NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F011242

Metagenome Family F011242

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F011242
Family Type Metagenome
Number of Sequences 293
Average Sequence Length 44 residues
Representative Sequence MQNNYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD
Number of Associated Samples 175
Number of Associated Scaffolds 288

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.03 %
% of genes near scaffold ends (potentially truncated) 20.48 %
% of genes from short scaffolds (< 2000 bps) 82.59 %
Associated GOLD sequencing projects 150
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.468 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(8.191 % of family members)
Environment Ontology (ENVO) Unclassified
(43.003 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(63.140 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 288 Family Scaffolds
PF00733Asn_synthase 25.00
PF00072Response_reg 20.14
PF00196GerE 15.97
PF07730HisKA_3 3.47
PF02518HATPase_c 2.08
PF13537GATase_7 2.08
PF13620CarboxypepD_reg 1.39
PF03160Calx-beta 1.04
PF05402PqqD 0.69
PF13517FG-GAP_3 0.69
PF13471Transglut_core3 0.69
PF06441EHN 0.35
PF00149Metallophos 0.35
PF13426PAS_9 0.35
PF00578AhpC-TSA 0.35
PF10096DUF2334 0.35
PF08487VIT 0.35
PF07494Reg_prop 0.35
PF07676PD40 0.35
PF10431ClpB_D2-small 0.35
PF02899Phage_int_SAM_1 0.35
PF03928HbpS-like 0.35

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 288 Family Scaffolds
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 3.47
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 3.47
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 3.47
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 3.47
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.35
COG3292Periplasmic ligand-binding sensor domainSignal transduction mechanisms [T] 0.35
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.35
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.35


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.47 %
UnclassifiedrootN/A8.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_3_74_1All Organisms → cellular organisms → Bacteria → Proteobacteria1874Open in IMG/M
2162886012|MBSR1b_contig_6255443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
2162886013|SwBSRL2_contig_12649672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1967Open in IMG/M
3300000559|F14TC_100529544All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300000953|JGI11615J12901_10304737All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300000953|JGI11615J12901_12686500All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium562Open in IMG/M
3300001431|F14TB_107345355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae553Open in IMG/M
3300001464|JGI12363J15224_100085All Organisms → cellular organisms → Bacteria → Acidobacteria22513Open in IMG/M
3300001867|JGI12627J18819_10345178All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300002100|JGI24809J26612_1001560All Organisms → cellular organisms → Bacteria → Acidobacteria7922Open in IMG/M
3300002100|JGI24809J26612_1003250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4968Open in IMG/M
3300002886|JGI25612J43240_1062598All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium568Open in IMG/M
3300003203|JGI25406J46586_10009976All Organisms → cellular organisms → Bacteria4235Open in IMG/M
3300003267|soilL1_10024981All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3533Open in IMG/M
3300003321|soilH1_10122543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1921Open in IMG/M
3300003324|soilH2_10175404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2601Open in IMG/M
3300004016|Ga0058689_10104401All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300004114|Ga0062593_100653250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1015Open in IMG/M
3300004156|Ga0062589_101564344All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium651Open in IMG/M
3300004156|Ga0062589_102195682All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300004156|Ga0062589_102441691All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300004157|Ga0062590_100949481All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300004463|Ga0063356_105171871All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium560Open in IMG/M
3300004479|Ga0062595_100406291All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300004479|Ga0062595_101776524All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300004480|Ga0062592_101382840All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300005093|Ga0062594_101502257All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium691Open in IMG/M
3300005093|Ga0062594_102873070All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300005290|Ga0065712_10005249All Organisms → cellular organisms → Bacteria2944Open in IMG/M
3300005290|Ga0065712_10150424All Organisms → cellular organisms → Bacteria1374Open in IMG/M
3300005293|Ga0065715_10050605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium871Open in IMG/M
3300005293|Ga0065715_10287376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1071Open in IMG/M
3300005293|Ga0065715_10296267All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300005294|Ga0065705_10201274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1428Open in IMG/M
3300005294|Ga0065705_10813887All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300005294|Ga0065705_10926684All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300005331|Ga0070670_100000023All Organisms → cellular organisms → Bacteria194438Open in IMG/M
3300005331|Ga0070670_101039044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300005332|Ga0066388_103112393All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300005334|Ga0068869_102168790All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300005337|Ga0070682_100060318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2399Open in IMG/M
3300005340|Ga0070689_100000373All Organisms → cellular organisms → Bacteria26382Open in IMG/M
3300005344|Ga0070661_100485964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae987Open in IMG/M
3300005345|Ga0070692_10316458All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300005345|Ga0070692_10385169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae881Open in IMG/M
3300005345|Ga0070692_11238519All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300005353|Ga0070669_100708236All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300005356|Ga0070674_101441536All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium617Open in IMG/M
3300005364|Ga0070673_100167242All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300005364|Ga0070673_100703244All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium928Open in IMG/M
3300005438|Ga0070701_10114946All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300005438|Ga0070701_11394861All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300005440|Ga0070705_100108153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1771Open in IMG/M
3300005440|Ga0070705_100371196All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300005441|Ga0070700_100599351All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005441|Ga0070700_101198491All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300005441|Ga0070700_101813329All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium526Open in IMG/M
