/M
3300017932|Ga0187814_10174008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300017932|Ga0187814_10434974Not Available513Open in IMG/M
3300017936|Ga0187821_10428298All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300017937|Ga0187809_10400362Not Available523Open in IMG/M
3300017938|Ga0187854_10062026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1833Open in IMG/M
3300017946|Ga0187879_10178667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1194Open in IMG/M
3300017959|Ga0187779_10806482Not Available641Open in IMG/M
3300017975|Ga0187782_11313357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300017975|Ga0187782_11534263Not Available525Open in IMG/M
3300017995|Ga0187816_10252128Not Available770Open in IMG/M
3300018007|Ga0187805_10397274Not Available640Open in IMG/M
3300018016|Ga0187880_1442185All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes539Open in IMG/M
3300018029|Ga0187787_10462867Not Available513Open in IMG/M
3300018033|Ga0187867_10348046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium825Open in IMG/M
3300018034|Ga0187863_10176980Not Available1189Open in IMG/M
3300018037|Ga0187883_10522750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia613Open in IMG/M
3300018037|Ga0187883_10530107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300018044|Ga0187890_10751269Not Available551Open in IMG/M
3300018058|Ga0187766_10633618Not Available733Open in IMG/M
3300018058|Ga0187766_10966231Not Available604Open in IMG/M
3300018062|Ga0187784_11310954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales574Open in IMG/M
3300018085|Ga0187772_10073086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium2159Open in IMG/M
3300018085|Ga0187772_11474902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300019888|Ga0193751_1158625Not Available803Open in IMG/M
3300021080|Ga0210382_10406426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300021088|Ga0210404_10598014Not Available627Open in IMG/M
3300021181|Ga0210388_10935992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300021404|Ga0210389_10458998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1002Open in IMG/M
3300021404|Ga0210389_10784984All Organisms → cellular organisms → Bacteria → Proteobacteria744Open in IMG/M
3300021404|Ga0210389_11476630Not Available517Open in IMG/M
3300021406|Ga0210386_11742183Not Available514Open in IMG/M
3300021407|Ga0210383_10340166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1292Open in IMG/M
3300021475|Ga0210392_10709346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684749Open in IMG/M
3300021560|Ga0126371_12302468Not Available651Open in IMG/M
3300021560|Ga0126371_12347484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300025576|Ga0208820_1039042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1396Open in IMG/M
3300025588|Ga0208586_1099930Not Available627Open in IMG/M
3300025588|Ga0208586_1115630Not Available573Open in IMG/M
3300025625|Ga0208219_1000694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11985Open in IMG/M
3300025922|Ga0207646_10389077Not Available1260Open in IMG/M
3300025922|Ga0207646_10700453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia906Open in IMG/M
3300025929|Ga0207664_10859615Not Available815Open in IMG/M
3300026116|Ga0207674_11959759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae551Open in IMG/M
3300026217|Ga0209871_1075470Not Available650Open in IMG/M
3300027072|Ga0208238_1013289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus africanus702Open in IMG/M
3300027172|Ga0208098_1029223Not Available565Open in IMG/M
3300027646|Ga0209466_1095305Not Available602Open in IMG/M
3300027676|Ga0209333_1145156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii639Open in IMG/M
3300027783|Ga0209448_10133797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK829Open in IMG/M
3300027854|Ga0209517_10023355All Organisms → cellular organisms → Bacteria5565Open in IMG/M
3300027889|Ga0209380_10251792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1037Open in IMG/M
3300027895|Ga0209624_10180121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1402Open in IMG/M
3300027895|Ga0209624_11045293Not Available528Open in IMG/M
3300027903|Ga0209488_10306266All Organisms → cellular organisms → Bacteria → Acidobacteria1186Open in IMG/M
3300028768|Ga0307280_10260849All Organisms → cellular organisms → Bacteria → Terrabacteria group625Open in IMG/M
3300028789|Ga0302232_10433143Not Available646Open in IMG/M
3300028801|Ga0302226_10114195Not Available1194Open in IMG/M
3300028813|Ga0302157_10098700All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300028879|Ga0302229_10078712All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300028906|Ga0308309_10043925All Organisms → cellular organisms → Bacteria3174Open in IMG/M
3300028906|Ga0308309_10271359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1426Open in IMG/M
3300029882|Ga0311368_10701286Not Available700Open in IMG/M
3300029917|Ga0311326_10217721Not Available995Open in IMG/M
3300029943|Ga0311340_10541892All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300029952|Ga0311346_10138877All Organisms → cellular organisms → Bacteria2930Open in IMG/M
3300029999|Ga0311339_11679402Not Available557Open in IMG/M
3300030013|Ga0302178_10130106All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300030053|Ga0302177_10023641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3906Open in IMG/M
