Metagenome / Metatranscriptome Family F012237

Basic Information
Family ID	F012237
Family Type	Metagenome / Metatranscriptome
Number of Sequences	282
Average Sequence Length	39 residues
Representative Sequence	LPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR
Number of Associated Samples	124
Number of Associated Scaffolds	275

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	36.79 %
% of genes near scaffold ends (potentially truncated)	62.77 %
% of genes from short scaffolds (< 2000 bps)	68.44 %
Associated GOLD sequencing projects	113
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.24

Most Common Taxonomy
Group	Bacteria (55.674 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (44.326 % of family members)
Environment Ontology (ENVO)	Unclassified (26.241 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (57.801 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 25.40% β-sheet: 0.00% Coil/Unstructured: 74.60%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 275 Family Scaffolds
PF14534	DUF4440	2.91
PF00903	Glyoxalase	1.82
PF15580	Imm53	1.82
PF10077	DUF2314	1.45
PF03544	TonB_C	1.09
PF04229	GrpB	1.09
PF01872	RibD_C	1.09
PF08734	GYD	1.09
PF13474	SnoaL_3	0.73
PF12680	SnoaL_2	0.73
PF15631	Imm-NTF2-2	0.73
PF13476	AAA_23	0.73
PF13620	CarboxypepD_reg	0.73
PF09346	SMI1_KNR4	0.73
PF04072	LCM	0.73
PF09720	Unstab_antitox	0.73
PF10387	DUF2442	0.73
PF13711	DUF4160	0.73
PF07927	HicA_toxin	0.73
PF13924	Lipocalin_5	0.73
PF15589	Imm21	0.73
PF11066	DUF2867	0.36
PF04365	BrnT_toxin	0.36
PF06877	RraB	0.36
PF14119	DUF4288	0.36
PF11008	DUF2846	0.36
PF05117	DUF695	0.36
PF04993	TfoX_N	0.36
PF14526	Cass2	0.36
PF05016	ParE_toxin	0.36
PF12158	DUF3592	0.36
PF04343	DUF488	0.36
PF07859	Abhydrolase_3	0.36
PF13472	Lipase_GDSL_2	0.36
PF13011	LZ_Tnp_IS481	0.36
PF07681	DoxX	0.36
PF12796	Ank_2	0.36
PF13207	AAA_17	0.36
PF08818	DUF1801	0.36
PF13826	DUF4188	0.36
PF13333	rve_2	0.36
PF13565	HTH_32	0.36
PF00589	Phage_integrase	0.36
PF06271	RDD	0.36
PF05694	SBP56	0.36
PF14300	DUF4375	0.36
PF07110	EthD	0.36
PF00005	ABC_tran	0.36
PF11622	DUF3251	0.36
PF00144	Beta-lactamase	0.36
PF06348	DUF1059	0.36
PF13551	HTH_29	0.36
PF13414	TPR_11	0.36
PF00248	Aldo_ket_red	0.36
PF09413	DUF2007	0.36
PF13787	HXXEE	0.36
PF09932	DUF2164	0.36
PF05076	SUFU	0.36
PF13455	MUG113	0.36
PF14499	DUF4437	0.36
PF08592	Anthrone_oxy	0.36
PF12681	Glyoxalase_2	0.36
PF10012	DUF2255	0.36
PF13936	HTH_38	0.36
PF13683	rve_3	0.36
PF08974	DUF1877	0.36
PF06197	DUF998	0.36
PF00069	Pkinase	0.36
PF07883	Cupin_2	0.36
PF08240	ADH_N	0.36
PF04402	SIMPL	0.36
PF13184	KH_5	0.36
PF06283	ThuA	0.36
PF13365	Trypsin_2	0.36
PF01844	HNH	0.36
PF00717	Peptidase_S24	0.36

COG ID	Name	Functional Category	% Frequency in 275 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	1.45
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	1.09
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	1.09
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	1.09
COG2320	GrpB domain, predicted nucleotidyltransferase, UPF0157 family	General function prediction only [R]	1.09
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	1.09
COG1724	Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family	General function prediction only [R]	0.73
COG3315	O-Methyltransferase involved in polyketide biosynthesis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.73
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.36
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.36
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.36
COG1714	Uncharacterized membrane protein YckC, RDD family	Function unknown [S]	0.36
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.36
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.36
COG2859	Outer membrane channel-forming protein BP26/OMP28, SIMPL family	Cell wall/membrane/envelope biogenesis [M]	0.36
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	0.36
COG2968	Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain	Function unknown [S]	0.36
COG3070	Transcriptional regulator of competence genes, TfoX/Sxy family	Transcription [K]	0.36
COG3076	Regulator of RNase E activity RraB	Translation, ribosomal structure and biogenesis [J]	0.36
COG3189	Uncharacterized conserved protein YeaO, DUF488 family	Function unknown [S]	0.36
COG3371	Uncharacterized membrane protein	Function unknown [S]	0.36
COG3471	Predicted secreted (periplasmic) protein	Function unknown [S]	0.36
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.36
COG4430	Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family	Function unknown [S]	0.36
COG4813	Trehalose utilization protein	Carbohydrate transport and metabolism [G]	0.36
COG5646	Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)	Posttranslational modification, protein turnover, chaperones [O]	0.36
COG5649	Uncharacterized conserved protein, DUF1801 domain	Function unknown [S]	0.36

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	56.38 %
Unclassified	root	N/A	43.62 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	56.38 %
Unclassified	root	N/A	43.62 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	55.67 %
Unclassified	root	N/A	43.62 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.35 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	9.57 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.45 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	4.26 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.42 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.06 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	1.06 %
Euryarchaeota	phylum	All Organisms → cellular organisms → Archaea → Euryarchaeota	0.35 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.35 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	7.09 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2.84 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.42 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1.42 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.06 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	1.06 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.71 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.71 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.71 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.71 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.71 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.35 %
unclassified Euryarchaeota	no rank	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %
Fungi	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	5.67 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	1.77 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.42 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	1.42 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	1.06 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.06 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	1.06 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
unclassified Actinobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria	0.35 %
Longimicrobiia	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia	0.35 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.35 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.35 %
Dikarya	subkingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	0.35 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	1.06 %
Chloroflexales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1.06 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	0.71 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.71 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Bacteroidetes Order II. Incertae sedis	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Longimicrobiales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales	0.35 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.35 %
Pseudonocardiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.35 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	0.35 %
Chromatiales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis	0.35 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.35 %
Ascomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Chloroflexineae	suborder	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae	1.06 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	1.06 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.71 %
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	0.71 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.35 %
Thiohalobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Longimicrobiaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
saccharomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta	0.35 %
Rhodothermaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae	0.35 %
Sorangiineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae	0.35 %
Desulfobulbaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae	0.35 %
Pseudonocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloridaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae	1.06 %
unclassified Nitrospira	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira	1.06 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
unclassified Gemmatimonadaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae	0.35 %
Gemmatirosa	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa	0.35 %
Rubinisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera	0.35 %
Polyangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	0.35 %
unclassified Thiohalobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter	0.35 %
Longimicrobium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium	0.35 %
Salinibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Kutzneria	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria	0.35 %
Pezizomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	0.35 %
unclassified Desulfobulbaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
unclassified Kutzneria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
unclassified Polyangiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
leotiomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
unclassified Oscillochloris	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
sordariomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Leotiomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Helotiales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Helotiales incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Cadophora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis → Cadophora	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
unclassified Cadophora	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis → Cadophora → unclassified Cadophora	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.62 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5.67 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1.77 %
Oscillochloris sp. ZM17-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	1.06 %
Nitrospira sp. ST-bin5	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1.06 %
Flavobacterium stagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	0.71 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.71 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.71 %
Cadophora sp. M221	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis → Cadophora → unclassified Cadophora → Cadophora sp. M221	0.35 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.35 %
Kutzneria sp. CA-103260	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	0.35 %
Longimicrobium terrae	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	0.35 %
Thiohalobacter sp. COW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	0.35 %
Rubinisphaera italica	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	0.35 %
Desulfobulbaceae bacterium A2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	0.35 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.35 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.35 %
Salinibacter ruber	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	0.35 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.35 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.35 %
Bacteroidetes bacterium 13_1_20CM_4_60_6	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	0.35 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.35 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.35 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.35 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.35 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002911\|JGI25390J43892_10122962	All Organisms → cellular organisms → Bacteria	594	Open in IMG/M
3300005176\|Ga0066679_10657176	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	682	Open in IMG/M
3300005180\|Ga0066685_10689225	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	701	Open in IMG/M
3300005446\|Ga0066686_10296281	All Organisms → cellular organisms → Bacteria → Proteobacteria	1098	Open in IMG/M
3300005447\|Ga0066689_10353561	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	916	Open in IMG/M
3300005555\|Ga0066692_10379869	All Organisms → cellular organisms → Bacteria	895	Open in IMG/M
3300005557\|Ga0066704_10121362	All Organisms → cellular organisms → Bacteria	1733	Open in IMG/M
3300005559\|Ga0066700_10042572	All Organisms → cellular organisms → Bacteria	2744	Open in IMG/M
3300005559\|Ga0066700_10124749	All Organisms → cellular organisms → Bacteria	1717	Open in IMG/M
3300005561\|Ga0066699_10189590	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1426	Open in IMG/M
3300005568\|Ga0066703_10505817	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300005569\|Ga0066705_10004038	All Organisms → cellular organisms → Bacteria	6125	Open in IMG/M
3300005569\|Ga0066705_10008148	All Organisms → cellular organisms → Bacteria	4802	Open in IMG/M
3300005575\|Ga0066702_10527754	Not Available	716	Open in IMG/M
3300005575\|Ga0066702_10549107	Not Available	698	Open in IMG/M
3300005586\|Ga0066691_10190807	All Organisms → cellular organisms → Bacteria	1190	Open in IMG/M
3300005586\|Ga0066691_10195644	Not Available	1176	Open in IMG/M
3300005598\|Ga0066706_10076923	All Organisms → cellular organisms → Bacteria	2354	Open in IMG/M
3300005833\|Ga0074472_10832079	Not Available	539	Open in IMG/M
3300005875\|Ga0075293_1079727	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	500	Open in IMG/M
3300005876\|Ga0075300_1074015	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	517	Open in IMG/M
3300005886\|Ga0075286_1012971	All Organisms → cellular organisms → Bacteria	999	Open in IMG/M
3300006032\|Ga0066696_11114059	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300006046\|Ga0066652_100816071	All Organisms → cellular organisms → Bacteria	892	Open in IMG/M
3300006049\|Ga0075417_10027313	All Organisms → cellular organisms → Bacteria	2335	Open in IMG/M
3300006049\|Ga0075417_10107768	All Organisms → cellular organisms → Bacteria	1268	Open in IMG/M
3300006049\|Ga0075417_10221995	Not Available	900	Open in IMG/M
3300006049\|Ga0075417_10228890	Not Available	887	Open in IMG/M
3300006049\|Ga0075417_10228890	Not Available	887	Open in IMG/M
3300006049\|Ga0075417_10386140	Not Available	691	Open in IMG/M
3300006049\|Ga0075417_10540025	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium A2	589	Open in IMG/M
3300006194\|Ga0075427_10104803	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300006577\|Ga0074050_11288055	Not Available	584	Open in IMG/M
3300006794\|Ga0066658_10430762	Not Available	718	Open in IMG/M
3300006796\|Ga0066665_10057744	All Organisms → cellular organisms → Bacteria	2702	Open in IMG/M
3300006796\|Ga0066665_10134766	All Organisms → cellular organisms → Bacteria	1857	Open in IMG/M
3300006797\|Ga0066659_11082113	All Organisms → cellular organisms → Bacteria	670	Open in IMG/M
3300006797\|Ga0066659_11185294	Not Available	638	Open in IMG/M
3300006800\|Ga0066660_10279038	Not Available	1323	Open in IMG/M
3300006800\|Ga0066660_10413309	Not Available	1117	Open in IMG/M
3300006800\|Ga0066660_10452636	All Organisms → cellular organisms → Bacteria	1073	Open in IMG/M
3300006844\|Ga0075428_100173156	All Organisms → cellular organisms → Bacteria	2339	Open in IMG/M
3300006844\|Ga0075428_100261748	All Organisms → cellular organisms → Bacteria → Proteobacteria	1862	Open in IMG/M