3300005444|Ga0070694_101409204All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales588Open in IMG/M
3300005459|Ga0068867_100432043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1118Open in IMG/M
3300005530|Ga0070679_101494607All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300005545|Ga0070695_100788840All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300005545|Ga0070695_101668218All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales533Open in IMG/M
3300005546|Ga0070696_100108318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1999Open in IMG/M
3300005546|Ga0070696_101744303Not Available537Open in IMG/M
3300005546|Ga0070696_101985919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300005547|Ga0070693_101525585All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005549|Ga0070704_100681794All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300005549|Ga0070704_102270455Not Available505Open in IMG/M
3300005563|Ga0068855_101763381All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium630Open in IMG/M
3300005564|Ga0070664_101285152All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300005577|Ga0068857_100265543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1576Open in IMG/M
3300005577|Ga0068857_101113874All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium763Open in IMG/M
3300005577|Ga0068857_101252172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300005578|Ga0068854_100384340All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300005617|Ga0068859_101489664All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium747Open in IMG/M
3300005617|Ga0068859_101899579All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300005618|Ga0068864_101284061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300005618|Ga0068864_101393479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300005719|Ga0068861_101138456All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium752Open in IMG/M
3300005840|Ga0068870_11040074All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300005841|Ga0068863_100043722All Organisms → cellular organisms → Bacteria4252Open in IMG/M
3300005841|Ga0068863_100281429All Organisms → cellular organisms → Bacteria1611Open in IMG/M
3300005841|Ga0068863_100437543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1282Open in IMG/M
3300005842|Ga0068858_100489889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1187Open in IMG/M
3300005842|Ga0068858_100575214All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300005843|Ga0068860_100107360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis2668Open in IMG/M
3300005843|Ga0068860_100516449All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1194Open in IMG/M
3300005983|Ga0081540_1081537All Organisms → cellular organisms → Bacteria → Acidobacteria1454Open in IMG/M
3300005985|Ga0081539_10204150All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium910Open in IMG/M
3300005985|Ga0081539_10206850All Organisms → cellular organisms → Bacteria → Proteobacteria902Open in IMG/M
3300005985|Ga0081539_10394222All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300006028|Ga0070717_11524525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300006049|Ga0075417_10537408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300006173|Ga0070716_100960041All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300006196|Ga0075422_10417509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300006237|Ga0097621_100271366All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300006358|Ga0068871_102382662All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300006755|Ga0079222_10047957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1963Open in IMG/M
3300006755|Ga0079222_10617678All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300006806|Ga0079220_10409799All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300006844|Ga0075428_100689058All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300006852|Ga0075433_10134743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2195Open in IMG/M
3300006852|Ga0075433_10385329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1237Open in IMG/M
3300006852|Ga0075433_11605602All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300006871|Ga0075434_101345555All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300006871|Ga0075434_102037908All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300006904|Ga0075424_101960161All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300006914|Ga0075436_100437095All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium951Open in IMG/M
3300006931|Ga0097620_102123653All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300006954|Ga0079219_10474530All Organisms → cellular organisms → Bacteria → Acidobacteria864Open in IMG/M
3300006954|Ga0079219_10474530All Organisms → cellular organisms → Bacteria → Acidobacteria864Open in IMG/M
3300009011|Ga0105251_10118817All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300009036|Ga0105244_10427773Not Available609Open in IMG/M
3300009094|Ga0111539_13160434All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae531Open in IMG/M
3300009101|Ga0105247_10739332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300009147|Ga0114129_13516815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300009148|Ga0105243_10132628All Organisms → cellular organisms → Bacteria2116Open in IMG/M
3300009148|Ga0105243_11663215All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium666Open in IMG/M
3300009156|Ga0111538_12393515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300009162|Ga0075423_10420113All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1404Open in IMG/M
3300009162|Ga0075423_11015118All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300009162|Ga0075423_11698947All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300009162|Ga0075423_12201309All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300009162|Ga0075423_13187552All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300009174|Ga0105241_10169541All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300009174|Ga0105241_12209108All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium546Open in IMG/M
3300009177|Ga0105248_11075463All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300009177|Ga0105248_11140353All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium881Open in IMG/M
3300009177|Ga0105248_11429946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300009177|Ga0105248_12613093All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300009551|Ga0105238_10286367All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300009551|Ga0105238_12608222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300009553|Ga0105249_10744917All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1042Open in IMG/M
3300009840|Ga0126313_11067263Not Available663Open in IMG/M
3300009840|Ga0126313_11450419All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300010036|Ga0126305_11045378All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300010038|Ga0126315_10000076All Organisms → cellular organisms → Bacteria21387Open in IMG/M