3300030053|Ga0302177_10656136Not Available533Open in IMG/M
3300030054|Ga0302182_10180656Not Available907Open in IMG/M
3300030520|Ga0311372_10008362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria23118Open in IMG/M
3300030646|Ga0302316_10358628Not Available587Open in IMG/M
3300030688|Ga0311345_10551341All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300031233|Ga0302307_10644324Not Available533Open in IMG/M
3300031236|Ga0302324_100482730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1816Open in IMG/M
3300031543|Ga0318516_10391584All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300031544|Ga0318534_10193383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. Soil7481175Open in IMG/M
3300031544|Ga0318534_10733979Not Available557Open in IMG/M
3300031544|Ga0318534_10773829Not Available540Open in IMG/M
3300031546|Ga0318538_10254447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii943Open in IMG/M
3300031546|Ga0318538_10769418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium522Open in IMG/M
3300031549|Ga0318571_10068996Not Available1096Open in IMG/M
3300031561|Ga0318528_10155855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1217Open in IMG/M
3300031561|Ga0318528_10205489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1054Open in IMG/M
3300031564|Ga0318573_10663347Not Available561Open in IMG/M
3300031572|Ga0318515_10047192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2156Open in IMG/M
3300031572|Ga0318515_10082856All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300031573|Ga0310915_10173108Not Available1501Open in IMG/M
3300031573|Ga0310915_10817033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii655Open in IMG/M
3300031671|Ga0307372_10335270Not Available821Open in IMG/M
3300031679|Ga0318561_10819871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300031680|Ga0318574_10064167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1967Open in IMG/M
3300031680|Ga0318574_10204703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1134Open in IMG/M
3300031681|Ga0318572_10323619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii913Open in IMG/M
3300031681|Ga0318572_10846710Not Available543Open in IMG/M
3300031682|Ga0318560_10040865All Organisms → cellular organisms → Bacteria2246Open in IMG/M
3300031682|Ga0318560_10214228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1031Open in IMG/M
3300031682|Ga0318560_10383608Not Available760Open in IMG/M
3300031708|Ga0310686_105081000Not Available570Open in IMG/M
3300031708|Ga0310686_106238335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300031708|Ga0310686_106291417Not Available508Open in IMG/M
3300031713|Ga0318496_10850739Not Available503Open in IMG/M
3300031715|Ga0307476_10194754All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300031715|Ga0307476_10313261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1152Open in IMG/M
3300031719|Ga0306917_10114716All Organisms → cellular organisms → Bacteria1954Open in IMG/M
3300031719|Ga0306917_10186166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1564Open in IMG/M
3300031723|Ga0318493_10710981Not Available563Open in IMG/M
3300031724|Ga0318500_10061216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1629Open in IMG/M
3300031744|Ga0306918_10167484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1636Open in IMG/M
3300031748|Ga0318492_10231664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii951Open in IMG/M
3300031748|Ga0318492_10819143Not Available501Open in IMG/M
3300031751|Ga0318494_10407499All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300031751|Ga0318494_10805459All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300031764|Ga0318535_10091212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1326Open in IMG/M
3300031764|Ga0318535_10312581Not Available703Open in IMG/M
3300031765|Ga0318554_10085213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1766Open in IMG/M
3300031768|Ga0318509_10006375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4789Open in IMG/M
3300031768|Ga0318509_10323049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella864Open in IMG/M
3300031769|Ga0318526_10045711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1655Open in IMG/M
3300031770|Ga0318521_10516847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia718Open in IMG/M
3300031770|Ga0318521_10950059Not Available526Open in IMG/M
3300031771|Ga0318546_10069213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2248Open in IMG/M
3300031771|Ga0318546_10484004Not Available868Open in IMG/M
3300031771|Ga0318546_10842828All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300031771|Ga0318546_10930173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. Soil748612Open in IMG/M
3300031777|Ga0318543_10057944Not Available1596Open in IMG/M
3300031778|Ga0318498_10079754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1476Open in IMG/M
3300031778|Ga0318498_10159789Not Available1025Open in IMG/M
3300031780|Ga0318508_1053804Not Available1069Open in IMG/M
3300031781|Ga0318547_10506693Not Available745Open in IMG/M
3300031793|Ga0318548_10005824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4524Open in IMG/M
3300031794|Ga0318503_10011752Not Available2321Open in IMG/M
3300031794|Ga0318503_10155212Not Available738Open in IMG/M
3300031795|Ga0318557_10357604Not Available671Open in IMG/M