3300006844\|Ga0075428_100298734	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica	1731	Open in IMG/M
3300006844\|Ga0075428_100613611	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	1161	Open in IMG/M
3300006844\|Ga0075428_100920790	Not Available	927	Open in IMG/M
3300006844\|Ga0075428_101022340	Not Available	874	Open in IMG/M
3300006844\|Ga0075428_102287349	Not Available	556	Open in IMG/M
3300006844\|Ga0075428_102420983	Not Available	539	Open in IMG/M
3300006845\|Ga0075421_100046642	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5491	Open in IMG/M
3300006845\|Ga0075421_100094669	All Organisms → cellular organisms → Bacteria	3761	Open in IMG/M
3300006845\|Ga0075421_100094669	All Organisms → cellular organisms → Bacteria	3761	Open in IMG/M
3300006845\|Ga0075421_100163152	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2780	Open in IMG/M
3300006845\|Ga0075421_100177218	Not Available	2652	Open in IMG/M
3300006845\|Ga0075421_100201349	All Organisms → cellular organisms → Bacteria → FCB group	2464	Open in IMG/M
3300006845\|Ga0075421_100670324	Not Available	1209	Open in IMG/M
3300006845\|Ga0075421_100729368	Not Available	1149	Open in IMG/M
3300006845\|Ga0075421_101071684	Not Available	907	Open in IMG/M
3300006845\|Ga0075421_101244374	All Organisms → cellular organisms → Bacteria	827	Open in IMG/M
3300006846\|Ga0075430_100801788	All Organisms → cellular organisms → Bacteria → Proteobacteria	776	Open in IMG/M
3300006847\|Ga0075431_100051413	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	4249	Open in IMG/M
3300006847\|Ga0075431_100081948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	3331	Open in IMG/M
3300006847\|Ga0075431_100129646	All Organisms → cellular organisms → Bacteria	2602	Open in IMG/M
3300006847\|Ga0075431_100190083	Not Available	2104	Open in IMG/M
3300006847\|Ga0075431_100929302	Not Available	839	Open in IMG/M
3300006847\|Ga0075431_101266834	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300006847\|Ga0075431_101878623	Not Available	555	Open in IMG/M
3300006852\|Ga0075433_10085998	All Organisms → cellular organisms → Bacteria	2776	Open in IMG/M
3300006852\|Ga0075433_10116883	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260	2366	Open in IMG/M
3300006852\|Ga0075433_10160358	Not Available	2001	Open in IMG/M
3300006852\|Ga0075433_10188693	Not Available	1834	Open in IMG/M
3300006852\|Ga0075433_10365809	Not Available	1274	Open in IMG/M
3300006852\|Ga0075433_10449190	Not Available	1136	Open in IMG/M
3300006852\|Ga0075433_10483710	Not Available	1090	Open in IMG/M
3300006852\|Ga0075433_11508734	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300006852\|Ga0075433_11915523	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300006854\|Ga0075425_100367586	Not Available	1656	Open in IMG/M
3300006871\|Ga0075434_100023960	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5959	Open in IMG/M
3300006871\|Ga0075434_100050888	Not Available	4115	Open in IMG/M
3300006871\|Ga0075434_100062617	All Organisms → cellular organisms → Bacteria	3703	Open in IMG/M
3300006871\|Ga0075434_100090536	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	3060	Open in IMG/M
3300006871\|Ga0075434_100113995	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2716	Open in IMG/M
3300006871\|Ga0075434_100148581	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	2363	Open in IMG/M
3300006871\|Ga0075434_100181770	Not Available	2123	Open in IMG/M
3300006871\|Ga0075434_100200488	Not Available	2015	Open in IMG/M
3300006871\|Ga0075434_100240006	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1832	Open in IMG/M
3300006871\|Ga0075434_100481270	All Organisms → cellular organisms → Bacteria	1262	Open in IMG/M
3300006871\|Ga0075434_101241947	Not Available	757	Open in IMG/M
3300006880\|Ga0075429_100051664	Not Available	3576	Open in IMG/M
3300006880\|Ga0075429_100051664	Not Available	3576	Open in IMG/M
3300006880\|Ga0075429_100078980	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	2868	Open in IMG/M
3300006880\|Ga0075429_100107861	Not Available	2433	Open in IMG/M
3300006880\|Ga0075429_100133657	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Longimicrobiia → Longimicrobiales → Longimicrobiaceae → Longimicrobium → Longimicrobium terrae	2170	Open in IMG/M
3300006880\|Ga0075429_100395835	Not Available	1209	Open in IMG/M
3300006880\|Ga0075429_100592070	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	972	Open in IMG/M
3300006880\|Ga0075429_100717851	Not Available	875	Open in IMG/M
3300006880\|Ga0075429_101202323	Not Available	662	Open in IMG/M
3300006904\|Ga0075424_100053346	All Organisms → cellular organisms → Bacteria → Proteobacteria	4225	Open in IMG/M
3300006904\|Ga0075424_100053346	All Organisms → cellular organisms → Bacteria → Proteobacteria	4225	Open in IMG/M
3300006904\|Ga0075424_102511631	Not Available	539	Open in IMG/M
3300006969\|Ga0075419_10099154	All Organisms → cellular organisms → Bacteria	1871	Open in IMG/M
3300006969\|Ga0075419_10396688	All Organisms → cellular organisms → Bacteria	945	Open in IMG/M
3300006969\|Ga0075419_10588820	Not Available	780	Open in IMG/M
3300006969\|Ga0075419_11010500	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300007255\|Ga0099791_10570397	Not Available	552	Open in IMG/M
3300009012\|Ga0066710_100033270	All Organisms → cellular organisms → Bacteria	6055	Open in IMG/M
3300009012\|Ga0066710_100462698	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1904	Open in IMG/M
3300009012\|Ga0066710_101028265	Not Available	1272	Open in IMG/M
3300009090\|Ga0099827_10414821	All Organisms → cellular organisms → Bacteria	1152	Open in IMG/M
3300009100\|Ga0075418_10745125	Not Available	1057	Open in IMG/M
3300009100\|Ga0075418_11485625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiales incertae sedis → Thiohalobacter → unclassified Thiohalobacter → Thiohalobacter sp. COW1	735	Open in IMG/M
3300009100\|Ga0075418_12472100	Not Available	567	Open in IMG/M
3300009137\|Ga0066709_100583086	All Organisms → cellular organisms → Bacteria	1590	Open in IMG/M
3300009137\|Ga0066709_102982133	Not Available	622	Open in IMG/M
3300009147\|Ga0114129_10078153	All Organisms → cellular organisms → Bacteria	4603	Open in IMG/M
3300009147\|Ga0114129_10143751	All Organisms → cellular organisms → Bacteria	3268	Open in IMG/M
3300009147\|Ga0114129_10154594	All Organisms → cellular organisms → Bacteria	3138	Open in IMG/M
3300009147\|Ga0114129_10172029	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2952	Open in IMG/M
3300009147\|Ga0114129_10199878	Not Available	2708	Open in IMG/M
3300009147\|Ga0114129_10274392	All Organisms → cellular organisms → Bacteria	2255	Open in IMG/M
3300009147\|Ga0114129_10287012	Not Available	2197	Open in IMG/M
3300009147\|Ga0114129_10298283	All Organisms → cellular organisms → Bacteria	2149	Open in IMG/M
3300009147\|Ga0114129_10374651	All Organisms → cellular organisms → Bacteria	1881	Open in IMG/M
3300009147\|Ga0114129_10434076	Not Available	1725	Open in IMG/M
3300009147\|Ga0114129_10515699	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1559	Open in IMG/M
3300009147\|Ga0114129_10554029	Not Available	1495	Open in IMG/M
3300009147\|Ga0114129_10633661	All Organisms → cellular organisms → Bacteria	1381	Open in IMG/M
3300009147\|Ga0114129_10676228	All Organisms → cellular organisms → Bacteria	1329	Open in IMG/M
3300009147\|Ga0114129_10677983	Not Available	1327	Open in IMG/M
3300009147\|Ga0114129_10948057	Not Available	1087	Open in IMG/M
3300009147\|Ga0114129_11031866	Not Available	1034	Open in IMG/M
3300009147\|Ga0114129_11210275	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	940	Open in IMG/M
3300009147\|Ga0114129_11234543	All Organisms → cellular organisms → Bacteria	929	Open in IMG/M
3300009147\|Ga0114129_11716202	All Organisms → cellular organisms → Bacteria	766	Open in IMG/M
3300009147\|Ga0114129_11791493	All Organisms → cellular organisms → Bacteria	747	Open in IMG/M
3300009147\|Ga0114129_12152490	Not Available	672	Open in IMG/M
3300009147\|Ga0114129_12153925	Not Available	672	Open in IMG/M
3300009147\|Ga0114129_12883113	Not Available	569	Open in IMG/M