3300010041|Ga0126312_11227218All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300010042|Ga0126314_10783203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300010042|Ga0126314_10987957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300010044|Ga0126310_10398603All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium979Open in IMG/M
3300010044|Ga0126310_10798837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300010045|Ga0126311_10002035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10006Open in IMG/M
3300010045|Ga0126311_10020755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3890Open in IMG/M
3300010045|Ga0126311_10468250All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium981Open in IMG/M
3300010045|Ga0126311_10497121All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium953Open in IMG/M
3300010046|Ga0126384_10488835All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300010046|Ga0126384_10977847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300010046|Ga0126384_11096502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300010047|Ga0126382_10934861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300010047|Ga0126382_11628472All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300010047|Ga0126382_11923006All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium560Open in IMG/M
3300010047|Ga0126382_12090040All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300010166|Ga0126306_11349925All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300010358|Ga0126370_10525849All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300010359|Ga0126376_10001177All Organisms → cellular organisms → Bacteria13937Open in IMG/M
3300010359|Ga0126376_10001177All Organisms → cellular organisms → Bacteria13937Open in IMG/M
3300010359|Ga0126376_10019941All Organisms → cellular organisms → Bacteria → Acidobacteria4367Open in IMG/M
3300010359|Ga0126376_10288361All Organisms → cellular organisms → Bacteria → Acidobacteria1420Open in IMG/M
3300010359|Ga0126376_11007241Not Available834Open in IMG/M
3300010359|Ga0126376_11007241Not Available834Open in IMG/M
3300010360|Ga0126372_11051543All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium829Open in IMG/M
3300010362|Ga0126377_11075716All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300010362|Ga0126377_13384492All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300010375|Ga0105239_13612171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300010376|Ga0126381_101016826All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1196Open in IMG/M
3300010396|Ga0134126_12891165All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300010397|Ga0134124_10194264All Organisms → cellular organisms → Bacteria → Proteobacteria1839Open in IMG/M
3300010397|Ga0134124_10253537All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1620Open in IMG/M
3300010399|Ga0134127_10102545All Organisms → cellular organisms → Bacteria → Acidobacteria2510Open in IMG/M
3300010399|Ga0134127_13057135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300010399|Ga0134127_13301039All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium528Open in IMG/M
3300010400|Ga0134122_10036191All Organisms → cellular organisms → Bacteria3753Open in IMG/M
3300010400|Ga0134122_10062422All Organisms → cellular organisms → Bacteria2880Open in IMG/M
3300010400|Ga0134122_10414097Not Available1194Open in IMG/M
3300010400|Ga0134122_10666683All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300010400|Ga0134122_10666683All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300010400|Ga0134122_12622778Not Available555Open in IMG/M
3300010401|Ga0134121_10000281All Organisms → cellular organisms → Bacteria60086Open in IMG/M
3300010401|Ga0134121_10000729All Organisms → cellular organisms → Bacteria34724Open in IMG/M
3300011119|Ga0105246_10488173All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1043Open in IMG/M
3300011119|Ga0105246_11478244Not Available637Open in IMG/M
3300011119|Ga0105246_11541854All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300012204|Ga0137374_11044224All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300012354|Ga0137366_11066159All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300012362|Ga0137361_10325032All Organisms → cellular organisms → Bacteria → Acidobacteria1410Open in IMG/M
3300012930|Ga0137407_12418761All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300013102|Ga0157371_10493344All Organisms → cellular organisms → Bacteria → Acidobacteria904Open in IMG/M
3300013297|Ga0157378_10827345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium953Open in IMG/M
3300013297|Ga0157378_13156430All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300013306|Ga0163162_10013729All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales7911Open in IMG/M
3300013306|Ga0163162_10369217All Organisms → cellular organisms → Bacteria → Proteobacteria1568Open in IMG/M
3300013306|Ga0163162_11554212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300013307|Ga0157372_12503671Not Available592Open in IMG/M
3300013307|Ga0157372_12503671Not Available592Open in IMG/M
3300013308|Ga0157375_12571599All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium608Open in IMG/M
3300013760|Ga0120188_1000669All Organisms → cellular organisms → Bacteria1870Open in IMG/M
3300013760|Ga0120188_1005092All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1026Open in IMG/M
3300014325|Ga0163163_10000070All Organisms → cellular organisms → Bacteria113169Open in IMG/M
3300014325|Ga0163163_10744472All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1043Open in IMG/M
3300014325|Ga0163163_12507158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300014326|Ga0157380_12035474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300014487|Ga0182000_10134814All Organisms → cellular organisms → Bacteria → Acidobacteria875Open in IMG/M
3300014487|Ga0182000_10153951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium836Open in IMG/M
3300014487|Ga0182000_10673228All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300014488|Ga0182001_10108432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium876Open in IMG/M
3300014745|Ga0157377_10173925All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1349Open in IMG/M
3300014745|Ga0157377_10425494Not Available910Open in IMG/M
3300014745|Ga0157377_11028937All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium626Open in IMG/M
3300018466|Ga0190268_11370618All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300020146|Ga0196977_1000098All Organisms → cellular organisms → Bacteria55254Open in IMG/M
3300021362|Ga0213882_10209276All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium805Open in IMG/M
3300021445|Ga0182009_10814891Not Available511Open in IMG/M
3300025885|Ga0207653_10025947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1876Open in IMG/M
3300025900|Ga0207710_10002535All Organisms → cellular organisms → Bacteria8446Open in IMG/M
3300025900|Ga0207710_10070419All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300025900|Ga0207710_10357325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300025904|Ga0207647_10004720All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10090Open in IMG/M