3300031796|Ga0318576_10105583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1289Open in IMG/M
3300031796|Ga0318576_10342376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300031796|Ga0318576_10439656All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300031797|Ga0318550_10033798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2218Open in IMG/M
3300031797|Ga0318550_10099781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1368Open in IMG/M
3300031797|Ga0318550_10419739Not Available647Open in IMG/M
3300031797|Ga0318550_10618016Not Available520Open in IMG/M
3300031798|Ga0318523_10153116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1146Open in IMG/M
3300031798|Ga0318523_10230504Not Available926Open in IMG/M
3300031799|Ga0318565_10446393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces626Open in IMG/M
3300031805|Ga0318497_10007121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4976Open in IMG/M
3300031805|Ga0318497_10055304Not Available2054Open in IMG/M
3300031819|Ga0318568_10563902Not Available710Open in IMG/M
3300031819|Ga0318568_11004259Not Available515Open in IMG/M
3300031821|Ga0318567_10762308Not Available548Open in IMG/M
3300031832|Ga0318499_10168685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii854Open in IMG/M
3300031833|Ga0310917_10379808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia960Open in IMG/M
3300031835|Ga0318517_10214935All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300031835|Ga0318517_10566899Not Available510Open in IMG/M
3300031859|Ga0318527_10215934Not Available813Open in IMG/M
3300031859|Ga0318527_10373071Not Available608Open in IMG/M
3300031860|Ga0318495_10333700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii672Open in IMG/M
3300031879|Ga0306919_10133426All Organisms → cellular organisms → Bacteria1792Open in IMG/M
3300031879|Ga0306919_10204707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1468Open in IMG/M
3300031879|Ga0306919_11033005Not Available628Open in IMG/M
3300031879|Ga0306919_11321929Not Available545Open in IMG/M
3300031890|Ga0306925_10993107All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300031893|Ga0318536_10098048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1467Open in IMG/M
3300031893|Ga0318536_10172756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1099Open in IMG/M
3300031894|Ga0318522_10108967Not Available1029Open in IMG/M
3300031894|Ga0318522_10373223All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300031897|Ga0318520_11050307Not Available515Open in IMG/M
3300031910|Ga0306923_10674732Not Available1153Open in IMG/M
3300031941|Ga0310912_10351430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1145Open in IMG/M
3300031945|Ga0310913_11050336Not Available570Open in IMG/M
3300031946|Ga0310910_10129701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1908Open in IMG/M
3300031947|Ga0310909_10502217All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300032009|Ga0318563_10108988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1468Open in IMG/M
3300032009|Ga0318563_10196475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1087Open in IMG/M
3300032009|Ga0318563_10782857Not Available511Open in IMG/M
3300032039|Ga0318559_10052614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1709Open in IMG/M
3300032039|Ga0318559_10079405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1426Open in IMG/M
3300032039|Ga0318559_10587504Not Available519Open in IMG/M
3300032041|Ga0318549_10074875Not Available1442Open in IMG/M
3300032043|Ga0318556_10097003Not Available1489Open in IMG/M
3300032043|Ga0318556_10147688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1212Open in IMG/M
3300032055|Ga0318575_10285869Not Available834Open in IMG/M
3300032059|Ga0318533_10478661All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300032059|Ga0318533_10772771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300032066|Ga0318514_10479283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia662Open in IMG/M
3300032067|Ga0318524_10142365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1209Open in IMG/M
3300032067|Ga0318524_10294849Not Available838Open in IMG/M
3300032068|Ga0318553_10053891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1986Open in IMG/M
3300032068|Ga0318553_10327006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermatophilaceae → Piscicoccus → Piscicoccus intestinalis802Open in IMG/M
3300032089|Ga0318525_10577071Not Available574Open in IMG/M
3300032090|Ga0318518_10314742All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300032091|Ga0318577_10311017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium754Open in IMG/M
3300032091|Ga0318577_10567634Not Available540Open in IMG/M
3300032094|Ga0318540_10388821Not Available674Open in IMG/M
3300032205|Ga0307472_100904766Not Available817Open in IMG/M
3300032261|Ga0306920_100441580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1933Open in IMG/M
3300032261|Ga0306920_100930968Not Available1269Open in IMG/M
3300032770|Ga0335085_11418059Not Available727Open in IMG/M
3300032895|Ga0335074_10787082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria892Open in IMG/M
3300033134|Ga0335073_11944171All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300033158|Ga0335077_10803335Not Available958Open in IMG/M
3300033158|Ga0335077_11376496Not Available681Open in IMG/M
3300033289|Ga0310914_11565386Not Available563Open in IMG/M