3300009147\|Ga0114129_12921796	Not Available	564	Open in IMG/M
3300009147\|Ga0114129_12934866	Not Available	563	Open in IMG/M
3300009147\|Ga0114129_13018254	Not Available	553	Open in IMG/M
3300009162\|Ga0075423_10035053	All Organisms → cellular organisms → Bacteria	5106	Open in IMG/M
3300009162\|Ga0075423_10055431	Not Available	4091	Open in IMG/M
3300009162\|Ga0075423_10094819	All Organisms → cellular organisms → Bacteria	3119	Open in IMG/M
3300009162\|Ga0075423_10367162	All Organisms → cellular organisms → Bacteria	1510	Open in IMG/M
3300009162\|Ga0075423_12707317	Not Available	543	Open in IMG/M
3300010046\|Ga0126384_12343845	Not Available	516	Open in IMG/M
3300010336\|Ga0134071_10124830	All Organisms → cellular organisms → Bacteria	1239	Open in IMG/M
3300010362\|Ga0126377_11208772	Not Available	826	Open in IMG/M
3300010403\|Ga0134123_11631852	All Organisms → cellular organisms → Bacteria	693	Open in IMG/M
3300011271\|Ga0137393_11739481	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300011444\|Ga0137463_1115418	Not Available	1010	Open in IMG/M
3300012199\|Ga0137383_10126010	Not Available	1869	Open in IMG/M
3300012200\|Ga0137382_10097321	All Organisms → cellular organisms → Bacteria	1936	Open in IMG/M
3300012201\|Ga0137365_10232612	Not Available	1373	Open in IMG/M
3300012203\|Ga0137399_10554683	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	965	Open in IMG/M
3300012204\|Ga0137374_10012363	All Organisms → cellular organisms → Bacteria	9948	Open in IMG/M
3300012204\|Ga0137374_10109657	Not Available	2574	Open in IMG/M
3300012204\|Ga0137374_10303302	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1309	Open in IMG/M
3300012204\|Ga0137374_10303302	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	1309	Open in IMG/M
3300012205\|Ga0137362_10355339	Not Available	1269	Open in IMG/M
3300012206\|Ga0137380_10031472	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	4891	Open in IMG/M
3300012207\|Ga0137381_10085995	All Organisms → cellular organisms → Bacteria	2648	Open in IMG/M
3300012207\|Ga0137381_10101702	All Organisms → cellular organisms → Bacteria	2438	Open in IMG/M
3300012207\|Ga0137381_10721780	Not Available	866	Open in IMG/M
3300012210\|Ga0137378_10488692	Not Available	1137	Open in IMG/M
3300012225\|Ga0137434_1025231	Not Available	806	Open in IMG/M
3300012349\|Ga0137387_10149780	Not Available	1660	Open in IMG/M
3300012350\|Ga0137372_10398996	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1042	Open in IMG/M
3300012353\|Ga0137367_10094788	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. ST-bin5	2202	Open in IMG/M
3300012353\|Ga0137367_11215450	Not Available	503	Open in IMG/M
3300012355\|Ga0137369_10678332	Not Available	710	Open in IMG/M
3300012360\|Ga0137375_10355887	Not Available	1297	Open in IMG/M
3300012363\|Ga0137390_10114377	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2671	Open in IMG/M
3300012532\|Ga0137373_10064348	All Organisms → cellular organisms → Bacteria → Proteobacteria	3342	Open in IMG/M
3300012532\|Ga0137373_10223337	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1536	Open in IMG/M
3300012685\|Ga0137397_11088949	All Organisms → cellular organisms → Bacteria → Acidobacteria	583	Open in IMG/M
3300012923\|Ga0137359_11651414	Not Available	528	Open in IMG/M
3300012929\|Ga0137404_12010731	Not Available	539	Open in IMG/M
3300012931\|Ga0153915_10254020	All Organisms → cellular organisms → Bacteria → Proteobacteria	1949	Open in IMG/M
3300012931\|Ga0153915_12811837	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300012931\|Ga0153915_13104927	All Organisms → cellular organisms → Bacteria → Proteobacteria	540	Open in IMG/M
3300012972\|Ga0134077_10378770	Not Available	608	Open in IMG/M
3300014873\|Ga0180066_1006131	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	1923	Open in IMG/M
3300015241\|Ga0137418_10039775	All Organisms → cellular organisms → Bacteria	4337	Open in IMG/M
3300017656\|Ga0134112_10281283	Not Available	665	Open in IMG/M
3300017659\|Ga0134083_10015944	All Organisms → cellular organisms → Bacteria	2595	Open in IMG/M
3300018053\|Ga0184626_10288883	Not Available	682	Open in IMG/M
3300018068\|Ga0184636_1211325	All Organisms → cellular organisms → Bacteria → Proteobacteria	689	Open in IMG/M
3300018079\|Ga0184627_10392996	Not Available	723	Open in IMG/M
3300018079\|Ga0184627_10586564	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6	562	Open in IMG/M
3300018082\|Ga0184639_10484789	All Organisms → cellular organisms → Bacteria	627	Open in IMG/M
3300018084\|Ga0184629_10607685	Not Available	557	Open in IMG/M
3300018084\|Ga0184629_10705192	Not Available	508	Open in IMG/M
3300018431\|Ga0066655_10011455	All Organisms → cellular organisms → Bacteria	3861	Open in IMG/M
3300018433\|Ga0066667_11386532	Not Available	617	Open in IMG/M
3300018468\|Ga0066662_10070444	All Organisms → cellular organisms → Bacteria	2338	Open in IMG/M
3300018482\|Ga0066669_10222788	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1466	Open in IMG/M
3300019360\|Ga0187894_10501355	Not Available	526	Open in IMG/M
3300019458\|Ga0187892_10245878	Not Available	922	Open in IMG/M
3300019458\|Ga0187892_10329187	Not Available	750	Open in IMG/M
3300019458\|Ga0187892_10390793	Not Available	665	Open in IMG/M
3300020022\|Ga0193733_1067029	All Organisms → cellular organisms → Bacteria → Proteobacteria	1009	Open in IMG/M
3300021081\|Ga0210379_10259813	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	755	Open in IMG/M
3300025922\|Ga0207646_11246572	Not Available	651	Open in IMG/M
3300026295\|Ga0209234_1014562	All Organisms → cellular organisms → Bacteria	2976	Open in IMG/M
3300026309\|Ga0209055_1002512	All Organisms → cellular organisms → Bacteria	11557	Open in IMG/M
3300026309\|Ga0209055_1025051	All Organisms → cellular organisms → Bacteria	2805	Open in IMG/M
3300026312\|Ga0209153_1085481	All Organisms → cellular organisms → Bacteria	1167	Open in IMG/M
3300026318\|Ga0209471_1004019	All Organisms → cellular organisms → Bacteria	8196	Open in IMG/M
3300026318\|Ga0209471_1263810	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300026328\|Ga0209802_1134035	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1070	Open in IMG/M
3300026333\|Ga0209158_1282583	All Organisms → cellular organisms → Bacteria → Proteobacteria	570	Open in IMG/M
3300026343\|Ga0209159_1135487	All Organisms → cellular organisms → Bacteria	1004	Open in IMG/M
3300026532\|Ga0209160_1220160	Not Available	669	Open in IMG/M
3300026538\|Ga0209056_10008251	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	10682	Open in IMG/M
3300026550\|Ga0209474_10079518	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	2256	Open in IMG/M
3300026552\|Ga0209577_10252122	Not Available	1331	Open in IMG/M
3300027187\|Ga0209869_1013187	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	909	Open in IMG/M
3300027846\|Ga0209180_10013312	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	4286	Open in IMG/M
3300027873\|Ga0209814_10024261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2477	Open in IMG/M
3300027873\|Ga0209814_10031317	Not Available	2190	Open in IMG/M
3300027873\|Ga0209814_10032980	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2137	Open in IMG/M
3300027873\|Ga0209814_10122695	Not Available	1108	Open in IMG/M
3300027873\|Ga0209814_10189769	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	887	Open in IMG/M
3300027873\|Ga0209814_10445545	Not Available	571	Open in IMG/M
3300027875\|Ga0209283_10633953	All Organisms → cellular organisms → Bacteria	674	Open in IMG/M
3300027880\|Ga0209481_10075137	Not Available	1603	Open in IMG/M
3300027880\|Ga0209481_10111433	All Organisms → cellular organisms → Bacteria	1329	Open in IMG/M
3300027880\|Ga0209481_10379945	Not Available	723	Open in IMG/M
3300027880\|Ga0209481_10442261	Not Available	669	Open in IMG/M
3300027880\|Ga0209481_10688195	Not Available	531	Open in IMG/M
3300027882\|Ga0209590_10221241	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1202	Open in IMG/M
3300027903\|Ga0209488_10452336	All Organisms → cellular organisms → Bacteria	946	Open in IMG/M
3300027909\|Ga0209382_10019267	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	8302	Open in IMG/M