3300025907|Ga0207645_10658228All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium712Open in IMG/M
3300025911|Ga0207654_10119533All Organisms → cellular organisms → Bacteria1652Open in IMG/M
3300025911|Ga0207654_10120049All Organisms → cellular organisms → Bacteria → Proteobacteria1649Open in IMG/M
3300025911|Ga0207654_10803377All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300025911|Ga0207654_10836858All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300025911|Ga0207654_11299449All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium530Open in IMG/M
3300025920|Ga0207649_10122528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1755Open in IMG/M
3300025920|Ga0207649_10433039All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium989Open in IMG/M
3300025922|Ga0207646_10042233All Organisms → cellular organisms → Bacteria4098Open in IMG/M
3300025924|Ga0207694_10422299All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300025924|Ga0207694_10593264All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium931Open in IMG/M
3300025925|Ga0207650_10000005All Organisms → cellular organisms → Bacteria663190Open in IMG/M
3300025925|Ga0207650_10622620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium908Open in IMG/M
3300025926|Ga0207659_11574658All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300025927|Ga0207687_11688287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300025934|Ga0207686_10060143All Organisms → cellular organisms → Bacteria2403Open in IMG/M
3300025934|Ga0207686_10333514All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1137Open in IMG/M
3300025935|Ga0207709_10811787All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300025935|Ga0207709_11870736All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium500Open in IMG/M
3300025936|Ga0207670_10000235All Organisms → cellular organisms → Bacteria35073Open in IMG/M
3300025936|Ga0207670_10251149All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1367Open in IMG/M
3300025941|Ga0207711_10839270All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium855Open in IMG/M
3300025941|Ga0207711_11407372All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300025941|Ga0207711_11463608Not Available626Open in IMG/M
3300025941|Ga0207711_11636377All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300025942|Ga0207689_10135108All Organisms → cellular organisms → Bacteria2031Open in IMG/M
3300025960|Ga0207651_10369579All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300025960|Ga0207651_10848371All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300025981|Ga0207640_10228013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1431Open in IMG/M
3300026041|Ga0207639_10348374All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas1322Open in IMG/M
3300026041|Ga0207639_10466150All Organisms → cellular organisms → Bacteria → Acidobacteria1149Open in IMG/M
3300026075|Ga0207708_11154751All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300026088|Ga0207641_10343046All Organisms → cellular organisms → Bacteria → Acidobacteria1422Open in IMG/M
3300026088|Ga0207641_12144345All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300026095|Ga0207676_12364229All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300026116|Ga0207674_12245547All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium508Open in IMG/M
3300026118|Ga0207675_100463618All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300026121|Ga0207683_11480738All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300026285|Ga0209438_1016364All Organisms → cellular organisms → Bacteria → Acidobacteria2484Open in IMG/M
3300026497|Ga0257164_1013413All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300027119|Ga0209522_1037049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300027266|Ga0209215_1007258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1308Open in IMG/M
3300027266|Ga0209215_1025890All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300027326|Ga0209731_1026307All Organisms → cellular organisms → Bacteria → Acidobacteria831Open in IMG/M
3300027530|Ga0209216_1033671All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300027750|Ga0209461_10141500All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300027846|Ga0209180_10056343All Organisms → cellular organisms → Bacteria → Proteobacteria2178Open in IMG/M
3300027880|Ga0209481_10049804All Organisms → cellular organisms → Bacteria1939Open in IMG/M
3300028381|Ga0268264_10442091All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1258Open in IMG/M
3300028381|Ga0268264_11186615All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300028381|Ga0268264_11996731All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300028381|Ga0268264_12469647All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium525Open in IMG/M
3300028381|Ga0268264_12513072All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300030496|Ga0268240_10151186All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300031455|Ga0307505_10000803All Organisms → cellular organisms → Bacteria30726Open in IMG/M
3300031456|Ga0307513_10429435Not Available1050Open in IMG/M
3300031548|Ga0307408_100005821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8200Open in IMG/M
3300031716|Ga0310813_10553573All Organisms → cellular organisms → Bacteria → Acidobacteria1012Open in IMG/M
3300031740|Ga0307468_100119695All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1617Open in IMG/M
3300031740|Ga0307468_101467308All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300032144|Ga0315910_10466303All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium972Open in IMG/M
3300032180|Ga0307471_101746331All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300033412|Ga0310810_11240855All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium597Open in IMG/M
3300034002|Ga0334920_000026All Organisms → cellular organisms → Bacteria52085Open in IMG/M
3300034007|Ga0334936_002251All Organisms → cellular organisms → Bacteria → Acidobacteria6074Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.19%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.51%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.14%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.80%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere4.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.41%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.71%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.37%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.02%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.02%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.02%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.02%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.02%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.02%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.02%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.68%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.68%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.34%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.34%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.34%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.34%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.34%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.34%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.34%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.34%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.34%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.34%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001464Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002100Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDAEnvironmentalOpen in IMG/M