3300033290|Ga0318519_10066836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. Llam01852Open in IMG/M
3300033290|Ga0318519_11030452Not Available512Open in IMG/M
3300033805|Ga0314864_0141178Not Available609Open in IMG/M
3300034818|Ga0373950_0006982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus1740Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil38.13%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.35%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.68%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.68%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.01%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.01%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.01%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.01%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.01%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.34%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.34%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.67%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.67%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.67%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.67%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.33%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.33%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.33%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.33%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.33%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.33%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.33%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025588Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300027072Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes)EnvironmentalOpen in IMG/M
3300027172Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031671Soil microbial communities from Risofladan, Vaasa, Finland - OX-1EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11611648913300000956SoilMTGWYAQRTPDRSAKAMIAVTLLAMLLVAAVPVALLAAVVM
JGI12635J15846_1033755013300001593Forest SoilMTGWYAERTPDRSAKAVIAVTMLALLLVAAVPVALLAGVVMMMLG
Ga0062389_10465058613300004092Bog Forest SoilMTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAAVVMMMLG
Ga0066398_1004405913300004268Tropical Forest SoilVVTGWYVERTPDRSAKAVIAVTLLALLLVAVVPVALLAGVV
Ga0070690_10174325313300005330Switchgrass RhizosphereMTGWYAERTPDVPAKAMIAVTLLALLLVTAVPVALLAAVIMMM
Ga0066388_10005843413300005332Tropical Forest SoilMTGWFAERAPGRSATAMIAVMLLALLLVAAVPVALLAAVV
Ga0066388_10498979913300005332Tropical Forest SoilMTGWYAEPTLDKPAKAVMAVMVLALLLVAAVPVALLAAVV
Ga0066388_10765176723300005332Tropical Forest SoilMTGWYAERTADRPAKAMIAVTLLALLLVAAVPVALLAAVIM
Ga0008090_1529606323300005363Tropical Rainforest SoilMTGWYAEPSLDRPAKAMIAVMLLALVLVAAVPVALLAAVVMM
Ga0070709_1067565113300005434Corn, Switchgrass And Miscanthus RhizosphereMTGWYAQRRPDGSAKTVIAMALLALLLVAAVPVALLAGVVMV
Ga0070709_1148254023300005434Corn, Switchgrass And Miscanthus RhizosphereMTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAAVVMM
Ga0070713_10021209733300005436Corn, Switchgrass And Miscanthus RhizosphereMTGWYAQRRPDGSAKTVIAMALLALLLVAAVPVALLAGVVMVL
Ga0070698_10128261013300005471Corn, Switchgrass And Miscanthus RhizosphereMTGWYAQQMPGRSAKAVIAVTLLALLLVAAVPVALLAGVVMM
Ga0070733_1020172913300005541Surface SoilMTGWYAESRPDRSGKFMVAVTVLALALVGLLPLALL
Ga0070665_10028249343300005548Switchgrass RhizosphereMTGWYAERAPGRSALAMIAVMLLALLLVAAVPVALLA
Ga0070761_1110511423300005591SoilMTGWYAERTPDRSGKAVIAVTLLALLLVAAVPVGLLAAVVMMMLGHVVGG
Ga0070762_1069329023300005602SoilMTGWYAERTPARSAKAVIGVTMLALVLVAAVPVALLAAV
Ga0070763_1086738723300005610SoilMMTIGNAEPMPDRSAKAVITLTLLALLLVAAVPVALLAGVVVML
Ga0068859_10060229113300005617Switchgrass RhizosphereMTGWYAERTPDVPAKAMIAVTLLALLLVTAVPVALLAAVIMIML
Ga0066903_10580184123300005764Tropical Forest SoilMTVWYAERMPDRSAKVMIAVTLLALLLVAAVPVALLAGVIIMMLG
Ga0070766_1028564523300005921SoilMTGWYAERGPGRSARAMIAVMLLALLLVAAVPVALLA
Ga0070717_1048079623300006028Corn, Switchgrass And Miscanthus RhizosphereMTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAAVVMMILGYV
Ga0070717_1089160113300006028Corn, Switchgrass And Miscanthus RhizosphereMTGWYAQRRPDWSGRAVIAMTLLALLLVAAVPVALLAGVVMVL
Ga0075023_10062340723300006041WatershedsMTDWYAERTPDRSAKAVIAVSLLALLLVAAVPVALLAGVVMMMLG
Ga0075017_10003659683300006059WatershedsMTDWHAERTPARSGKAMIAVTLLALGLVAAVPVALLA
Ga0075017_10084554513300006059WatershedsMTDWYAERTPDRSAKAVIAVSLLALLLVAAVPVALLAGVVMMMLGHV
Ga0070716_10047159613300006173Corn, Switchgrass And Miscanthus RhizosphereMTGWYAERAPGRSALAMIAVMLLALLLVAAVPVAL
Ga0075014_10097582213300006174WatershedsMTDWYAERTPDRSAKAVIAVSLLALLLVAAVPVALLAGVVMM
Ga0070765_10004265763300006176SoilMTGWHAEQTPGRSAKAVIIVTLLALLLLTAVPVALLAA
Ga0074051_1000843033300006572SoilMTGWYAERTPDRPAKAMIAVTLLALLLVAAVPVALLA
Ga0079222_1063464233300006755Agricultural SoilMTRWYTERMPNRSAKAVIAVTLLALLLVAAVPLALLAG
Ga0075426_1013119013300006903Populus RhizosphereMMTSWHAERSPDGSARAVIAMTLLALLLVAAVPVALLAAVVMMAIG
Ga0075424_10212259033300006904Populus RhizosphereMTKWYTERMPNRSAKAVIAVTLLALLLVAAVPVALLAGVVMM
Ga0075436_10154446413300006914Populus RhizosphereMTGWYAERTPDRPAKVMIAVTLLALLLVAAVPVSL
Ga0079219_1159947533300006954Agricultural SoilMTGWYAARTPDRSAKAMIAVTLLALLLVAAVPVALLA
Ga0079219_1167503823300006954Agricultural SoilMTGWYAERTPDGPAKAMIAVTLLALLLVAAVPVALLA
Ga0099829_1023385023300009038Vadose Zone SoilMTGWYAERTPDRPAKAMIAVTLVALLLVAAVPVALLAAAVMMMLG