3300027909\|Ga0209382_10085229	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3718	Open in IMG/M
3300027909\|Ga0209382_10111940	All Organisms → cellular organisms → Bacteria	3189	Open in IMG/M
3300027909\|Ga0209382_10151088	Not Available	2690	Open in IMG/M
3300027909\|Ga0209382_10171997	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4	2498	Open in IMG/M
3300027909\|Ga0209382_10506872	All Organisms → cellular organisms → Bacteria → FCB group	1328	Open in IMG/M
3300027909\|Ga0209382_11277101	Not Available	746	Open in IMG/M
3300028536\|Ga0137415_10070273	All Organisms → cellular organisms → Bacteria	3363	Open in IMG/M
3300028536\|Ga0137415_11362548	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Helotiales incertae sedis → Cadophora → unclassified Cadophora → Cadophora sp. M221	530	Open in IMG/M
3300028803\|Ga0307281_10433640	Not Available	506	Open in IMG/M
3300031949\|Ga0214473_10993118	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium stagni	887	Open in IMG/M
3300032770\|Ga0335085_10035904	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	6843	Open in IMG/M
3300032770\|Ga0335085_10035904	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	6843	Open in IMG/M
3300032770\|Ga0335085_10141816	Not Available	3029	Open in IMG/M
3300032770\|Ga0335085_10152671	All Organisms → cellular organisms → Bacteria	2894	Open in IMG/M
3300032770\|Ga0335085_10193472	Not Available	2499	Open in IMG/M
3300032770\|Ga0335085_10615893	Not Available	1219	Open in IMG/M
3300032770\|Ga0335085_10624958	Not Available	1208	Open in IMG/M
3300032770\|Ga0335085_12281985	Not Available	542	Open in IMG/M
3300032782\|Ga0335082_10330345	Not Available	1394	Open in IMG/M
3300032782\|Ga0335082_10374147	All Organisms → cellular organisms → Bacteria	1290	Open in IMG/M
3300032782\|Ga0335082_10947587	Not Available	724	Open in IMG/M
3300032782\|Ga0335082_11087506	Not Available	665	Open in IMG/M
3300032782\|Ga0335082_11551141	Not Available	534	Open in IMG/M
3300033412\|Ga0310810_11414198	Not Available	529	Open in IMG/M
3300033412\|Ga0310810_11414198	Not Available	529	Open in IMG/M
3300033433\|Ga0326726_10009306	All Organisms → cellular organisms → Bacteria	8712	Open in IMG/M
3300033433\|Ga0326726_10065187	All Organisms → cellular organisms → Bacteria	3208	Open in IMG/M
3300033433\|Ga0326726_10363720	All Organisms → cellular organisms → Bacteria	1367	Open in IMG/M
3300033433\|Ga0326726_10742337	Not Available	948	Open in IMG/M
3300033433\|Ga0326726_11293898	Not Available	709	Open in IMG/M
3300033433\|Ga0326726_11705762	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300033500\|Ga0326730_1012288	Not Available	1865	Open in IMG/M
3300033513\|Ga0316628_101718877	Not Available	835	Open in IMG/M
3300033811\|Ga0364924_004058	All Organisms → cellular organisms → Bacteria	2559	Open in IMG/M
3300033811\|Ga0364924_007166	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2005	Open in IMG/M
3300033812\|Ga0364926_140997	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300034090\|Ga0326723_0010760	All Organisms → cellular organisms → Bacteria	3593	Open in IMG/M
3300034090\|Ga0326723_0014398	All Organisms → cellular organisms → Bacteria	3165	Open in IMG/M
3300034090\|Ga0326723_0155540	All Organisms → cellular organisms → Bacteria → Proteobacteria	1005	Open in IMG/M
3300034090\|Ga0326723_0284453	Not Available	740	Open in IMG/M
3300034090\|Ga0326723_0434491	Not Available	598	Open in IMG/M
3300034165\|Ga0364942_0125895	All Organisms → cellular organisms → Bacteria → FCB group	833	Open in IMG/M
3300034773\|Ga0364936_001106	All Organisms → cellular organisms → Bacteria → Proteobacteria	3665	Open in IMG/M
3300034773\|Ga0364936_120481	Not Available	527	Open in IMG/M
3300034817\|Ga0373948_0053954	Not Available	869	Open in IMG/M

Habitat	Taxonomy	Distribution
Environmental	Environmental	55.32%
Host-Associated	Host-Associated	44.68%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	50.00%
Plants	Host-Associated → Plants	44.68%
Aquatic	Environmental → Aquatic	5.32%

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	44.68%
Soil	Environmental → Terrestrial → Soil	42.20%
Peat	Environmental → Terrestrial → Peat	4.26%
Sediment	Environmental → Aquatic → Sediment	3.90%
Floodplain	Environmental → Terrestrial → Floodplain	2.13%
Freshwater	Environmental → Aquatic → Freshwater	1.42%
Cave	Environmental → Terrestrial → Cave	1.42%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	44.33%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.46%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.03%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.26%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.90%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	2.13%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.42%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.06%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.35%
Loam	Environmental → Terrestrial → Soil → Loam	0.35%
Sand	Environmental → Terrestrial → Soil → Sand	0.35%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.35%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	44.33%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	17.73%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.38%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.03%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.26%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.90%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	2.13%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.42%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.06%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.35%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.35%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.35%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.35%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	44.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	13.83%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.12%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.96%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	4.26%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.90%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.48%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	2.13%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.42%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.42%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.06%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.06%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.06%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	1.06%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.71%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.35%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.35%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.35%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.35%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.35%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.35%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.35%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental	Open in IMG/M
3300005875	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101	Environmental	Open in IMG/M
3300005876	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401	Environmental	Open in IMG/M
3300005886	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006194	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Host-Associated	Open in IMG/M
3300006577	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012225	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014873	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018068	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2	Environmental	Open in IMG/M
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental	Open in IMG/M
3300018082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300020022	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026309	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)	Environmental	Open in IMG/M
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)	Environmental	Open in IMG/M