3300002886Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cmEnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013760Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300027119Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027266Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027326Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027530Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034002Biocrust microbial communities from Mojave Desert, California, United States - 16HMCEnvironmentalOpen in IMG/M
3300034007Biocrust microbial communities from Mojave Desert, California, United States - 32SMCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_019968002124908016MQNKYEAPELTLIGEANEVVMGTSFGGVDYPFNTALDFEFEQD
MBSR1b_0759.000065002162886012Miscanthus RhizosphereMQSKYEAPELTLIGQAEEIVMGFSWGGDDVPNQFGMDFEFEQD
SwBSRL2_0392.000053602162886013Switchgrass RhizosphereMQNNYEAPELTLIGQADEVVMGVSDTGIDFPNQAAWDFEFEQD
F14TC_10052954413300000559SoilMQNNYEAPELTLIGEANEVVMGANGSGLDIPHEFGMDFEFEHD*
JGI11615J12901_1030473723300000953SoilMQNVYEAPALTLIGEANDIVMGFSSGGDDLPNQLAFDFEFEQD*
JGI11615J12901_1268650013300000953SoilLTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD*
F14TB_10734535523300001431SoilMQNNYETPELTLCGEANEVVMGSSGGGFDIPYENAWDFEFQQD*
JGI12363J15224_100085143300001464SoilMQNNYEAPELTLIGEANEVVMGSAIGGDDFPKQFGLDFEFEQD*
JGI12627J18819_1034517823300001867Forest SoilMQNNYEAPELTLIGEANEVVMGSNIGGDDFPRNFGFDFEFEQD*
JGI24809J26612_100156023300002100SoilMQSKYEAPELTPIGQAEEIVMGFSWGGDDVPNQFGMDFEFEQD*
JGI24809J26612_100325043300002100SoilMQNNYEAPELTLIGEANEVVMGTGVGGDDFPRSFGFDFEFEQD*
JGI25612J43240_106259823300002886Grasslands SoilMHKTYETPELTLVGQADEVIMGTGVGGDDFPFHSGFDFEFEQD*
JGI25406J46586_1000997613300003203Tabebuia Heterophylla RhizosphereMQNNYEAPELTLIGEANEVVMGASGDGLDLPHEFGMDFEFEHD*
soilL1_1002498153300003267Sugarcane Root And Bulk SoilMQNQYETPELTLIGQADEVVMGTGVGGDDAPRSFGFDFEFEHD*
soilH1_1012254323300003321Sugarcane Root And Bulk SoilMQNNYEAPELTLIGEANEVVMGNNIGGDDFPKQFGFDFEFEQD*
soilH2_1017540423300003324Sugarcane Root And Bulk SoilMKNNYEAPELTLIGEADEVVMGNNIGGDDFPKQFGFDFEFEQD*
Ga0058689_1010440123300004016AgaveMERIERKEASQMQNNYEAPELTLVGDVNEVVMGSGTGGDDFPKLVAIDFEFEQDR*
Ga0062593_10065325023300004114SoilMQNNYEAPELTLIGQADEVVMGVSETGLDFPNLAAWDFEFEQD*
Ga0062589_10156434423300004156SoilMQSKYEAPELTLIGQAEEIVMGFSWGGDDVPNQFGMDFEFEQD*
Ga0062589_10219568223300004156SoilPMQNNYEAPELTLIGEANEVVMGAGIGGDDLPKQFGFDFEFEQD*
Ga0062589_10244169123300004156SoilMQNNYEAPELTLIGEADEVVMGTGVGGDDFPKQFGLDFEFEQD*
Ga0062590_10094948123300004157SoilMQNNYEAPELTLVGEANEVVMGTGVGGDDFPRSFGFDFEFEQD*
Ga0063356_10517187123300004463Arabidopsis Thaliana RhizosphereMQNNYEAPELTLIGDANEVVMGTGIGGDDFPKQFGLDFEFEQD*
Ga0062595_10040629123300004479SoilMQNNYEAPELTLCGEANEVVMGSSGGGFDIPYENAWDFEFQQD*
Ga0062595_10177652423300004479SoilMQNKYEAPELTLIGEAEEVVMGIGSFGDDLPLQTVPDFEFEQD*
Ga0062592_10138284023300004480SoilMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKEFGLDFEFEQD*
Ga0062594_10150225713300005093SoilMKFRKKGGKSMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKFFGLDFEFEQD*
Ga0062594_10287307013300005093SoilMQHQYETPELTLVGEADAVVMGTGLGGNDFPKEFASDFEFEHD*
Ga0065712_1000524933300005290Miscanthus RhizosphereMNTCKKGGKPMQNNYEAPELTLIGEANEVVMGTAIGGDDFPKQFGIDFEFEQD*
Ga0065712_1015042413300005290Miscanthus RhizosphereMENIYEAPALTLIGEANNIILGFSSGGDDLPNQLAFDFEFEQD*
Ga0065715_1005060523300005293Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGTAIGGDDFPKQFGIDFEFEQD*
Ga0065715_1028737623300005293Miscanthus RhizosphereMQNQYETPELTLIGEANEVVMGAGSGGDDLPRFFSLDFEFEHD*
Ga0065715_1029626723300005293Miscanthus RhizosphereMQNNYETPELTLIGEANEVVMGTAIGGDDFPKQFGIDFEFEQD*
Ga0065705_1020127423300005294Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGALGDGVDFPHEFSMDFEFEQD*
Ga0065705_1081388723300005294Switchgrass RhizosphereMQNNYEAPELTLLGKANELVMGGGAGGDDFPRELSLDFEFEQD*
Ga0065705_1092668423300005294Switchgrass RhizosphereMQNQYESPELTQIGEAAEVIMGAGCGGDDMPQQFGWDFEFEQD*
Ga0070670_1000000231463300005331Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAAIGGNDFPKEFGLDFEFEQD*
Ga0070670_10103904423300005331Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGSGIGGDDLPKQFGFDFEFEQD*
Ga0066388_10311239313300005332Tropical Forest SoilMNNQYEAPELTPVGTADEVVMGTGTGGDDAARFFGADFEYEHD*
Ga0068869_10216879013300005334Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGSSIGGNDFPKEFGLDFEFEQD*
Ga0070682_10006031833300005337Corn RhizosphereMQSKYETPALTLIGDANDIVMGFSSGGDDLPNQLAFDFEFEQD*
Ga0070689_100000373163300005340Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKYFGLDFEFEQD*
Ga0070661_10048596423300005344Corn RhizosphereMENVYETPELTLVGKAEEIVMGFSAGGDDLPNELAFDFEFEQD*
Ga0070692_1031645823300005345Corn, Switchgrass And Miscanthus RhizosphereMQNTYETPELTLVGKAEEIVMGYSAGGDDVPNELAFDFEFEQD*
Ga0070692_1038516923300005345Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGSGVGGDDLPRQFGLDFEFEQDF*
Ga0070692_1123851923300005345Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGTGVGGDDFPKQFGLDFEFEQD*
Ga0070669_10070823623300005353Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGANGDGFDLPHEFGMDFEFEHD*
Ga0070674_10144153613300005356Miscanthus RhizosphereNYEAPELTLIGEANEVVMGTGVGGDDFPKQFGLDFEFEQD*
Ga0070673_10016724233300005364Switchgrass RhizosphereKEVSPMQNNYEAPELTLIGEANEVVMGAGIGGDDLPKQFGLDFEFEQD*
Ga0070673_10070324413300005364Switchgrass RhizosphereMQEEYEAPELTLIGQADEVVMGTTTGGDDLPKFFGWDFEFEPD*
Ga0070701_1011494623300005438Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD*
Ga0070701_1139486113300005438Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGAGIGGDDFPKFFGLDFEFEQD*
Ga0070705_10010815323300005440Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGLNGSGLDFPHEFGADFEFEQD*
Ga0070705_10037119613300005440Corn, Switchgrass And Miscanthus RhizosphereMQNVYETPELTLIGKAEEIVMGTTMGGDDLPNELAFDFQFEQD*
Ga0070700_10059935123300005441Corn, Switchgrass And Miscanthus RhizosphereSSMNTCKKGGKPMQNNYEAPELTLIGEANEVVMGTAIGGDDFPKQFGIDFEFEQD*
Ga0070700_10119849123300005441Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANDVVMGSGIGGDDLPKQFGLDFEFEQD*
Ga0070700_10181332913300005441Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGAGIGGDDFPKYFGLDFEFEQD*
Ga0070694_10140920413300005444Corn, Switchgrass And Miscanthus RhizosphereMQNIYEAPALTLIGEANDIVMGFTSGGDDAPNQLAFDFEFEQD*
Ga0068867_10043204313300005459Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGLSGDGFDLPHEFAMDFEFEQD*
Ga0070679_10149460723300005530Corn RhizosphereMQSNYEAPELTLIGEANDVVLGSQIGGDDFPKQFGVDFEFEQD*
Ga0070695_10078884023300005545Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLCGEANEVVMGGGGSGLDLPFENAWDFEFQQD*
Ga0070695_10166821823300005545Corn, Switchgrass And Miscanthus RhizosphereMQNQYETPELTLIGEAAEVVMGQNIGGNDFPKEFGADFEFEND*
Ga0070696_10010831823300005546Corn, Switchgrass And Miscanthus RhizosphereMQNIYEAPALTLIGEANDIVMGFSSGGDDVPNQLAFDFEFEQD*