Ga0099830_1131022513300009088Vadose Zone SoilMTGWYAERTPDRSAKAMIAVTLLALLLVAAVPAALLAAVVMMILGYVVG
Ga0066709_10129901113300009137Grasslands SoilMTGWYAERSPGRPARAVIAVTLLALPLVAAVPVVLL
Ga0116218_123402723300009522Peatlands SoilMTGWYAEQTPDRSAKAVIAVTLLALLLVAAVPVALL
Ga0105238_1287678123300009551Corn RhizosphereMTRWYTERMPNRSAKAVIAVTLLALLLVAAVPVALLA
Ga0116105_118042913300009624PeatlandMTGWYGQRTPDRSAKAVIAVTLLALLLVAAVPLALLTGVVMMMLGHVVGGL
Ga0116216_1037106813300009698Peatlands SoilMTDWHEERTPRRSAKAVIAVTLLALLLLTAVPVAL
Ga0116217_1042027813300009700Peatlands SoilMTGWYAERTPDRSARAVIAVTLLALLLVAAVPVALL
Ga0116134_107307513300009764PeatlandMTGWYAERMPDRPARAVIAVTLLALLLVAAVPVALLAAVVMMM
Ga0126374_1021576923300009792Tropical Forest SoilMMTGWHAERTPDRPAKAMIAVTLLALLLVAAVPVALLAAVVMM
Ga0126380_1001155913300010043Tropical Forest SoilMTAWYAQRAPDRPTKAMIAVTLLALLLVAAVPVAL
Ga0126380_1073812113300010043Tropical Forest SoilMTSWYAERAPDRPAKAMVALTLLALLLVAAVPVALLAAVVMM
Ga0126384_1186230013300010046Tropical Forest SoilMTGWYAERTPGRPAKAAIAMTLLALLLVAAVPVALLAAVVMMMLGYVVGG
Ga0126373_1007017053300010048Tropical Forest SoilMMTGWYAERTPGRSAKAMIAVMLLALLLVAAVPLALLAAV
Ga0126373_1027681133300010048Tropical Forest SoilMTGWYAERTPDRSAKTMIAVTLLALLLVAAVPVALLAA
Ga0126373_1045540713300010048Tropical Forest SoilMTGWYAERMPDRSAKAMIGVTLLALLLVAAVPVALLAGVVIMM
Ga0126373_1177592523300010048Tropical Forest SoilMTGWYAERTPDRSARVVIAVTLLALLLVAAVPVALLAGVV
Ga0126373_1190273223300010048Tropical Forest SoilMTGWYAERRPDRSARAMIAVTLLALLLVAAVPVALLA
Ga0126373_1214469313300010048Tropical Forest SoilMTGWYAERTDGRSGKAVIAVTLLALLLVAAVPVALLA
Ga0126370_1229749713300010358Tropical Forest SoilMTGWYAQRTPDRSAKAVIAVTLLALLLVAAVPVALLAGV
Ga0126376_1114059613300010359Tropical Forest SoilMTGWYAERAPDRRAKAMIAMTLLALLLVAAVPVALLAA
Ga0126372_1068487933300010360Tropical Forest SoilMTGWYAERTTDRSAKAMFAVTLLALLLVAAVPVALLAAVVMMLLGYVA
Ga0126372_1135509133300010360Tropical Forest SoilMMTGWYAERTPNRSAKAVSAVTLLALLLVATVPVALL
Ga0126372_1232172213300010360Tropical Forest SoilMTGWYAERTPDRSTKVVIAVTLLALLLVAAVPVALLA
Ga0126378_1047185913300010361Tropical Forest SoilMTGWYAKRTPDRSAKTVIAVTLLALLLVAAVPVALLA
Ga0126378_1138951523300010361Tropical Forest SoilVSVMAVWHAERTPDRSARAVIAVTLLALLLVAAVPVALLAGVVMMMLGHV
Ga0126379_1358867513300010366Tropical Forest SoilMTGWYAEQTTDRSAKAMIAVTLLALLLVAAVPVAL
Ga0126381_10084994713300010376Tropical Forest SoilMTGWYVERTPDRSAKAVIAVTLLALLLVAVVPVALLAGVVL
Ga0126381_10171889723300010376Tropical Forest SoilMTGWYAERMPDRSTKAMIAVTLLALLLVAAVPVALL
Ga0126381_10249664713300010376Tropical Forest SoilVSVVTGWYVERMPDRSAKAVIAVTLLALLLVAVVPVALLAGMVLMMLGHVAG
Ga0136449_10265955313300010379Peatlands SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVM
Ga0134123_1220251523300010403Terrestrial SoilMTGWYAERTPDVPAKAMIAVTLLALLLVTAVPVALLAAVIMMMLGYV
Ga0126347_148884323300010867Boreal Forest SoilMTGWYAERMPGRSAKAMIAVTLLALLLVAAVPVALLA
Ga0126350_1222027213300010880Boreal Forest SoilLRGERDAGWYAERTPGRPAKAVIAVTLLALLLVAAVPVALLAAVV
Ga0137388_1054856013300012189Vadose Zone SoilMTGWYAKRTPDRSAKAVIDVTQLELQLVAAVPVALLPGSIMMLLGH
Ga0137364_1044970613300012198Vadose Zone SoilMTSWYAERTPDRPAKAMIAVTLLALLLVAAVPVALLAA
Ga0137381_1086502413300012207Vadose Zone SoilMTGWHAERTPDRPARAMIAVTLVALLLVAAVPVALL
Ga0137378_1069389423300012210Vadose Zone SoilMTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAAVVLMMLG
Ga0137378_1181373713300012210Vadose Zone SoilMTGWYAERIPDRPAKAVIAVTLLALLLVAAVPVVLLAGVVMM
Ga0137377_1115263313300012211Vadose Zone SoilMTGWYAGRMPGRSAKAVIAVILLALLLVAAVPVAL
Ga0137372_1074749323300012350Vadose Zone SoilMTGWYAERTPDRPAKAMIAVTLVALLLVAAVPVALLAAVVMM
Ga0137385_1078285613300012359Vadose Zone SoilMMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVAL
Ga0137361_1076429413300012362Vadose Zone SoilMMTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVA
Ga0137390_1027801113300012363Vadose Zone SoilMTGWYAERTPDRPAKAMIAVTLVALLLVAAVPVALLAAV
Ga0137407_1003163313300012930Vadose Zone SoilMTGWYAERTPDRPAKVMIAVTLVALLLVADVPVAL
Ga0164307_1148615833300012987SoilMTGWYAERASGRSAKAMIVVMLLALLLVAAVPVALLAAVVM
Ga0181524_1011943413300014155BogMTGWYAERMPDRPARAVIAVTLLALLLVSAVPVALLAAV
Ga0181522_1006131513300014657BogMTRWYAERVPNRSARGVIAVTLLALLLVAAVPLALLAG
Ga0132258_1122405313300015371Arabidopsis RhizosphereMTGWYAERTPDGPAKAMIAVTLLALLLVAAVPVALLAAVVMMMLGYV
Ga0132256_10121286313300015372Arabidopsis RhizosphereMTSWYAERTPDRSAKVMIAVTLLALLLVAAVPVSLLAAVVMMM
Ga0182041_1233633213300016294SoilMTGWYVERTPNWSGKAVTAVTLLALLLVAAVPVALLAAV
Ga0182032_1097174313300016357SoilMTGWYVERTPDRSAKVVIATTLLALLLVAAVPVALLAGVVIMMLGHV
Ga0182040_1010003633300016387SoilMTGWYVERMPDRSAKVVIATTLLALLLVAAVPVALLAGVVIMMLGH
Ga0182039_1035080433300016422SoilMTGWYVERTPDRSAKAVMAATLLALLLVAVVPVALLAGVVMMVLG
Ga0182038_1088036823300016445SoilMTGWYAERTPDRTAWAVIAVTLVALLLVAAVPVALLAG
Ga0187806_102939723300017928Freshwater SedimentMTDWYAGRTPDRSTKAVIAVTLLALLLVAAVPVALLA
Ga0187814_1017400813300017932Freshwater SedimentMTGWHAERTPGRSAKAVIAVTLLALLLLTAVPVALLAAVIMM
Ga0187814_1043497413300017932Freshwater SedimentMTGWYADRTPDRSAKAVIAATLLALLLVASLPVALLAGVVMMMLGHVVGGL
Ga0187821_1042829813300017936Freshwater SedimentVSVMTGWYAERMPNRSAKAVIVVTLLALLLVAAVPVA
Ga0187809_1040036213300017937Freshwater SedimentMMTVWYAERTPDRSAKAMIAVTLLALVLVAVVPVALLAGVVM
Ga0187854_1006202633300017938PeatlandMTGWYAERMPDRPARAVIAVTLLALLLVAAVPVALLA
Ga0187879_1017866723300017946PeatlandVSVTTGWYAERTPGRSATAVIAMTLLALLLVATVHS