3300026343	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)	Environmental	Open in IMG/M
3300026532	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300027187	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033500	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300033811	Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17	Environmental	Open in IMG/M
3300033812	Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M
3300034165	Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17	Environmental	Open in IMG/M
3300034773	Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17	Environmental	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI25390J43892_101229621	3300002911	Grasslands Soil	STGGARVRNHRGLNCALPNQRLKLAARGGRMIGKGSVLIAAAAARSLSAIR*
Ga0066679_106571762	3300005176	Soil	VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR*
Ga0066685_106892252	3300005180	Soil	AHIDLAPSNMRMKLSARGGRLIGNSSNLSAAAAGRSLCAIR*
Ga0066686_102962812	3300005446	Soil	MSQVPPNMRLKLSARGGRLIGKGSILIAAAAGRSLGAIR*
Ga0066689_103535611	3300005447	Soil	LNCALPNQRLKLPARGGRVIGKGSVLIAAAAGRSLSAIR*
Ga0066692_103798692	3300005555	Soil	VRNHCGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066704_101213622	3300005557	Soil	VRNHCGLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR*
Ga0066700_100425724	3300005559	Soil	VRSHRGLNCALPHQRLKPPARGGRVIGKGSVLIAAAAGRSLSAIR*
Ga0066700_101247493	3300005559	Soil	ALPNKRLKLAACGGRLKRNGSVLSAAAAGRSLSAIR*
Ga0066699_101895904	3300005561	Soil	CALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066703_105058171	3300005568	Soil	VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGHSLSAIRYAAPQKDAL*
Ga0066705_100040382	3300005569	Soil	VRNHRGLNCALPSQRLKLSACGGRMIGKDSVLIAAAAGRSLSAIR*
Ga0066705_100081484	3300005569	Soil	VRNHRGLKCALPNQRLKLSARGGRVIGKGSVLIAAAVGRSLSAIR*
Ga0066702_105277541	3300005575	Soil	TGGARVRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066702_105491071	3300005575	Soil	EHSVLPNMRLKLAARGGRLIEKASFLIAAAAGRSLSAIR*
Ga0066691_101908074	3300005586	Soil	GLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR*
Ga0066691_101956443	3300005586	Soil	LSTVAPNQRLKLSARGGRVVGNWINLSAAAAGRSLSAIR*
Ga0066706_100769235	3300005598	Soil	VRNHRGLNCALPSQRLKLSARGGRMIGKDSVLIAAAAGRSLSAIR*
Ga0074472_108320792	3300005833	Sediment (Intertidal)	MYPVCTKLLPNQRWKLSARGGRLGGNGSVLSAAAAGR
Ga0075293_10797271	3300005875	Rice Paddy Soil	GLPNQRLKLSARGGHICKKKSVLSVAAAGRSLSATR*
Ga0075300_10740151	3300005876	Rice Paddy Soil	SIERLGVRPNQRLKLSARGGHICKKKSVLSVAAAGRSLSATR*
Ga0075286_10129713	3300005886	Rice Paddy Soil	RQMPNPRLKLSARGGRSVGKGSILIAAAAGRSLSAIR*
Ga0066696_111140591	3300006032	Soil	MMARPNKRLKLSACGGRSIGNWFILSAAAAGRSLSAIR*
Ga0066652_1008160712	3300006046	Soil	MCSESTWQMRAPPNQRLKLTARGGRSIRELSFLSAAAAGRSLS
Ga0075417_100273135	3300006049	Populus Rhizosphere	MSLLPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR*
Ga0075417_101077681	3300006049	Populus Rhizosphere	SGGLPNQRLKLTARGGRLIGKGSVLIAAAAGRTLSAIR*
Ga0075417_102219951	3300006049	Populus Rhizosphere	MVREMPLPNQRLKLSARGGRVVGNGSLLIAAAAGRSLSAIR*
Ga0075417_102288902	3300006049	Populus Rhizosphere	MALSNKRLKLAARGGRLIGKESLLVAAAAGRSLSAIR*
Ga0075417_102288904	3300006049	Populus Rhizosphere	PNQRLKLTARGGRVRGNGSIFSAAAAGRSLSAIR*
Ga0075417_103861401	3300006049	Populus Rhizosphere	PNMRLKLTARGGRVLGNESVLSAAAAGRSLSAIR*
Ga0075417_105400251	3300006049	Populus Rhizosphere	MLPNLRLKLPARGGRLIGKKSVLIAAAAGRSLSAIR*
Ga0075427_101048032	3300006194	Populus Rhizosphere	MLIAMPPANQRLKLTARGGRLMRNSSVLSAAAAGRSLS
Ga0074050_112880552	3300006577	Soil	LKLSARGGRPVGNGSVLSAAAGGRSFSAVRYAHR*
Ga0066658_104307621	3300006794	Soil	SNLRLKLPARGGRSVENRSVLIAAAAGRSLSAIR*
Ga0066665_100577443	3300006796	Soil	LAPNQRLKLTARGGRSVGNGSVLIAAAAGRSLSAIR*
Ga0066665_101347664	3300006796	Soil	VVAWAQPNPRLKLSARGGRVIGSGSVLSAAAAGRSLSAIR*
Ga0066659_110821132	3300006797	Soil	ARVRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGHSLSAIRYAAPQKDAL*
Ga0066659_111852941	3300006797	Soil	ARVRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066660_102790384	3300006800	Soil	LNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066660_104133093	3300006800	Soil	NCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR*
Ga0066660_104526363	3300006800	Soil	SEHSVLPNMRLKLAARGGRLIEKASFLIAAAAGRSLSAIR*
Ga0075428_1001731562	3300006844	Populus Rhizosphere	MSIGCTKVPPNQRLKLSARGGRVIGKWSVLSAAAAGRSLSAIR*
Ga0075428_1002617482	3300006844	Populus Rhizosphere	MASICVDMLPNLRLKLPARGGRLIGKKSVLIAAAAGRSLSAIR*
Ga0075428_1002987344	3300006844	Populus Rhizosphere	MVRGLPRQPNMRLKLTARGGRVLGNESVLSAAAAGRSLSAIR*
Ga0075428_1006136111	3300006844	Populus Rhizosphere	MRHGRNGKWLAPNMRLKLLARGGRSIGKWSVLIAAAAGRNLSAIR*
Ga0075428_1009207904	3300006844	Populus Rhizosphere	PNQRLKLTARGGRVIGNRYVLSAAVAGRSLSAIR*
Ga0075428_1010223402	3300006844	Populus Rhizosphere	GALPNQRLKLSARGGRLVGNGSILIAAAAGRSLSAIR*
Ga0075428_1022873491	3300006844	Populus Rhizosphere	MASMCVDMLPNQRLKLTARGGRLIGKRSVLSAAAAGRSL
Ga0075428_1024209832	3300006844	Populus Rhizosphere	MSPLPNQRLKLTARGGRSRGKESVLIAAAAGRSLS
Ga0075421_1000466422	3300006845	Populus Rhizosphere	VTCLSELPNQRLKLTARGGRLIGKGSVLSAAATGRSLSAIR*
Ga0075421_10009466910	3300006845	Populus Rhizosphere	VRGRRGLTYALPNQRLKLTARGGRLIGKRSILSAAAAGRSLSAIR*
Ga0075421_1000946692	3300006845	Populus Rhizosphere	MGLPNMRLKLTARGGRLIGNRSVLSAAAAGRSLSAIR*
Ga0075421_1001631521	3300006845	Populus Rhizosphere	MLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR*
Ga0075421_1001772186	3300006845	Populus Rhizosphere	MWRPNQRLKLTARGGRLVRYGSVLMAAATGRSLSAIR*
Ga0075421_1002013495	3300006845	Populus Rhizosphere	ARAPANMRLKLTARGRRLVGNGSVFSAAAAGRSLSAIR*
Ga0075421_1006703242	3300006845	Populus Rhizosphere	VSKPPSNQRLKLTSRGGRLKGKRSILIAAAAGRSLSAIR*
Ga0075421_1007293682	3300006845	Populus Rhizosphere	MASMCVDMLPNQRLKLTARGGRLIGKRSVLSAAAAGRSLSAIR*
Ga0075421_1010716841	3300006845	Populus Rhizosphere	PIMLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR*
Ga0075421_1012443741	3300006845	Populus Rhizosphere	MSLPNQRLKLTARGGRLRGNRLLLSAAAAGRSLSAIR*
Ga0075430_1008017881	3300006846	Populus Rhizosphere	VAQAPPNQRMKLAARGGRSVGNNVFLIAAAAGRSLCAIR*
Ga0075431_10005141310	3300006847	Populus Rhizosphere	MGGEPPNQRLKLPARGGRLVGHKSFLSTAAAGRSLSAIR*
Ga0075431_1000819482	3300006847	Populus Rhizosphere	MVQDDSCCGKVPPNQRLKLTARGGRLKGKVPVLSAAAAGRSLSAIR*
Ga0075431_1001296463	3300006847	Populus Rhizosphere	VLRPNQRLKLTACGGRVVGKRSILIAAAPGRSLSAIR*
Ga0075431_1001900834	3300006847	Populus Rhizosphere	MIAKPPNQRLKLSARGGRLIGKGSVLIAAAAGRSLSAIR*
Ga0075431_1009293021	3300006847	Populus Rhizosphere	PNQRLKLPARGGRLRGNESILIAAAAGRSLSAIR*
Ga0075431_1012668342	3300006847	Populus Rhizosphere	PNMRLKLTARGGRLIGNWLFLSAAAAGRSLSAIR*
Ga0075431_1018786232	3300006847	Populus Rhizosphere	PNQRLKLTARGGRLVGNGVVLPAAAAGRSLSAIR*
Ga0075433_100859982	3300006852	Populus Rhizosphere	MKARLLPNMRLKLSARGGRLIGKVFILIAAAAGRSLSAIR*
Ga0075433_101168836	3300006852	Populus Rhizosphere	PMGLPNMRLKLTARGGRLRGNRLFLSAAAAGRSLSAIR*
Ga0075433_101603584	3300006852	Populus Rhizosphere	QPPNQRLKLSARGGRLRGNWSILSAAAAGRSLSAIR*
Ga0075433_101886932	3300006852	Populus Rhizosphere	VYLNMLPNMRLKLTARGGRLVGDGSVLMAAAAGRSLSAIR*
Ga0075433_103658094	3300006852	Populus Rhizosphere	MNKLAPNQRLKLTARGGRLMGNRSILSAAAAGRSLSAIR*
Ga0075433_104491902	3300006852	Populus Rhizosphere	VDMLPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR*
Ga0075433_104837101	3300006852	Populus Rhizosphere	MASICVDMLPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR*
Ga0075433_115087341	3300006852	Populus Rhizosphere	LPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR*
Ga0075433_119155232	3300006852	Populus Rhizosphere	MLPNQRLKLTARGGRLTGNESVLSAAAAGRSLSAIR*
Ga0075425_1003675862	3300006854	Populus Rhizosphere	MSLPNQRLKLSARGGHNCRKESVLSVAAAGRSLSAIR*
Ga0075434_1000239605	3300006871	Populus Rhizosphere	MIQAHLPNQRLKLSARGGRVVGNGSVLSAAAAGRSLSAIR*
Ga0075434_1000508882	3300006871	Populus Rhizosphere	MGAPPNQRLKLTARGGRLVRNGSVLSAAAAGRSLSAIR*
Ga0075434_1000626174	3300006871	Populus Rhizosphere	VPQQPNQRLKLTARGGRLKGKKSILIAAAAGRSLRAIR*
Ga0075434_1000905361	3300006871	Populus Rhizosphere	VRPNQRLKLSARGGRLVEKGFVLSAAAAGRSLSAIR*
Ga0075434_1001139957	3300006871	Populus Rhizosphere	MMQPPNMRLKLTARGGRLIGNRSVLSAAAAGRSLSAIR*