Ga0070696_10174430333300005546Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGASGGGLDYPWELAMDFEFEPD*
Ga0070696_10198591913300005546Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGLNGSGFDLSHEFGADFEFEQD*
Ga0070693_10152558513300005547Corn, Switchgrass And Miscanthus RhizosphereNNYEAPELTLVGEANEVVMGTGVGGDDFPRSFGFDFEFEQD*
Ga0070704_10068179413300005549Corn, Switchgrass And Miscanthus RhizosphereMNTCKKGGKQMQNNYEAPELTLIGEANEVVMGGGIGGNDFPKEFGLDFEFEQN*
Ga0070704_10227045513300005549Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLVGEANEVVMGLNGSGFDLPHEFGADFEFEQD*
Ga0068855_10176338113300005563Corn RhizosphereKGGKPMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD*
Ga0070664_10128515223300005564Corn RhizosphereMQNNYEAPELTLIGEANEVVMGTGTGGDDFPKQFGLDFEFEQD*
Ga0068857_10026554323300005577Corn RhizosphereMQNQYEAPELTLVGEANEVVMGNATGGDDLPKFFGFDFEFEHD*
Ga0068857_10111387423300005577Corn RhizosphereMQNSYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD*
Ga0068857_10125217223300005577Corn RhizosphereMQNNYEAPELTLIGEANEVVMGSNIGGNDFPKEFGIDFEFEQD*
Ga0068854_10038434033300005578Corn RhizosphereLTLIGEANEVVMGSSIGGNDFPKEFGLDFEFEQD*
Ga0068859_10148966423300005617Switchgrass RhizosphereMQEEYEAPELTLIGEANQVVMGGGIGGNDFPKEFGSDFEFEQD*
Ga0068859_10189957913300005617Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQ
Ga0068864_10128406143300005618Switchgrass RhizosphereMQEEYEAPELTLIGEANQVVMGGGIGGNDFPKEFGSDFEF
Ga0068864_10139347923300005618Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGTGVGGDDFPKEFGLDFEFEQD*
Ga0068861_10113845613300005719Switchgrass RhizosphereQNNYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD*
Ga0068870_1104007423300005840Miscanthus RhizosphereMENVYETPELTLIGTAEEIVMGTTMGGDDLPNEFAFDFQFEQD*
Ga0068863_10004372213300005841Switchgrass RhizosphereLTLVGKAEEIVMGFSAGGDDLPNELAFDFEFEQD*
Ga0068863_10028142923300005841Switchgrass RhizosphereKKGDKPMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD*
Ga0068863_10043754323300005841Switchgrass RhizosphereMQNNYETPELTLIGEANEVVMGTGVGGNDFPREFALDFEFEHD*
Ga0068858_10048988923300005842Switchgrass RhizosphereMQSKYEAPALTLIGDANDIVMGFSSGGDDLPNQLAFDFEFEQD*
Ga0068858_10057521433300005842Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGSGVGGNDFPKEFGLDFEFEQD*
Ga0068860_10010736013300005843Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKFFGLDFEFEQD*
Ga0068860_10051644913300005843Switchgrass RhizosphereALTLIGEANDIVMGFSSGGDDVPNQLAFDFEFEQD*
Ga0081540_108153713300005983Tabebuia Heterophylla RhizosphereMQNKYEAPELTQIGEANEVVMGTDGDGLDYPYETAPDFEFEQD*
Ga0081539_1020415023300005985Tabebuia Heterophylla RhizosphereMQEEYEAPELTLIGEANEVVMGFGGSGLDLPFYAAADFEFEHDQFALPERR*
Ga0081539_1020685023300005985Tabebuia Heterophylla RhizosphereMQNQYETPELTLLGEAADVVMGSGLGGNDFPKQFPTDFEFEHD*
Ga0081539_1039422213300005985Tabebuia Heterophylla RhizosphereKEETTMQNNYEAPELTLIGEANEVVMGGSGDGLDIPHEFGMDFEFEHD*
Ga0070717_1152452523300006028Corn, Switchgrass And Miscanthus RhizosphereMQNKYEAPELTLIGEAQEVVMGSTIGGAENFTSFAPDFEFEQD*
Ga0075417_1053740823300006049Populus RhizosphereMQNNYEAPELTLCGEANEVVLGGGGSGIDLPYENAWDFEFEQD*
Ga0070716_10096004113300006173Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGASGGGLDYPWELAMDFEFEQD*
Ga0075422_1041750923300006196Populus RhizosphereMQNNYEAPELTLIGEANEVVMGAGIGGDDLPKQFGLDFEFEQD*
Ga0097621_10027136623300006237Miscanthus RhizosphereLKKGDKPMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD*
Ga0068871_10238266213300006358Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGSGVGGDDLPRQFGLDFEF
Ga0079222_1004795733300006755Agricultural SoilMQNQYETPELTLIGEAAEVVMGSGLGGNDFPKQFGSDFEFEHD*
Ga0079222_1061767823300006755Agricultural SoilMQSIYEAPALTLIGEANEIVMGFSSGGDDLPNQLAFDFEFEQD*
Ga0079220_1040979923300006806Agricultural SoilMQNNYEAPELTVCGEANEVVMGSSGTGLDLPYENAWDFEFQQD*
Ga0075428_10068905823300006844Populus RhizosphereMENNYEAPELTLIGEADEVVMGASIGGDDFPRSFGLDFEFEQD*
Ga0075433_1003350733300006852Populus RhizosphereMQDQYESPELTQIGEAAEVIMGAGCGGDDMPQQFGWDFEFEQD*
Ga0075433_1013474313300006852Populus RhizosphereMQNNYEAPELTLCGEANEVVLGGGGSGIDLPYENAWDFEFQQD*
Ga0075433_1038532923300006852Populus RhizosphereMQKNYEAPELTLLGQAEEVVMGTGNSGFDFPFEAAMDFEFEQD*
Ga0075433_1160560223300006852Populus RhizosphereMQNKYEAPALTLIGEANDIVMGFTSGGDDAPNELAFDFYFEQD*
Ga0075434_10134555513300006871Populus RhizosphereMQNNYEAPELTLCGEANEVVFGGGGSGIDLPYENAWDFEFEQD*
Ga0075434_10203790813300006871Populus RhizosphereRIPKIRRKEVSPMQSKYEAPELTLIGQAEEIVMGLNWGGDDVPNQFGADFEFEQDR*
Ga0075424_10196016123300006904Populus RhizosphereMQHQYETPELTLIGEASDVVMGTSLGGNDFPKEFAPDFEFEHD*
Ga0075436_10043709523300006914Populus RhizosphereMQSKYEAPELTLIGQAEEIVMGLNWGGDDVPNQFGADFEFEQDR*
Ga0097620_10212365323300006931Switchgrass RhizosphereMENIYEAPALTLIGEANDIVMGFSSGGDDLPNQLAFDFEFEQD*
Ga0079219_1047453023300006954Agricultural SoilMQHQYETPELTLIGEATEVVMGSGLGGNDFPKQFGSDFEFEHD*
Ga0079219_1047453033300006954Agricultural SoilMQNQYETPELTLIGEAAEIVMGSGLGGNDFPKQFGSDFEFEHD*
Ga0105251_1011881723300009011Switchgrass RhizosphereMQNNYEAPELTLIAEADEVVMGTGVGGDDFPKQFGLDFEFEQD*
Ga0105244_1042777313300009036Miscanthus RhizosphereELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD*
Ga0111539_1316043423300009094Populus RhizosphereMQKNYEAPELTLIGQAEEVVMGTGNSGFDFPFEAAFDFEFEQD*
Ga0105247_1073933213300009101Switchgrass RhizosphereMQNQYETPELTLLGEAADVVMGSGLGGNDFPKQFATDFEFEHD*
Ga0114129_1259713213300009147Populus RhizosphereMQTNFDAPELTLIGEAGEVVMGISSGGDDLPNFGAWDFEFAQDC*
Ga0114129_1351681523300009147Populus RhizosphereVNTLEESFLNFERKEDGPMQNNYEAPELTLIGQADEVVMGVSETGLDFPNLAAWDFEFEQD*
Ga0105243_1013262833300009148Miscanthus RhizosphereMQNVYETPELTLIGTAEEIVMGTTMGGDDLPNEFAFDFQFEQD*
Ga0105243_1166321523300009148Miscanthus RhizospherePELTLIGEANEVVMGAGVGGDDFPKEFGLDFEFEQD*
Ga0111538_1019089933300009156Populus RhizosphereMQNQYESPELTQIGEAAKVIMGAGCGGDDMPQQFGWDFEFEQD*
Ga0111538_1239351523300009156Populus RhizosphereMKLELKILERKEVSPMQNNYEAPELTLIGEANEVVMGAGIGGDDLPKQFGLDFEFEQD*
Ga0075423_1042011323300009162Populus RhizosphereMQTNYEAPELTLIGEANEVVMGASGGGLDYPWELAMDFEFEQD*
Ga0075423_1101511823300009162Populus RhizosphereKKGGKPMQSKYEAPELTLIGQAEEIVMGFSWGGDDVPNQFGMDFEFEQD*
Ga0075423_1169894723300009162Populus RhizosphereMQSKYEAPALTLIGEANDIVLGFTSGGDDVPNWFGVDFEFEQD*
Ga0075423_1220130923300009162Populus RhizosphereMQNKYEAPALTLIGEANDIVMGFTSGGDDAPNQLAFDFEFEQD*
Ga0075423_1318755213300009162Populus RhizosphereRKEVNPMQNQYEAPELTLIGETNEVVMGSSSGGDDLPKYFGFDFEFEHD*
Ga0105241_1016954133300009174Corn RhizosphereMQNQYEAPELTLVGEANEVVMGAGTGGDDLPKLFGFDFEFEHD*
Ga0105241_1220910813300009174Corn RhizosphereAMQNNYEAPELTLIGDANEVVMGTSIGGDDYPRSFGFDFEFEQD*
Ga0105248_1107546313300009177Switchgrass RhizosphereMQNNYEAPELTLIGEADEVVMGTGVGGDDFPKQFGLDFE
Ga0105248_1114035323300009177Switchgrass RhizosphereMSKNYETPELTMVGQADEIIMGIGAGGDDFPFRAGFDFEFEQD*
Ga0105248_1142994623300009177Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGGGIGGNDFPKEFGLDFEFEQD*
Ga0105248_1261309323300009177Switchgrass RhizospherePELTLIGETNEVVMGSSSGGDDLPKYFGFDFEFEHD*
Ga0105238_1028636733300009551Corn RhizosphereMNTCKKGGSQMQNNYEAPELTLIGEANEVVMGSGVGGNDFPKEFGLDFEFEQD*
Ga0105238_1260822223300009551Corn RhizosphereMQNNYEAPELTLIGEANEVVMGSSIGGNDFPKEFGLDFE
Ga0105249_1074491723300009553Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAVVGSDDFPKQFGLDFEFEED*
Ga0126313_1106726313300009840Serpentine SoilMQKTYEAPELTLIGDADEVVMGASGSGFDLPFENGWDFEFAQD*