Ga0187779_1080648213300017959Tropical PeatlandMTGWYAERTPDRSGRAVIAVALLAMLLVAAVPAALLAAV
Ga0187782_1131335713300017975Tropical PeatlandMTVWYAERTPDRSARGVIAVTLLALLLVAAVPVALLAGVVMMMLGHV
Ga0187782_1153426323300017975Tropical PeatlandMTGWYTERTPDRSAKAVIAVTLLALLLVAAMPVAL
Ga0187816_1025212813300017995Freshwater SedimentMTGWYAERTPDGSAKAVIAVTLLALLLLAAMPVALLAGVVMM
Ga0187805_1039727413300018007Freshwater SedimentMTGWHAERTPDRSARAVIALTLLALLLVAAVPVALLAAV
Ga0187880_144218513300018016PeatlandMTGWYAERTPDRSAKAMIAVTLLALMLVAAVPVALLAAVVMMMLGYV
Ga0187787_1046286713300018029Tropical PeatlandVSVMTGWYAERTPDRPAKVMIAVMLLALLLVAAVPVALLAAVV
Ga0187867_1034804613300018033PeatlandMTGWYAERTLDRSARAMIAVTLLALLLVAAVPVALLAAVVMMMLGY
Ga0187863_1017698033300018034PeatlandMTGWYAERTPDRQAKAVIAVTLLALLLVAAVPVALLAGVVMMMLG
Ga0187883_1052275013300018037PeatlandMTGWYAERTPDRSAKAVVAVTLLALLLVAAVPVAL
Ga0187883_1053010713300018037PeatlandMNGWYAERAPGRPARAVIAVTLLALLLVAAVPVALL
Ga0187890_1075126923300018044PeatlandMTGWNPERTPGRSAKALIALTLLALLLVAAVPVALL
Ga0187766_1063361813300018058Tropical PeatlandMTGWYAERTPDRSARAVTAVTLLALLLVAAVPVALLAAVVMMTL
Ga0187766_1096623113300018058Tropical PeatlandMTGWHAERTPGRSAKAVIAVTLLALLLLTAMPVALLAAAIMMILGHVVG
Ga0187784_1131095413300018062Tropical PeatlandMTGWYAERTPDRSAKTVIVLTLLALLLVAAVPVAL
Ga0187772_1007308643300018085Tropical PeatlandMTGWYAERTPDRSARAVIAMTLLALLLVAAVPVALLAAVV
Ga0187772_1147490223300018085Tropical PeatlandMTGWYAERTSDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMMLG
Ga0193751_115862533300019888SoilMTGWYAERTPDRPAKAMIAVTLVALLLVAAVPVAL
Ga0210382_1040642623300021080Groundwater SedimentMTGWYAERTPDRPAKAMIAVTLVALLLVAAVPVACWPQWS
Ga0210404_1059801413300021088SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVLI
Ga0210388_1093599213300021181SoilMTGWHEEGMPGRSARAVIVVTLLALLLVAAVPVALLAAVI
Ga0210389_1045899813300021404SoilMMTNWYTERMPGRSGKAVIAVTLLALLLVAAVPLALLA
Ga0210389_1078498413300021404SoilMTGWRADRTAGRSAKAVIVLTLLALLLLTAVPVALLAAV
Ga0210389_1147663023300021404SoilMTRWYAERMPDRSARAVIAVALLALLLVAAVPVALLAGLILMV
Ga0210386_1174218313300021406SoilMTCWYAERTPGRSAKAMIALTLLALLLVAAVPIALLAAVVMM
Ga0210383_1034016633300021407SoilMTGWYTERTSDRSAKAVVAVTLLALLLVAAVPVALLAGAL
Ga0210392_1070934623300021475SoilMMTNWYTERMPGRSGKAVIAVTLLALLLVAVVPLALLAGLFLM
Ga0126371_1230246823300021560Tropical Forest SoilMTVWYAERMPDRSAKVMIAVTLLALLLVAAVPVALLAGVIIMMLGN
Ga0126371_1234748423300021560Tropical Forest SoilMMTGWYAERTPDRPAKAMIAVTLLALLLVATVPVALLAAVIM
Ga0208820_103904233300025576PeatlandMTGWYAERMPDRPARAVIAVTLLALLLVAAVPVALLAAVVM
Ga0208586_109993013300025588Arctic Peat SoilMMTGWYAERMPGRSAKAMIAVTLLALLLVAAVPVALLAAVV
Ga0208586_111563013300025588Arctic Peat SoilMTGWYAGRTPGRSAKAMIAVTLLALLLVAAVPVALLA
Ga0208219_100069493300025625Arctic Peat SoilMTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAAVVMMMLGYVAGG
Ga0207646_1038907723300025922Corn, Switchgrass And Miscanthus RhizosphereMMTDWYAERTPGRPAKAMIAVTLLALLLVAAVPVALLA
Ga0207646_1070045313300025922Corn, Switchgrass And Miscanthus RhizosphereMTGWYVERAPDRPAKAVIAVTLLALLLVAAVPMAL
Ga0207664_1085961523300025929Agricultural SoilMTGWYVERTPNRSAKAVTAVTLLALLLVAVVPVALLAAVAMMMLG
Ga0207674_1195975923300026116Corn RhizosphereMTGWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLA
Ga0209871_107547023300026217Permafrost SoilMTSWYGEQAAGRPAKAMIAVTLLALLLVAAVPVALLAAVVMM
Ga0208238_101328913300027072Forest SoilMTSWYAERTPDRSAKAMIAVMFLALLLVAAVPVALLAAVVM
Ga0208098_102922313300027172Forest SoilMTGWYAERRPDRSAKAVIAVTLLALLLVAALPVALLAAV
Ga0209466_109530523300027646Tropical Forest SoilMTGWYAQRAPDRPTKAMIAVTLLALLLVAAVPVALLAA
Ga0209333_114515623300027676Forest SoilMTDWYVERTPDRSGKAVIAVTIFALLLVAAVPVALLA
Ga0209448_1013379733300027783Bog Forest SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALMAGVVMM
Ga0209517_1002335513300027854Peatlands SoilMTGWYAERTPDRSARAVIAVTLLALLLLLVAAVPVALLAGVVMM
Ga0209167_1072709623300027867Surface SoilMTGWYAESRPDRSGKFMVAVTVLALALVGLLPLALLAGVIV
Ga0209380_1025179213300027889SoilMTRWYADRTPERSARSVIAVALLALLLVAAMPVALLAAVIM
Ga0209624_1018012123300027895Forest SoilMMTNWYTERMPGRSGKAVIAVTLLALLLVAAVPLALLAGLFL
Ga0209624_1104529323300027895Forest SoilVTDLRAERTSDRSAKAVITVTLLALVLVAAVPVAA
Ga0209488_1030626633300027903Vadose Zone SoilMTGWHAERMPGRSAKAVIAVTLLALLLVAAVPVALLAA
Ga0307280_1026084923300028768SoilMTSWYAERPDRPAKAMIAVMLLALLLVAAVPVALLA
Ga0302232_1043314323300028789PalsaMTGWYAERTPGRSARAVIAVTLLALLLVAAVPVALLA
Ga0302226_1011419523300028801PalsaVSVMTGWYVERTPDRSARAVIAVTVLALLLVAAVPV
Ga0302157_1009870013300028813BogMTGWYVERTPDRSAKAVIAVTLLALLLVAAVPLALL
Ga0302229_1007871213300028879PalsaMTGWYAERTPDRPAKAVIAVTLLALLLVAAVPVALLAAVV
Ga0308309_1004392513300028906SoilMTGWHEEGMPGRSARAVIVVTLLALLLVAAVPVALLA
Ga0308309_1027135913300028906SoilMTGWHAEQTPGRSAKAVIIVTLLALLLLTAVPVALLA
Ga0311368_1070128613300029882PalsaMTGWYAERTPGRSAKAVIGVTLLALLLVAAVPLALLAGMVL
Ga0311326_1021772123300029917BogMTGRYAERTLDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMMLG
Ga0311340_1054189213300029943PalsaMTDWYVERTPDRSGKAVIAVTLLAVLLVAAVPVALLA
Ga0311346_1013887713300029952BogMTGWYVERTPDRSAKAVIAVTLLALLLVAAVPLALLAGVVIM
Ga0311339_1167940213300029999PalsaMNGWYAERRPDRSAKAVIAVTLLALLLVAAVPVALLAGVV
Ga0302178_1013010613300030013PalsaMTDWYTERSSTRSAKAVIAVSLLALLLVAAVPVALLA
Ga0302177_1002364183300030053PalsaMMGWYGERTPDRSAKAVIAVTLLALLLVAAVPAALLAGVVMMMLGHVVGGLAL
Ga0302177_1065613613300030053PalsaMNGWYAERRPDRSAKAVIAVTLLALLLVAAVPVALLAGVVIMALGHV
Ga0302182_1018065623300030054PalsaMTGWHAERTPGRPARAMIAVTLLALLLVAAVPVALLAAVVMMMLGYV