Ga0075434_1001485818	3300006871	Populus Rhizosphere	PNQRLKLTARGGRLRGNVSILSAAAAGRSLSAIR*
Ga0075434_1001817704	3300006871	Populus Rhizosphere	MTQQPNMRLKLTARGGRVKGKESILIAAAAGRSLSAIR*
Ga0075434_1002004885	3300006871	Populus Rhizosphere	MGLPNMRLKLTARGGRLRGNRLFLSAAAAGRSLSAIR
Ga0075434_1002400064	3300006871	Populus Rhizosphere	GRLLPNQRLKLTTRGGRLIEKESVLIAAAAGRSLSAIR*
Ga0075434_1004812702	3300006871	Populus Rhizosphere	MASICVDTLPNQRLKLSARGGRLIAKESVLIAAAAGRSLSAIR*
Ga0075434_1012419471	3300006871	Populus Rhizosphere	MVQDDSCCGKVPPNQRLKLTARGGRSVRNESILIAAAAGRSLSAIR*
Ga0075429_1000516643	3300006880	Populus Rhizosphere	VIVGLPNQRLKLTARGGRVIGNWSILCAAATGRSLSAIR*
Ga0075429_1000516648	3300006880	Populus Rhizosphere	VPLPNQRLKLTARGGRLVGKELVLSAAAAGRSLSAIR*
Ga0075429_1000789806	3300006880	Populus Rhizosphere	MRGLPPNQRLKLTARGGRLIGNESVLSAAAAGRSLSAIR*
Ga0075429_1001078611	3300006880	Populus Rhizosphere	LPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR*
Ga0075429_1001336572	3300006880	Populus Rhizosphere	MTGLSNQRLKLSARGGRLVGSASVLSAAAAGRSLSAIR*
Ga0075429_1003958351	3300006880	Populus Rhizosphere	SNQRLKLTARGGRSIGNGSVLMAAAAGRSLSAIR*
Ga0075429_1005920704	3300006880	Populus Rhizosphere	PNMRLKLTARGGRVVGNRSILIAAAAGRSLSAIR*
Ga0075429_1007178511	3300006880	Populus Rhizosphere	RSRLPNMRLKLPARGGRLIGKGSILLAAAAGRSLSAIR*
Ga0075429_1012023232	3300006880	Populus Rhizosphere	PNQRLKLPARGGRLRGKGSVLIAAAAGRSLSAIR*
Ga0075424_1000533462	3300006904	Populus Rhizosphere	VTPRRAPPNQRLKLSARGGRVAGNRSVLSAAAAGRSLSAIR*
Ga0075424_1000533465	3300006904	Populus Rhizosphere	VSKPPSNQRLKLTARGGRLVGNGSVLIAAAAGRSLSAIR*
Ga0075424_1025116311	3300006904	Populus Rhizosphere	GGTLPNQRLKLSARGGRLRGNGSVLSAAAAGRSLSAFR*
Ga0075419_100991541	3300006969	Populus Rhizosphere	RPNQRLKLTARGGRLMGNGSILSAAAAGCSLSAIR*
Ga0075419_103966881	3300006969	Populus Rhizosphere	PPNQRLKLTARGGRLREKRSILLAAAAGRSLSAIR*
Ga0075419_105888202	3300006969	Populus Rhizosphere	PPNQRLKLTARGGRLRAKGSILMAAAAGRSLSAIR*
Ga0075419_110105003	3300006969	Populus Rhizosphere	ALPNQRLKLTARGGRPKGKRSILIAAAAGRSLSAIR*
Ga0099791_105703971	3300007255	Vadose Zone Soil	SICVDMLPNQRLKLTARGGRVVGNGSVLIAAAAGRSLSAIR*
Ga0066710_10003327012	3300009012	Grasslands Soil	TLVVAWAQPNPRLKLSARGGRVIGSGSVLSAAAAGRSLSAIR
Ga0066710_1004626982	3300009012	Grasslands Soil	MTLRPNQRMNLSASGGRFWRNRSIFSAAAAGRSLCAIR
Ga0066710_1010282651	3300009012	Grasslands Soil	MGAIPRQDRLPNQRLKLSACGGRLIRNWSVLSAAAAGRSLSA
Ga0099827_104148211	3300009090	Vadose Zone Soil	LPNQRLKLSARGGRLVENNVFLPTAAAGRSLSAIR*
Ga0075418_107451253	3300009100	Populus Rhizosphere	PLPNQRLKLTARGGRLVGKELVLSAAAAGRSLSAIR*
Ga0075418_114856251	3300009100	Populus Rhizosphere	RQPNMRLKLTARGSRLIGKRSVLIAAATGRSLSAIR*
Ga0075418_124721002	3300009100	Populus Rhizosphere	VPSNMRLKLTARAGRLVGHGTVLSAAAAGGSLREIR*
Ga0066709_1005830864	3300009137	Grasslands Soil	GGARVRNHRGLNCALPNQRLKLSARGGRMIGKGSFLIAAAASRSLSAIR*
Ga0066709_1029821332	3300009137	Grasslands Soil	SNMRMKLSARGGRLIGNWSKLSAAAAGRSLCAPR*
Ga0114129_100781539	3300009147	Populus Rhizosphere	MTPNMRLKLTARGGRLVANSSVLIAAAAGRSLSAIR*
Ga0114129_101437511	3300009147	Populus Rhizosphere	MPLPNQRLKLTARGGRLRGKRSILIAAAAGRSLSAIR*
Ga0114129_101545946	3300009147	Populus Rhizosphere	MRARPNQRLKLTARGGRLIGKWFTLIAAAAGRSLSAIR*
Ga0114129_101720292	3300009147	Populus Rhizosphere	MAGALPNQRLKLTACGGRLVGNRSLLSAAAAGRCLSAIR*
Ga0114129_101998785	3300009147	Populus Rhizosphere	CSAGQPNQRLKLSARGARLVRNRSILSAGAAGRSLSAIR*
Ga0114129_102743925	3300009147	Populus Rhizosphere	VALPNQRLKLSARGGRLVGNGSVLIAAAAGRSLSAIR*
Ga0114129_102870124	3300009147	Populus Rhizosphere	RPNQRLKLTTRGGRLLRNGSILSAAAAGRSLSAIR*
Ga0114129_102982831	3300009147	Populus Rhizosphere	LARAPANMRLKLTARGRRLVGNGSVFSAAAAGRSLSAIR*
Ga0114129_103746516	3300009147	Populus Rhizosphere	LPVLRPNQRLKLTACGGRVVGKRSILIAAAPGRSLSAIR*
Ga0114129_104340761	3300009147	Populus Rhizosphere	SRSRLPNMRLKLPARGGRLIGKGSILLAAAAGRSLSAIR*
Ga0114129_105156994	3300009147	Populus Rhizosphere	WPIMLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR*
Ga0114129_105540291	3300009147	Populus Rhizosphere	TLLSVSTQPNQRLKLTARGGRLRGNGSVLSAAAAGRSLSAIR*
Ga0114129_106336614	3300009147	Populus Rhizosphere	DVFTDPQPPNKRLKLTARGGRQVGNLSILSAAAAGRSLSAIR*
Ga0114129_106762281	3300009147	Populus Rhizosphere	CSGGLPNQRLKLTARGGRLIGKGSVLIAAAAGRTLSAIR*
Ga0114129_106779831	3300009147	Populus Rhizosphere	MKGLPPNQRLKLTARGGRLIGNRSILSAAAAGRSLSAI
Ga0114129_109480573	3300009147	Populus Rhizosphere	VSKPPSNQRLKLPARGDRVVRSRSVLSAAAAGRSLSAIR*
Ga0114129_110318663	3300009147	Populus Rhizosphere	RSFVRLSRLPNMRLKLTARGGRVIGNRFVLSAADAGRSLSAIR*
Ga0114129_112102751	3300009147	Populus Rhizosphere	MVTLGPAPNIRLKLSARGGRVVGKGSILSAAAAGCSLSAIR
Ga0114129_112345431	3300009147	Populus Rhizosphere	EPPNMRLKLAARGGRLRGKGSILIAAAAGRSLSAIR*
Ga0114129_117162021	3300009147	Populus Rhizosphere	PNQRLKLSARGGRLVGNGSVLIAAATGRSLSAIR*
Ga0114129_117914932	3300009147	Populus Rhizosphere	MVLPNQRLKLTARGGRLIAKESVLLAAAAGRSLSAIR*
Ga0114129_121524901	3300009147	Populus Rhizosphere	VLPNQRLKLSARGGRVIGKGFVLSAAAAGRSLSAIR*
Ga0114129_121539251	3300009147	Populus Rhizosphere	PMSLLPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR*
Ga0114129_128831131	3300009147	Populus Rhizosphere	MPLPNQRMKLSARGGHTCRLNSILSVAAAGRSLCALR
Ga0114129_129217961	3300009147	Populus Rhizosphere	PNQRLKLSARGGRLVGKGSILIAAAAGRSLSAIR*
Ga0114129_129348661	3300009147	Populus Rhizosphere	PNQRLKLTARGGRLIGNRSILIAAAAGRSLSAIR*
Ga0114129_130182541	3300009147	Populus Rhizosphere	LKQDAVLPNQRLKLTARGGRLIVKGSILIAAAAGRSLSSIR
Ga0075423_100350531	3300009162	Populus Rhizosphere	LTCDLKLTARGGRLIGKRTVLSAAAAGRSLSAFR*
Ga0075423_100554311	3300009162	Populus Rhizosphere	PPMGLPNMRLKLTARGGRLRGNRLFLSAAAAGRSLSAIR*
Ga0075423_100948191	3300009162	Populus Rhizosphere	PNQRLKLTTRGGRLIEKESVLIAAAAGRSLSAIR*
Ga0075423_103671625	3300009162	Populus Rhizosphere	GQAPNQRLKLTARGGRLIGNRLFLSAAAAGRSLSAIR*
Ga0075423_127073172	3300009162	Populus Rhizosphere	MLPNQRLKLSGCGGRLKGNGSALIAAAATRSLSAIR*
Ga0126384_123438451	3300010046	Tropical Forest Soil	AGRVLANQRMKLTARGGRLIGNGLIFCAAAAGRSLCAIR*
Ga0134071_101248303	3300010336	Grasslands Soil	RYPPPNQRMKLTACRGHIWRNRSLLIVAAAGRSLSAIR*
Ga0126377_112087721	3300010362	Tropical Forest Soil	MKDLDNAPSNMRMKLSTRGGRVIGKGLLLSAAAAGRSLCAIR*
Ga0134123_116318521	3300010403	Terrestrial Soil	RVRGLCGLNCAQPNQRVKLSARGGHNGRKESVLSVAAAGRSLSAIR*
Ga0137393_117394811	3300011271	Vadose Zone Soil	GGARVRSHRGLNCALPNQRLKLMARGGRVIGKGSVLIAAAAGRGLSAIR*
Ga0137463_11154182	3300011444	Soil	SKVLPNQRLKLSARGGRLVGSSFVLSAAAAGRSLSAIR*
Ga0137383_101260103	3300012199	Vadose Zone Soil	MTLRPNMRLKLSARGGRLIGKGSVLLAAAAGRSLSAIR*
Ga0137382_100973213	3300012200	Vadose Zone Soil	MTLRPNQRMKLSASGGRFWRNRSIFSAAAAGRSLCAIR*
Ga0137365_102326121	3300012201	Vadose Zone Soil	PNMRLKLSARGGRLIGKGSVLLAAATGRSLSAIR*
Ga0137399_105546832	3300012203	Vadose Zone Soil	MAWICVDMLPNQRLKLTARGGRVVGDGSVLIAAAAGRSLSAIR*
Ga0137374_100123635	3300012204	Vadose Zone Soil	MRVLPNQRLKLSARGGRLRGKGSILIVAAAPHSLSAIR*
Ga0137374_101096572	3300012204	Vadose Zone Soil	MGRVRPNQRLKLSARGGRLIGKGSILIAAAAGRSLSASR*
Ga0137374_101585266	3300012204	Vadose Zone Soil	MYPVCTGMLPNQRMKLTARGGHIRRNRVTLSVAAAGRSLCAIR*
Ga0137374_103033021	3300012204	Vadose Zone Soil	TKRLPNQRMKLPACGGRLRGKGFVLIAAAAGRSLCAVR*
Ga0137374_103033023	3300012204	Vadose Zone Soil	MRVLLPNMRMKLAARGGRMMGNEFVLSAAAAGRSLCAIR*
Ga0137362_103553391	3300012205	Vadose Zone Soil	CALPNQRLKLSARGGRMIGKGSVLIAAAARRSLSAIR*
Ga0137380_100314724	3300012206	Vadose Zone Soil	VWLRAVRALPNERLNLTGLGGRLRGKGSILIVAAARRSLSAIR*
Ga0137381_100859951	3300012207	Vadose Zone Soil	MLLPPNQRLKLSARGGRLVGNEFVLSAAAAGRSLSA
Ga0137381_101017021	3300012207	Vadose Zone Soil	EVVVPRMSPPNQRMKLTARGGRVKRKKSFWSAAATGCSLCAIR*
Ga0137381_107217801	3300012207	Vadose Zone Soil	FRVSMLLPPNQRLKLSARGGRLVGNEFVLSAAAAGRSLSAIR*
Ga0137378_104886922	3300012210	Vadose Zone Soil	MTLRPNQRMKLSARGGRFWRNRSILSAAAAGRSLCAIR*
Ga0137434_10252311	3300012225	Soil	MLLPNRRINLSARGGRVAGNGSVLSAAAAGRSLCAI
Ga0137387_101497802	3300012349	Vadose Zone Soil	MTLRPNQRMNLSASGGRFWRNRSIFSAAAAGRSLCAIR*
Ga0137372_103989962	3300012350	Vadose Zone Soil	MSLDWRRPNKRLKLTARGGRLVGKASFLIAAGAGRSLSAIR*
Ga0137367_100947883	3300012353	Vadose Zone Soil	VTKRLPNQRMKLPACGGRLRGKGFVLIAAAAGRSLCAVR*