Ga0126313_1145041923300009840Serpentine SoilMQNNYEAPELTLVGEANEVVMGAGIGGDDLPKQFGLDFEFEQD*
Ga0126305_1104537823300010036Serpentine SoilMQNNYEAPELTLVGDANEVVLGGGVGGDDFPKRFGFDFEFEQD*
Ga0126315_1000007693300010038Serpentine SoilMQNNYEAPELTLIGEANEVVMGANIGGDDFPRSFGLDFEFEQD*
Ga0126312_1122721823300010041Serpentine SoilMHNNYEAPELTLIGEANEVVMGSGVGGDDFPKLFGLDFEFEQD*
Ga0126314_1078320323300010042Serpentine SoilMNILERKEVSPMQNNYEAPELTLIGEANEVVMGGGVGGDDLPKQFGLDFEFEQD*
Ga0126314_1098795713300010042Serpentine SoilMQNNYEAPELTLIGEANEVVMGSGIGGDDLPKQFGLDFEF
Ga0126310_1039860333300010044Serpentine SoilMQNNYEAPELTLVGDANEVVLGGGVGGDDFPKQFGFDFEFEQD*
Ga0126310_1079883713300010044Serpentine SoilMQNNYEAPELTLIGEANEVVMGGGVGGDDLPKQFGLD
Ga0126311_1000203553300010045Serpentine SoilMQNNYEAPELTLIGQANEVVMGAGIGGDDLPKQFGLDFEFEQD*
Ga0126311_1002075533300010045Serpentine SoilMQNNYEAPELTLIGEANEVVMGAGVGGDDFPRQFGMDFEFEQD*
Ga0126311_1046825023300010045Serpentine SoilMSEHYWRLVMKILERKEVSPMQNNYEAPELMLIGEANEVVMGTGVGGDDFPKQFGLDFEFEQD*
Ga0126311_1049712123300010045Serpentine SoilVTSGSYEKSHQYLKKGGKPMQNNYEAPELTLVGEANEVVMGGGIGGDDFPKQFGFDFEFEQD*
Ga0126384_1048883513300010046Tropical Forest SoilMQNNYEAPELTLCGEANEVVMGTSGLGSDLPFENGWDFEFQQD*
Ga0126384_1097784713300010046Tropical Forest SoilMKNNYEVPELTLIGEANEVVMGTGAGGDDFPKQFGMDFEFEQD*
Ga0126384_1109650223300010046Tropical Forest SoilMQNNYEAPELTLCGEANEVVLGLGGSGSDLPFENA
Ga0126382_1093486133300010047Tropical Forest SoilMQNNYEAPELTLCGEANEVVLGTSGGGVDLPYENAWDFEFQQD*
Ga0126382_1162847213300010047Tropical Forest SoilMQHQYETPELTLIGKADEVVMGTGTGGNDFPKEFALDFEFEQD*
Ga0126382_1192300613300010047Tropical Forest SoilPELTLVGEANEVVMGSGAVGDDFPKQFGLDFEFEQD*
Ga0126382_1209004023300010047Tropical Forest SoilMQNQYEAPELTLIGEANEVVMGTTTGGDDLPKWFGFDFEFEHD*
Ga0126306_1134992513300010166Serpentine SoilMQNNYEAPELTLIGEANEVVMGSGVGGDDFPKQIAIDFEFEQD*
Ga0126370_1052584923300010358Tropical Forest SoilMQNNYEAPELTLCGEANEVVLGTSGGGVDLPYENAWDFEFEQD*
Ga0126376_10001177103300010359Tropical Forest SoilMQNEYEAPELTLIGDADEVVMGTSLGGDDVPNQLAADFEFEED*
Ga0126376_10001177113300010359Tropical Forest SoilMQNEYEAPELTLIGEANEIVMGSGVIGDDFPQLAATDFEFEED*
Ga0126376_1001994123300010359Tropical Forest SoilMQNQYETPELTQIGKADDVVMGLAGIGDDFPRQFGSDFEFEHD*
Ga0126376_1028836123300010359Tropical Forest SoilMQNQYETPELTVLGEADAVVMGSGVGGDDFPRLQALDFEFEHD*
Ga0126376_1100724113300010359Tropical Forest SoilYEAPELTLIGDANEVVMGSGIGGDDFPKQFGASFEFEED*
Ga0126376_1100724123300010359Tropical Forest SoilMENNYEAPELTLIGDADEIVMGADCGGDDFPHEVAIDFEFEQD*
Ga0126372_1105154323300010360Tropical Forest SoilMQNDYEAPELTLIGDADEVVMGIGAGGDDFPFRAGIDFEFEED*
Ga0126377_1107571623300010362Tropical Forest SoilMQNQYEAPELTLIGEANEVVMGSFTGGDDMPKYFGFDFEFEHD*
Ga0126377_1338449223300010362Tropical Forest SoilMQNNYEAPELTLVGEANEVVMGSGAGGDDFPKQFGLDFEFEQD*
Ga0105239_1361217113300010375Corn RhizosphereMQNNYEAPELTLIGEANEVVMGSGGSGLDFPYLIAGDFEFEQD*
Ga0126381_10101682623300010376Tropical Forest SoilMQKKYEAPEVTLIGQAGEVVMGTGINGDDLPWKTGLDFEFEQD*
Ga0134126_1191947723300010396Terrestrial SoilMQQTYEAPELVLMGEAQEVVMGSTGLGGDLPFENAFDFEFEQD*
Ga0134126_1289116523300010396Terrestrial SoilPMQHQYETPELTLVGEADAVVMGTGLGGNDFPKEFASDFEFEHD*
Ga0134124_1019426413300010397Terrestrial SoilTPELTLIGTAEEIVMGTTMGGDDLPNEFAFDFQFEQD*
Ga0134124_1025353743300010397Terrestrial SoilVKLMQEEYEAPELTPIGQADEVVMGSNGDGLDLPHEFGWDFEFEPD*
Ga0134127_1010254543300010399Terrestrial SoilMRLVLKSERKEVSPMQNNYEAPELTLIGKANELVMGGGIGGDDFPKQYGFDFEFEQD*
Ga0134127_1305713523300010399Terrestrial SoilMQNNYEAPELTLIGEANEVVMGSGIGGDDLPKQFGLDFEFEQD*
Ga0134127_1330103913300010399Terrestrial SoilRKEVSQMQNNYEAPELTLIGEANEVVMGSSIGGNDFPKEFGLDFEFEQD*
Ga0134122_1003619133300010400Terrestrial SoilMNTCKKGGKPMQNNYEAPELTLIGEANEVVMGTGVGGDDFPKQFGMDFEFEQD*
Ga0134122_1006242223300010400Terrestrial SoilMQNQYEAPEITLIGEANEVVMGAGTGGDDLPKFFTLDFEFEHD*
Ga0134122_1024761823300010400Terrestrial SoilMQQTYEAPELALMGEAQEVVMGSTGLGGDLPFENAFDFEFEQD*
Ga0134122_1041409723300010400Terrestrial SoilMEEEYEVPELTVIGEANQVVMGGNIGGFDLGNKTAMDFEFEHD*
Ga0134122_1066668313300010400Terrestrial SoilNPMQHQYETPELTLVGEADTVVMGTGLGGNDFPKEFASDFEFEHD*
Ga0134122_1066668323300010400Terrestrial SoilMQHQYETPELTLIGEADAVVMGTGLGGNDFPKEFASDFEFEHD*
Ga0134122_1262277813300010400Terrestrial SoilMQNKYEAPELSLIGEANEVVMGAVGCGLDLPFENGWDFEFQQD*
Ga0134121_10000281353300010401Terrestrial SoilMQNQYEAPEITLIGEANEVVMGTGNGGDDLPKYFGFDFEFERD*
Ga0134121_10000729113300010401Terrestrial SoilMNTCKKGDKPMQNNYEAPELTLIGEANEVVMGSSIGGNDFPKDFGIDFEFEQD*
Ga0134121_1037842413300010401Terrestrial SoilTYEAPELVLMGEAQEDVMGSTGLGGDLPFENAFDFEFEQD*
Ga0105246_1048817323300011119Miscanthus RhizosphereMQNNYEAPELTLIGDANEVVMGTSIGGDDYPRSFGFDFEFEQD*
Ga0105246_1147824413300011119Miscanthus RhizosphereRKEVIEMQEEYEAPELTLIGQADAVVMGTTTGGDDLPKFFGWDFEFEPD*
Ga0105246_1154185423300011119Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGLSGEGLDLPHEFAMDFEFEQD*
Ga0137374_1104422413300012204Vadose Zone SoilTMQTIYEAPELTLIGEAEEVVMGADFSGNDCPWQSALDFEFEQD*
Ga0137376_1150634513300012208Vadose Zone SoilMKNQYEIPELTPIGEAAEVIMGAGCGGDDMPLQFG
Ga0137366_1106615923300012354Vadose Zone SoilMQNNYEAPELTLMGRANEIVMGTGTSGVDLPHFSEPDFEFEQD*
Ga0137361_1032503223300012362Vadose Zone SoilMKNRKEVNRMQNNYEAPELTLIGRANEIVMGSGTSGVDLPHFSEPDFEFEQD*
Ga0137358_1001134463300012582Vadose Zone SoilMQNQYESPELTPIGEAAEVIMGSGCGGDDMPQQFGWDFEFEQD*
Ga0137407_1241876113300012930Vadose Zone SoilMQKKYEVPELNLIGEAPEVIMGSGCGGDDMPWETALDFEFEQD*
Ga0157371_1049334413300013102Corn RhizosphereKSMQNNYEAPELTLIGEANEVVMGAGIGGDDFPKFFGLDFEFEQD*
Ga0157378_1082734523300013297Miscanthus RhizosphereMNTCKKGGKPMQNNYEAPELTLIGEANEVVMGSAIGGDDFPKQFGLDFEFEQD*
Ga0157378_1315643023300013297Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGGSGDGLDIPHEFGMDFEFEHD*
Ga0163162_1001372923300013306Switchgrass RhizosphereMHKKYEAPELTVIGEANEVVMGSGIGGDDFPQQLAIDFEFERD*
Ga0163162_1036921723300013306Switchgrass RhizosphereMNTCKKGGKPMQNNYEAPELTLIGEANEVVMGGGIGGNDFPKEFGLDFEFEQD*
Ga0163162_1155421233300013306Switchgrass RhizospherePELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEED*
Ga0157372_1250367123300013307Corn RhizosphereLYWQKEVIEMQEEYEAPELTLIGEADDVVLGLNGDGVDFPHEFGWDFEFEPD*
Ga0157372_1250367133300013307Corn RhizosphereMQEEYEAPELTPIGEADEVVMGASGDGLDLPHEFAADFEFEQD*
Ga0157375_1257159913300013308Miscanthus RhizosphereKYEAPALTLIGDANDIVMGFSSGGDDLPNQLAFDFEFEQD*
Ga0120188_100066913300013760TerrestrialYEAPELPLCGEANEVVMGSSGGGFDIPYENAWDFEFQQD*
Ga0120188_100509223300013760TerrestrialMQNNYEAPELTLIGEANEVVMGSGVGGDDFPKQVAVDFEFEQDF*
Ga0163163_10000070193300014325Switchgrass RhizosphereMNTCKKGGNPMQNNYEAPELTLIGEANEVVMGAAIGGNDFPKEFGLDFEFEQD*
Ga0163163_1074447223300014325Switchgrass RhizosphereMNTCKKGGKPMQNNYEAPELTLIGEANEVVMGSNIGGNDFPKEFGIDFEFEQD*
Ga0163163_1250715813300014325Switchgrass RhizosphereKPMQNNYEAPELTLIGEANEVVMGSGVGGNDFPKEFGLDFEFEQD*
Ga0157380_1203547423300014326Switchgrass RhizosphereMRLALKSGRKEVSPMQNNYEAPELTLCGEANEVVMGAGVGGDDFPKQFGLDFEFEQD*
Ga0182000_1013481423300014487SoilMQNNYEAPELTLIGEANEVVMGAGVGGDDFPRQFGLDFEFEQD*
Ga0182000_1015395113300014487SoilMKNNYEAPELTLIGEANEVVMGAGIGGDDFPKQFGLDFEFEQD*
Ga0182000_1067322823300014487SoilMQNNYEAPELTLIGEANEVVMGTGVGGDDFPKQFGFDFEFEQD*
Ga0182001_1010843213300014488SoilMQNNYEAPELTLVGEADEVVMGMGSGGDDFPMETAWDFEFQQD*
Ga0157377_1017392513300014745Miscanthus RhizosphereMNSFKKGGKQMQNNYEAPELTLIGEANAVVMGGGIGGNDFPKEFGLDFEFEQD*