Ga0311372_10008362243300030520PalsaMMTGWYAERTPGRSAKALIAVTLLALLLVAAVPVA
Ga0302316_1035862813300030646PalsaMTGRYAERTLDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMILGHVA
Ga0311345_1055134123300030688BogMTGRYAERTLDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMILG
Ga0302307_1064432423300031233PalsaMMGWYGERTPDRSAKAVIAVTLLALLLVAAVPAALLAGV
Ga0302324_10048273033300031236PalsaMMTGWYAERTPGRSAKALIAVTLLALLLVAAVPVALLAGVVMMLLGHV
Ga0318516_1039158423300031543SoilMTVWYADRTAGRPARAMIGVTLLALLLVAAVPVALLAAVVMMMLGYVVGGLAV
Ga0318534_1019338313300031544SoilMTVWYAERMPDRPAKTMIAVTLLALLLVAAVPVALLAA
Ga0318534_1073397913300031544SoilMTGWYAERMPDRPAKAMIAVTLLALLLVAAVPVALLAAVVIMML
Ga0318534_1077382913300031544SoilVSVMTGWYAERTPDRSAKALIAVTLIALLLVAAVPVALQA
Ga0318538_1025444713300031546SoilVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMML
Ga0318538_1076941823300031546SoilMTVWYAERTPGRPARAMIAVTLLALLLVAAVPVALLAAVVMMMLGY
Ga0318571_1006899623300031549SoilMTGWYLERTPGRPATAVIAATLLALVLVALVPVALLAAVAMM
Ga0318528_1015585523300031561SoilVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVM
Ga0318528_1020548913300031561SoilMTSWYVERTPDRSAKAVIVATLLALLLVAVVPVALLAGVVM
Ga0318573_1066334713300031564SoilMTGWYVEQTPNRPAKAVVAATLLALLLVAVVPVALLAGVVMMMLGHVIG
Ga0318515_1004719213300031572SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVMML
Ga0318515_1008285633300031572SoilMTGWYVERMPDRSAKVVIATTLLALLLVAAVPVALLA
Ga0310915_1017310823300031573SoilMTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAVVM
Ga0310915_1081703313300031573SoilVSVVTGWYVERTPDRWAKAMIAVTLFALLLVAAVPVALL
Ga0307372_1033527023300031671SoilMTGWHAERTPGRSAKAVIAVTLLALLLVTAVPVAL
Ga0318561_1081987123300031679SoilMTGWYAERTPDRTAWAVIAVTLVALLLVAAVPVALLAGVVM
Ga0318574_1006416743300031680SoilMTGWHAERAPDRPATAVIAVTLLALLLVAAVPVALLAGMVLV
Ga0318574_1020470313300031680SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVV
Ga0318572_1032361923300031681SoilVSVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMMLG
Ga0318572_1084671013300031681SoilVSVMTGWYAERMPDRPARAVTAVTLLALLLVAAVPVALLAA
Ga0318560_1004086533300031682SoilMTGWYMERTPNRSAQAVIAVTLLALLLVAVVPVALLAGVVMM
Ga0318560_1021422813300031682SoilMTGWYVEQTPNRPAKAVVAATLLALLLVAVVPVALLAGVV
Ga0318560_1038360813300031682SoilMTGWYVERMPDRSAKVVIATTLLALLLVAAVPVALLAG
Ga0310686_10508100013300031708SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVIMMLG
Ga0310686_10623833513300031708SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLA
Ga0310686_10629141713300031708SoilMTGWYAERTPGRSAKAVIAVMLLALLLVAAVPVAL
Ga0318496_1085073913300031713SoilMTGWYAEQTSDRSAKAVIAVTLLALLLVAIVPLALLAGVVMMILG
Ga0307476_1019475443300031715Hardwood Forest SoilMTGWYAQRTPDRSARAVIVVTLLALLLVAAVPVAL
Ga0307476_1031326113300031715Hardwood Forest SoilMMTGWYAKRAPDRSGKAVIAVTLLALLLVAAVPVALLAGLV
Ga0306917_1011471643300031719SoilMTVWYADRTAGRPARAMIGVTLLALLLVAAVPVALLAAVVMMMLGYV
Ga0306917_1018616633300031719SoilMTGWYLERTPGRPATAVIAATLLALVLVALVPVALLAAVAMMVLG
Ga0318493_1071098113300031723SoilMTGWYVERTPGRPAIAVIAATLLALLLVAVVPVALLAGVV
Ga0318500_1006121613300031724SoilMTSWYVERTPDRSAKAVIVATLLALLLVAVVPVAL
Ga0306918_1016748413300031744SoilMTGWYVERTPDRSAKVVIATTLLALLLVAAVPVALLAGVVIMMLG
Ga0318492_1023166423300031748SoilVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMMLG
Ga0318492_1081914313300031748SoilMMTGWYAERTPDRSAKAVIAMTLLALLLVAAVPLALLAAVIIM
Ga0318494_1040749913300031751SoilMTGWYAELMPDRPAKAVIAVTLLALLLVAAVPVALLAAVII
Ga0318494_1080545913300031751SoilMTGWYAEQTSDRSAKAVIAVTLLALLLVAIVPLAL
Ga0318535_1009121213300031764SoilVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMM
Ga0318535_1031258113300031764SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVAL
Ga0318554_1008521343300031765SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMLLG
Ga0318509_1000637553300031768SoilMTGWYLERTPGRPATAVIAATLLALVLVALVPVAL
Ga0318509_1032304913300031768SoilMTSWYAERTPDRSAKAMIAVTLLALLLVAAVPVAL
Ga0318526_1004571133300031769SoilMTGWYVERTPDRSAKAVMAATLLALLLVAVVPVALLAGVVMMVLGHV
Ga0318521_1051684713300031770SoilMTGWHAERAPDRPTTAVIAVTLLALLLVAAVPVALLA
Ga0318521_1095005913300031770SoilMTGWYVERMPNRSAKAVIAATLLALLLVAVVPVALVAG
Ga0318546_1006921333300031771SoilMTGWYVERMPDRSAKVVIATTLLALLLVAAVPVALLAGVVI
Ga0318546_1048400423300031771SoilMTGWYMEQTPDRSARAVIAVTLLALLLVAAVPVALLAGVI
Ga0318546_1084282823300031771SoilMTGWYMERTPNRSAQAVIAVTLLALLLVAVVPVAL
Ga0318546_1093017323300031771SoilMTVWYAERMPDRPAKTMIAVTLLALLLVAAVPVALLAAVVIMMLG
Ga0318543_1005794423300031777SoilMTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAVVMM
Ga0318498_1007975423300031778SoilMTGWYAERTSDRSARAVIAVTLLALLLVAAVPVALLAAVVMMM
Ga0318498_1015978923300031778SoilMTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAVVMMMLG
Ga0318508_105380423300031780SoilMTGWYAERTPDRSARIMTALALLALVLVAAVPVALL
Ga0318547_1050669313300031781SoilVSVMTGWYAERMPDRPARAVTAVTLLALLLVAAVPVALLAAVVMMLLGHVVG
Ga0318548_1000582433300031793SoilMTGWYAERMPDRPARAVTAVTLLALLLVAAVPVALLAAVVMML
Ga0318503_1001175213300031794SoilMTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAV
Ga0318503_1015521223300031794SoilMTGWYVERTPGRPAIAVIAATLLALLLVAVVPVALLAGVVM
Ga0318557_1035760423300031795SoilVSVMTGWYAERMPDRPARAVTAVTLLALLLVAAVPVALLAAVVMMLLG
Ga0318576_1010558313300031796SoilMTGWYVERTPGRPAMAVIAATLLALLLVAVVPVALLAG
Ga0318576_1034237623300031796SoilMTGWYLERTPGRPATAVIAATLLALVLVALVPVALLAAVAM
Ga0318576_1043965623300031796SoilMTVWYADRTAGRPARAMIGVTLLALLLVAAVPVALLAAVVMMMLG
Ga0318550_1003379843300031797SoilMTGWYVERTPDKSAKAVVAVTLLALLLVAVVPVAL
Ga0318550_1009978123300031797SoilMTGWYVERTPDRSAKVVIATTLLALLLVAAVPVALL
Ga0318550_1041973913300031797SoilMTGWYLERTPGRPATAVIAATLLALVLVALVPVALLAAVAMMV
Ga0318550_1061801613300031797SoilMTGWYAEQTSDRSAKAVIAVTLLALLLVAIVPLALLAGVVMMILGH
Ga0318523_1015311623300031798SoilVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMMLGHVVG
Ga0318523_1023050423300031798SoilMTSWYAERTPDRSAKAMIAVTLLALLLVAAVPVALLAGVVM
Ga0318565_1044639313300031799SoilMTVWYAERMPVRSAKAVIAVTLLALLLVAVVPLALVAAV
Ga0318497_1000712113300031805SoilMTVWYAERAPDRPAKAMIAVTLLALVLVAAVPVALLAAVVMMM
Ga0318497_1005530423300031805SoilMTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAVVMMM
Ga0318568_1056390213300031819SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVMM
Ga0318568_1100425913300031819SoilMTSWYVERAPNRPAMAVIAATLFALLLVAAVPVALLAAVVM
Ga0318567_1076230813300031821SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAG
Ga0318499_1016868523300031832SoilVSVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMML
Ga0310917_1037980813300031833SoilMTSWYVERTPDRSAKAVIVATLLALLLVAVVPVALLAGVV
Ga0318517_1021493523300031835SoilMTVWYADRTAGRPARAMIGVTLLALLLVAAVPVALLAAVVM
Ga0318517_1056689923300031835SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVMMLL
Ga0318527_1021593413300031859SoilMTSWYVERTPNWSAKAVTAMSLLALLLVAAVPVALLAAVAMMMLGHVVG
Ga0318527_1037307123300031859SoilMTGWYMEQTPDRSARAVIAVTLLALLLVAAVPVALLAGVIL
Ga0318495_1033370013300031860SoilVSVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMMMLGHVV
Ga0306919_1013342613300031879SoilMTGWYAERTPDRPARAVIAVTLVALLLVAAVPVALLAGVVM
Ga0306919_1020470713300031879SoilMTGWYVERTPGRPAIAVIAATLLALLLVAVVPVALLAG
Ga0306919_1103300513300031879SoilMTGWYVERTPGRPAMAVIAATLLALLLVAVVPVALLAGVVMMMLGH
Ga0306919_1132192913300031879SoilMTSWYVERTPDRSAKVVIAMTLLALLLVAAVPVALLAGVVMMMLG
Ga0306925_1099310723300031890SoilMTVWYAERAPDRPAKAMIAVTVLALVLVAAVPVALLA
Ga0318536_1009804813300031893SoilMTGWYAELMPDRPAKAVIAVTLLALLLVAAVPVALLAGVIIMM
Ga0318536_1017275613300031893SoilMTVWYAERAPDRPAKAMIAVTLLALVLVAAVPVALLAAVVM
Ga0318522_1010896723300031894SoilMTGWYAERTPDRSARIMTALALLALVLVAAVPVALLAAVVMMMLGY
Ga0318522_1037322323300031894SoilMTGWYAERMPDRSAKAVIAVTLLALLLVAAVPVALLAGVV
Ga0318520_1105030713300031897SoilMTGWYAEQTPDRPARAMTAMALLALLLVAAVPVALLAAVVMMMLGYVVGGLAL
Ga0306923_1067473213300031910SoilMTGWYVERMPNRSAKAVIAATLLALLLVAVVPVALVA
Ga0310912_1035143033300031941SoilMTGWHAERAPDRPTTAVIAVTLLALLLVAAVPVALLAGMV
Ga0310913_1105033613300031945SoilMTGWYAEQTSDRSAKAVIAVTLLALLLVAIVPLALLAGVV
Ga0310910_1012970133300031946SoilMTGWYVERTPGRPAIAVIAATLLALLLVAVVPVALLAGV
Ga0310909_1050221723300031947SoilMTVWYADGTAGRPARAMIGVTLLALLLLVAAVPVAL
Ga0318563_1010898813300032009SoilVVTSWYVERTPDRWAKAVIAVTLLALLLVAAVPVALLAGVVMM
Ga0318563_1019647513300032009SoilMTGWYVERTPGRPAIAVIAATLLALLLVAVVPVALLAGVVMMM
Ga0318563_1078285713300032009SoilMTSWYVERTPNWSAKAVTAMSLLALLLVAAVPVALLAAVAMMM
Ga0318559_1005261413300032039SoilMTGWYAERTPDRTAWAVIAVTLVALLLVAAVPVALLAGVVMMM
Ga0318559_1007940533300032039SoilMTGWYVERTPDRSAKAVMAATLLALLLVAVVPVALLA
Ga0318559_1058750423300032039SoilMTGWYVERTPDRSAKAVIALTLLALLLVAAMPVALVAGVVMM
Ga0318549_1007487513300032041SoilMTGWYLERTPGRPATAVIAATLLALVLVALVPVALLAAVAMMVLGH
Ga0318556_1009700313300032043SoilMTGWYVERMPNRSAKAVIAATLLALLLVAVVPVALVAGVVMM
Ga0318556_1014768823300032043SoilMTGWYAELMPDRPAKAVIAVTLLALLLVAAVPVALLAAVIIM
Ga0318575_1028586913300032055SoilMTGWYAERTLGRSAMGVIAVTLLALLLVAAVPVALLAGV
Ga0318533_1047866133300032059SoilMTVWYAERAPDRPAKAMIAVTMLALVLVAAVPVSLLAAV
Ga0318533_1077277123300032059SoilMTGWYVEQTANRSAKAVVAVTLLALLLVAVVPVALLAGVVM
Ga0318514_1047928323300032066SoilMTGWYVERTPNRSATAVTAVTLLALLLVAAVPVALLAAVAMMMLGHVV
Ga0318524_1014236523300032067SoilMTSWYVERTPDRSAKAVIVATLLALLLVAVVPVALLAG
Ga0318524_1029484913300032067SoilVSVMTGWYAERMPDRPARAVTAVTLLALLLVAAVPVAL
Ga0318553_1005389143300032068SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALL
Ga0318553_1032700633300032068SoilMTGWYAERTPDRSAKAVVAVTLLALLLVAAVPVALLAGV
Ga0318525_1057707113300032089SoilMTGWYVERTPNRSATAVTAVTLLALLLVAAVPVALLAAVAM
Ga0318518_1031474213300032090SoilMTVWYAERAPDRPAKAMIAVTLLALVLVAAVPVAL
Ga0318577_1031101723300032091SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGV
Ga0318577_1056763413300032091SoilVSVMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAG
Ga0318540_1038882123300032094SoilMTVWYAERTPGRSAKTVIAVTLLALLLVAAVPVALLAGVVM
Ga0307472_10090476623300032205Hardwood Forest SoilMTGWYAERAPGRSALAMIAVMLLALLLVAAVPVALLAAV
Ga0306920_10044158033300032261SoilMTGWYMERTPNRSAQAVIAVTLLALLLVSVVPVALL
Ga0306920_10093096823300032261SoilMTGWYAERTPDRSAKAVIAVTLLALLLVAAVPVALLAGVVIM
Ga0335085_1141805923300032770SoilMMTGWYAERTPDRSGRAVIAVTLLALLLVAAVPVALLA
Ga0335074_1078708233300032895SoilMIGSHEQRTPARSASAMIAMTLLALLLLAAVPAALLAA
Ga0335073_1194417113300033134SoilMTGWYEERTPDRSGKAMIALTLLALLLVAAVPVALLAGVIMM
Ga0335077_1080333513300033158SoilMTGWRTEPTPDRSAKAVIAVTLLALLLVAAVPVALLAGLIMMLLGH
Ga0335077_1137649613300033158SoilMSGWYAEPTPDRSARAVIAVTLLALLLVAAVPVALLAA
Ga0310914_1156538623300033289SoilMTEPYAERTPDRSARAVIAVTLLGIVLVCSVEVGVV
Ga0318519_1006683623300033290SoilMTGWYAERMPDRPARAVTAVTLLALLLVAAVPVALLAAVVMMLLG
Ga0318519_1103045223300033290SoilMMTGWYAERTPDRSAMAVIAATLLALLLVAAVPVALLV
Ga0314864_0141178_480_6083300033805PeatlandMTGWYAERTPDRPARAMIAVTLLALLLVAAVPVALLAAVVMMM
Ga0373950_0006982_1605_17393300034818Rhizosphere SoilMTGRYAERTPDGPAKAMIAVTLLALLLVAAVPVALLAAVVMMMLG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.