Ga0157377_1042549413300014745Miscanthus RhizosphereMKGDKPMQNNYEAPELTLIGEADEVVMGTGVGGDDFPKQFGLDFEFEQD*
Ga0157377_1102893713300014745Miscanthus RhizosphereQNNYEAPELTLIGEANEVVMGAGIGGDDFPKFFGLDFEFEQD*
Ga0190268_1137061823300018466SoilMENNYEAPELTLVGEANEVVMGSGIGGDDFPKQFGFDFEFEQD
Ga0196977_1000098253300020146SoilMQNNYEAPELTLIGEANDVVMGAGVGGDDFPKQFGVDFEFEQD
Ga0179594_10000019173300020170Vadose Zone SoilMQNQYESPELTLLGEAAEVIMGTGCGGDDMPQQFGWDFEFEQD
Ga0213882_1020927623300021362Exposed RockMQNNYEAPELTLVGDAEEVVMGSDFGGDDYPQHVAWDFEFAQD
Ga0182009_1081489113300021445SoilMQNNYEAPELTLIGEANEVVMGLSGEGLDLPHEFAMDFEFEQD
Ga0207653_1002594713300025885Corn, Switchgrass And Miscanthus RhizosphereMQNVYETPELTLIGEANEVVMGTAIGGDDFPKQFGIDFE
Ga0207710_1000253583300025900Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGTAIGGDDFPKQFGIDFEFEQD
Ga0207710_1007041913300025900Switchgrass RhizosphereNNYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD
Ga0207710_1035732513300025900Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGSGVGGDDLPRQFGLDFEFEQDF
Ga0207647_1000472053300025904Corn RhizosphereMQSKYEAPALTLIGDANDIVMGFSSGGDDLPNQLAFDFEFEQD
Ga0207645_1065822823300025907Miscanthus RhizosphereMKNVYETPELTLVGKAEEIVMGFSAGGDDLPNELAFDFEFEQD
Ga0207654_1011953323300025911Corn RhizosphereMQNQYEAPELTLVGEANEVVMGAGTGGDDLPKLFGFDFEFEHD
Ga0207654_1012004933300025911Corn RhizosphereMQNVYETPELTLIGKAEEIVMGTTMGGDDLPNEFAFDFQFEQD
Ga0207654_1080337713300025911Corn RhizosphereMQSNYEAPELTLIGEANDVVLGSQIGGDDFPKQFGVDFEFEQD
Ga0207654_1083685823300025911Corn RhizosphereMQNNYEAPELTLIGEANEVVMGSNIGGNDFPKEFGIDFEFEQD
Ga0207654_1129944923300025911Corn RhizosphereYEAPELTLIGDANEVVMGTSIGGDDYPRSFGFDFEFEQD
Ga0207649_1012252823300025920Corn RhizosphereMENVYETPELTLVGKAEEIVMGFSAGGDDLPNELAFDFEFEQD
Ga0207649_1043303923300025920Corn RhizosphereMQNNYEAPELTLIGEANEVVMGSGVGGNDFPKEFGLDFEFEQD
Ga0207646_1004223363300025922Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGASGGGLDYPWELAMDFEFEQD
Ga0207694_1042229923300025924Corn RhizosphereMQNNYEAPELTLCGEANEVVMGGGGSGLDLPFENAWDFEFQQD
Ga0207694_1059326423300025924Corn RhizosphereMQNNYEAPELALIGEANEVVMGSGVGGNDFPKEFGLDFEFEQD
Ga0207650_100000051643300025925Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAAIGGNDFPKEFGLDFEFEQD
Ga0207650_1062262023300025925Switchgrass RhizosphereMQNNYEAPELTLVGETNEVVMGAGIGGDDYPKQFGLDFEFEQD
Ga0207659_1157465813300025926Miscanthus RhizosphereEAIFESSMKLELKILERKEVSPMQNNYEAPELTLIGEANEVVMGAGIGGDDLPKQFGLDFEFEQD
Ga0207687_1168828723300025927Miscanthus RhizosphereMQNIYEAPALTLIGEANDIVMGFTSGGDDAPNQLAFDFEFEQD
Ga0207686_1006014343300025934Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGLSGDGFDLPHEFAMDFEFEQD
Ga0207686_1033351423300025934Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGTGVGGDDFPKQFGLDFEFEQD
Ga0207709_1081178713300025935Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGTGVGGDDFPKEFGLDFEFEQD
Ga0207709_1187073613300025935Miscanthus RhizospherePMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEED
Ga0207670_10000235193300025936Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKYFGLDFEFEQD
Ga0207670_1025114913300025936Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKEFGLDIEFEQD
Ga0207711_1083927023300025941Switchgrass RhizosphereMQEEYEAPELTLIGEANQVVMGGGIGGNDFPKEFGSDFEFEQD
Ga0207711_1140737213300025941Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGGGIGGNDFPKEFGLDFEFEQD
Ga0207711_1146360823300025941Switchgrass RhizosphereMSKNYETPELTMVGQADEIIMGIGAGGDDFPFRAGFDFEFEQD
Ga0207711_1163637713300025941Switchgrass RhizosphereMQEEYEAPELTLIGQADEVVMGTTTGGDDLPKFFGWDFEFEPD
Ga0207689_1013510813300025942Miscanthus RhizosphereMQNNYEAPELTLVGEANEVVMGTGVGGDDFPRSFGFDFEFEQD
Ga0207651_1036957923300025960Switchgrass RhizosphereMQNQYETPELTLIGEANEVVMGAGSGGDDLPRFFSLDFEFEHD
Ga0207651_1084837123300025960Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAGIGGDDLPKQFGLDFEFEQD
Ga0207640_1022801323300025981Corn RhizosphereMQNNYEAPELTLIGEANEVVMGLSGSGLDLPHEFGADFEFEQD
Ga0207639_1034837433300026041Corn RhizosphereKPMQNNYEAPELTLIGEANEVVMGSGVGGNDFPKEFGLDFEFEQD
Ga0207639_1046615023300026041Corn RhizosphereMQNNYEAPELTLIGEANEVVMGSAIGGDDFPKQFGLDFEFEQD
Ga0207708_1115475113300026075Corn, Switchgrass And Miscanthus RhizosphereMQNNYEAPELTLIGEANDVVMGSGIGGDDLPKQFGLDFEFEQD
Ga0207641_1034304633300026088Switchgrass RhizosphereMQNNYETPELTLIGEANEVVMGTGVGGNDFPREFALDFEFEHD
Ga0207641_1214434513300026088Switchgrass RhizosphereMQNQYEAPELTLVGEANEVVMGNATGGDDLPKFFGFDFEFEHD
Ga0207676_1236422913300026095Switchgrass RhizosphereMQNNYEAPELTLIGEADEVVMGTGVGGDDFPKQFGLDSEFEQD
Ga0207674_1224554723300026116Corn RhizospherePMQNSYEAPELTLIGEANEVVMGAGVGGDDFPKQFGLDFEFEQD
Ga0207675_10046361833300026118Switchgrass RhizosphereMKLELKILERKEVSPMQNNYEAPELTLIGEANEVVMGAGIGGDDLPKQFGLDFEFEQD
Ga0207683_1148073823300026121Miscanthus RhizosphereMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKEFGLDFERKFADFIQK
Ga0209438_101636423300026285Grasslands SoilMHKTYETPELTLVGQADEVIMGTGVGGDDFPFHSGFDFEFEQD
Ga0209438_107877423300026285Grasslands SoilMQKKYEVPELNLIGEAPEVIMGSGCGGDDMPWETALDFEFEQD
Ga0257164_101341313300026497SoilMQKTYEVPELTPIGEADEVVMGAGCCGDDMPWQGALDFEFEED
Ga0209522_103704913300027119Forest SoilMQNNYEAPELTLVGEAEEVVMGSGIGGDDMPWESALDFEFEHD
Ga0209215_100725813300027266Forest SoilMQNNYEAPELTLIGEANEVVMGTGVGGDDFPKQFGVDFEFEQD
Ga0209215_102589013300027266Forest SoilMQNNYEAPELTLIGEANEVVMGSNIGGDDFPRNFGFDFEFEQD
Ga0209731_102630723300027326Forest SoilMQKTYEAPELALIGEANEVVMGISGCGVDLPFENAFDFEFEQD
Ga0209216_103367123300027530Forest SoilMQNTYEAPELTLIGEASEVVMGTTVGGDDFPKQFGIDFEFEQD
Ga0209461_1014150023300027750AgaveMQNNYEAPELTLVGDVNEVVMGSGTGGDDFPKLVAIDFEFEQDR
Ga0209180_1005634333300027846Vadose Zone SoilMHNKYEVPELTLIGEAEEVVMGTTWGGVDLPNQAAWDFEFEQD
Ga0209481_1004980423300027880Populus RhizosphereMENNYEAPELTLIGEADEVVMGASIGGDDFPRSFGLDFEFEQD
Ga0268264_1044209113300028381Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKFFGLDFEFEQD
Ga0268264_1118661513300028381Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKEFGLDFEFEQD
Ga0268264_1199673123300028381Switchgrass RhizosphereALTLIGEANDIVMGFSSGGDDVPNQLAFDFEFEQD
Ga0268264_1246964723300028381Switchgrass RhizosphereMQNNYEAPELTLIGEANEVVMGAGVGGDDFPKQFGMDFEFEQD
Ga0268264_1251307223300028381Switchgrass RhizosphereMQNIYEAPALTLIGEANDIVMGFSSGGDDVPNQLAFDFEFEQD
Ga0268240_1015118623300030496SoilMQNNYEAPELTLIGEADEVVMGSGIGGDDLPKQFGLDFEFEQD
Ga0307505_1000080373300031455SoilMQNNYEAPELTLIGEANEVVMGNGIGGDDFPKQFGVDFEFEQD
Ga0307513_1042943523300031456EctomycorrhizaMQNKYEAPELTLIGEADQVVMGTNWGGDDVPNELGPDFEFEQD
Ga0307408_10000582133300031548RhizosphereMQDNYEAPELTLIGEANEVVMGSGIGGDDLPKQFGLDFEFEQD
Ga0310813_1055357323300031716SoilMQSKYEAPALTLIGEANEIVMGFSTGGDDLPNQLAFDFEFEQD
Ga0307468_10011969523300031740Hardwood Forest SoilMQNNYEAPELTLIGEANEVVMGGGVGGNDFPKEFGLDFEFEQD
Ga0307468_10146730813300031740Hardwood Forest SoilMQNNYEAPELTLIGEANEVVMGLNGSGFDLSHEFGADFEFEQD
Ga0315910_1046630323300032144SoilMQNTYEAPELTLIGEANEVVMGTTVGGDDFPKQFGVDFEFEQD
Ga0307471_10174633113300032180Hardwood Forest SoilQNNYEAPELTLIGEANEVVMGLNGDGVDFPHEFGADFEFEQD
Ga0310810_1124085523300033412SoilPELTLVGEANEVVMGTGVGGDDFPRSFGFDFEFEQD
Ga0334920_000026_48052_481833300034002Hypolithic BiocrustMQNNYEAPELTLVGEADEVVMGAGYGGHDFPMETAWDFEFQQD
Ga0334936_002251_2606_27373300034007BiocrustMQNNYEAPELTLVGEADEVVMGSDFGGDDYPQQAAWDFEFAQD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.