Ga0137367_112154501	3300012353	Vadose Zone Soil	IASLANQRLKLTARGGRLKGNWSVLSAAAAGRSLSAIR*
Ga0137369_106783322	3300012355	Vadose Zone Soil	GPVPSSPSNQRLKLTARGGRLRGKGSILIAAAAGRSLSAIC*
Ga0137375_103558874	3300012360	Vadose Zone Soil	RSGPRPVRPNQRLKLSARGGRLVGNGSVLLAAAAGRSLSAIR*
Ga0137390_101143774	3300012363	Vadose Zone Soil	MTALLTHPPNQRLKLSASGGRSKGNGFVLIAAAAGRSLSAIR*
Ga0137373_100643481	3300012532	Vadose Zone Soil	VAQPNQRLKLSARGGHTCWNRFILSVAAAGRSLSAIH*
Ga0137373_102233373	3300012532	Vadose Zone Soil	MAPNMRMKLTARGGRLKGNGLFLSAAAAGRSLCAIR*
Ga0137397_110889491	3300012685	Vadose Zone Soil	ALPNQRLNLTARGGRVIGKGSVLIAAPAGRSLSAIR*
Ga0137359_116514142	3300012923	Vadose Zone Soil	MASICVDMLPNQRLKLTARGGRVVGNGSVLIAAAAGRSLSAIR*
Ga0137404_120107313	3300012929	Vadose Zone Soil	LPNQRLKLTARGGRVVGNGSVLIAAAAGRSLSAIR*
Ga0153915_102540201	3300012931	Freshwater Wetlands	MLLPNQRLKLSARGGRLIGKGSLLIAAAAGRSLSAFR*
Ga0153915_128118372	3300012931	Freshwater Wetlands	RRPSNQRLKLAARGGRGKEKGFVLLAAAAGRSLSAIR*
Ga0153915_131049271	3300012931	Freshwater Wetlands	KWLPNLRLKLSARGGRLARNWSVLSAAAAGRSLSAIR*
Ga0134077_103787701	3300012972	Grasslands Soil	MRVQPNKRLKLSARGGRSTRERSFLSAAAAGRSLSAFR
Ga0180066_10061311	3300014873	Soil	MLPRVPNKRMKLAARGGRMVGIRSVLIAAAAGRSLSAIR*
Ga0137418_100397751	3300015241	Vadose Zone Soil	RGLNCALPNQRLKLSARGGRMIGKGSVLIAAAARRSLSAIR*
Ga0134112_102812831	3300017656	Grasslands Soil	TPSSERRVLPNMRLKLSARGGRLVGNGFVLSAAAAGRSLSAIR
Ga0134083_100159442	3300017659	Grasslands Soil	MSRSEPPNQRLKLSARGGRLVGNKVFLIAAAAGRSLSAIR
Ga0184626_102888831	3300018053	Groundwater Sediment	DVTPNQRLKLAARGGRLVGNGSVSSAAAAGRSLSAIR
Ga0184636_12113251	3300018068	Groundwater Sediment	MLRKLAPNQRLKLSARGGRLVGNESVLSAAAAGRSLSA
Ga0184627_103929962	3300018079	Groundwater Sediment	RHPNMRLKLSARGGRLIENGFVLSAAAAGRSLSAIR
Ga0184627_105865641	3300018079	Groundwater Sediment	HAVGVLPNQRMKLAARGGRVIGNSLFLSAAAAGRSLCAIR
Ga0184639_104847892	3300018082	Groundwater Sediment	AREQPPPNKRMKLSARGGHTCRTKSVLSVAAAGRSLCANR
Ga0184629_106076852	3300018084	Groundwater Sediment	LPNQRLKLSARGGRVVGNGSVLSAAAAGRSLSASR
Ga0184629_107051923	3300018084	Groundwater Sediment	VGASLGRVMPNQRLKLSACGGRSAGKGSVLSAAATG
Ga0066655_100114554	3300018431	Grasslands Soil	MPLNQRLKVLALGGRLIGNKVFLSAASAGRSLSAIR
Ga0066667_113865321	3300018433	Grasslands Soil	PRRRNMRVKLAAWGGRSVGKESLLIAAAPGRSLSAIR
Ga0066662_100704444	3300018468	Grasslands Soil	VVAWAQPNPRLKLSARGGRVIGSGSVLSAAAAGRSLSAIR
Ga0066669_102227881	3300018482	Grasslands Soil	RGLNCALPNQRLKLSARGGRMIGKGSILIAAAAGRSLSAIR
Ga0187894_105013551	3300019360	Microbial Mat On Rocks	LIRLRPNQRMKLTARGGRVKRNRSFVAAAATGCSLCAF
Ga0187892_102458782	3300019458	Bio-Ooze	PKSSRPNQRMKLSARGGRLRGMGFVMIAAAAGRSLCAVR
Ga0187892_103291871	3300019458	Bio-Ooze	MAKRPNQRMKLSARGGRVKRKQSFLSAAATGCSLCAIR
Ga0187892_103907931	3300019458	Bio-Ooze	MCWAVLPNQRMKLSARGGRVKRHPSFLAAAATGCSL
Ga0193733_10670293	3300020022	Soil	SHRGLNCALPNQRLKLTARGGRVIGKGSVLIAAAAGRSLSAIR
Ga0210379_102598132	3300021081	Groundwater Sediment	MDTLPNQRLKLSARGGRLIGKKSVLIAAAAGRSLSAIR
Ga0207646_112465722	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	LCGLNCALPNRRLKLSARGGHNCRKESILSVAAAGRSLSAIR
Ga0209234_10145626	3300026295	Grasslands Soil	VRNHRGLNRALPNQRLKLSARDGRMIGKSSVFIAAAAGCSLSAIR
Ga0209055_100251221	3300026309	Soil	VRSHRGLNCALPHQRLKPPARGGRVIGKGSVLIAAAAGRSLSASR
Ga0209055_10250513	3300026309	Soil	VRNHRGLNCALPSQRLKLSACGGRMIGKDSVLIAAAAGRSLCAIR
Ga0209153_10854812	3300026312	Soil	VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR
Ga0209471_10040192	3300026318	Soil	VRNHRGLNCALPSQRLKLSACGGRMIGKDSVLIAAAAGRSLSAIR
Ga0209471_12638102	3300026318	Soil	SSEHSVLPNMRLKLAARGGRLIEKASFLIAAAAGRSLSAIR
Ga0209802_11340353	3300026328	Soil	PLNQRLKLSARGGRLVGNGSVLSAAAAGRSLSAIR
Ga0209158_12825833	3300026333	Soil	STGGARVRNHCGLNCALPNQRLKLSARGGRMIGKGSVLIAAAADHSLSAIR
Ga0209159_11354872	3300026343	Soil	VRNHRGLNCALPNQRLKLSARGGRMIGKGSVLIAPAAGRSLSAIR
Ga0209160_12201601	3300026532	Soil	MYPVCTGLLPNPPMKLSARGGRSVRNRSVLSAAAAGRSLW
Ga0209056_100082519	3300026538	Soil	MGAIPRQDRLPNQRLKLSACGGRLIRNWSVLSAAAAGRSLSAIR
Ga0209474_100795184	3300026550	Soil	PGLYRVAPNLRMKLSARGGRLVRNWSFLSAAAAGRSLCAIR
Ga0209577_102521223	3300026552	Soil	GLNCALPNQRLKLSARGGRMIGKGSVLIAAAAGRSLSAIR
Ga0209869_10131872	3300027187	Groundwater Sand	RVPDLLTMCKLPNQRLKLSGGGGRPKGNGSLLIAAAAPRSLSAIR
Ga0209180_100133123	3300027846	Vadose Zone Soil	VRSHRGLNCALPNQRLKLMARGGRVIGKGSVLIAAAAGRGLSAIR
Ga0209814_100242612	3300027873	Populus Rhizosphere	MSIGCTKVPPNQRLKLSARGGRVIGKWSVLSAAAAGRSLSAIR
Ga0209814_100313175	3300027873	Populus Rhizosphere	VIAPSNQRLKLSARGGRLIGKGSILSAAAAGRSLSAIR
Ga0209814_100329804	3300027873	Populus Rhizosphere	MGLPNMRLKLTARGGRLIGNRSVLSAAAAGRSLSAIR
Ga0209814_100829243	3300027873	Populus Rhizosphere	LGGPLDQTRSGPSGPPNMRLKLTARGGRLRGKRSILIAAAAGRSLSAIR
Ga0209814_101226951	3300027873	Populus Rhizosphere	ERPNQRLKLTARGGRLMGNGSILSAAAAGCSLSAIR
Ga0209814_101897691	3300027873	Populus Rhizosphere	CDKVQPNMRLKLPARGGRLVGHKSFLSTAAAGRSLSAIR
Ga0209814_104455452	3300027873	Populus Rhizosphere	MALSNKRLKLAARGGRLIGKESLLVAAAAGRSLSAIR
Ga0209283_106339532	3300027875	Vadose Zone Soil	MYQGPPNQRLKLSARGGRPGGTESVLSAAAAGRSL
Ga0209481_100751371	3300027880	Populus Rhizosphere	TYVLTNRLCSGGLPNQRLKLTARGGRLIGKGSVLIAAAAGRSLSAIR
Ga0209481_101114333	3300027880	Populus Rhizosphere	MSLLPNQRLKLSARGGRLIGKRSVLSAAAAGRSLSAIR
Ga0209481_103799452	3300027880	Populus Rhizosphere	LPVKQPPNQRMKLSARGGRLIGNWSILSAAAAGRSLCAIR
Ga0209481_104422612	3300027880	Populus Rhizosphere	RMGGEPPNQRLKLPARGGRLVGHKSFLSTAAAGRSLSAIR
Ga0209481_106881951	3300027880	Populus Rhizosphere	HRLRPNQRLKLTARSGRVVGKGSILSAAAAGRSLSAIR
Ga0209590_102212411	3300027882	Vadose Zone Soil	RVSMLLPPNQRLKLSARGGRLVRNEFVLSAAAAGRSLSAIR
Ga0209488_104523363	3300027903	Vadose Zone Soil	VRSHRGLNCALPNQGLKLMARGGRVIGKGSVLIAAAAGRGLSAIR
Ga0209382_1001926711	3300027909	Populus Rhizosphere	MVRGLPRQPNMRLKLTARGGRVLGNESVLSAAAAGRSLSAIR
Ga0209382_100852296	3300027909	Populus Rhizosphere	MLRPNQRLKLTARGGRLVGNRSVLSAAAAGRSLSAIR
Ga0209382_101119405	3300027909	Populus Rhizosphere	MLIAMPPANQRLKLTARGGRLMRNSSVLSAAAAGRSLSAIR
Ga0209382_101510885	3300027909	Populus Rhizosphere	VIVGLPNQRLKLTARGGRVIGNWSILCAAATGRSLSAIR
Ga0209382_101719977	3300027909	Populus Rhizosphere	VRGRRGLTYALPNQRLKLTARGGRLIGKRSILSAAAAGRSLSAIR
Ga0209382_105068723	3300027909	Populus Rhizosphere	ILARAPANMRLKLTARGRRLVGNGSVFSAAAAGRSLSAIR
Ga0209382_112771013	3300027909	Populus Rhizosphere	RPNQRLKLTARGGRLIGNWSILIAAAAGRSLSAIR
Ga0137415_100702733	3300028536	Vadose Zone Soil	VRSHRGLNCALPNQRLKLTARGGRVIGKGSVLIAAAAGRSLRAIR
Ga0137415_113625482	3300028536	Vadose Zone Soil	MAWICVDMLPNQRLKLTARGGRVVGDGSVLIAAAAGRSLSAIR
Ga0307281_104336401	3300028803	Soil	PAGKVLPNQRLKLSARGGRLVGNKSVLSAAAAGRSLSAIR
Ga0214473_109931181	3300031949	Soil	MVPPNQRMKLSARGGRLVGNRSVLSAAAAGRSLCAIR
Ga0335085_100359047	3300032770	Soil	MLPPNLRLKLSARGGRSIEERLFLSAAAAGRSLSASR
Ga0335085_100359049	3300032770	Soil	MCCLKLPPNLRLKLSARGGRAIRERSFLSAAAAGRSLSAFR
Ga0335085_101418162	3300032770	Soil	MPSVRLCLPPNLRLKLAARGGRAIKERSFLSAAAAGRSLSASR
Ga0335085_101526716	3300032770	Soil	MPSLPVCLLPNLRLKLSARGGRSIKEWSFLSAAAAGRSLSAFR
Ga0335085_101934722	3300032770	Soil	MMALPNLRLKLSARGGRSIKEVVFLIAAAAGRSLSASR
Ga0335085_106158933	3300032770	Soil	TRNERPSNLRLKLSARGGRAITERFFLSAAAAGRSLSAFR
Ga0335085_106249582	3300032770	Soil	MMAFARALPWQPNLRLKLSARGGRVGWNTFILSAAAAGRSLSASR
Ga0335085_122819852	3300032770	Soil	LPNLRLKLSARGGRTIKELLLLIAAAAGRSLSASR
Ga0335082_103303453	3300032782	Soil	MALPNLRLKLSARGGRTIKELLLLIAAAAGRSLSASR
Ga0335082_103741471	3300032782	Soil	RPLTPPNWRLKLSARGGRLIRELIFLIAAAAGRSLSASR
Ga0335082_109475871	3300032782	Soil	AAFLWLIAVRPNLRLKLPARGGRAIKERSFLSAAAAGRSLSAFR
Ga0335082_110875061	3300032782	Soil	MVCHVLPNWRLKLAARGGRSIKERSFLIAAAAGRSLSASRYAA
Ga0335082_115511411	3300032782	Soil	MPSLPVCLLPNLRLKLSARGGRSIKEWSFLSAAAAGRSLSASR
Ga0310810_114141981	3300033412	Soil	VKRVPNLRLKLSARGGRLVGNGSVLSAAAAGRSLSA
Ga0310810_114141982	3300033412	Soil	MPPPNQRLKLTARGGRLIGKWSILSAAAAGRSLSAIR
Ga0326726_100093061	3300033433	Peat Soil	LPNLRLKLSARGGRLKGKGSVLIAAAAGRSLSAIR
Ga0326726_100651876	3300033433	Peat Soil	MMAGEPPNQRLKLSARGGRLVGKGSVLIAAAAGRSLSAIR
Ga0326726_103637201	3300033433	Peat Soil	TSSEAPPNQRLKLSARGGRVVGNGFILSAAAAGRSLSAIR
Ga0326726_107423371	3300033433	Peat Soil	MLRPDLRLKLSARGGRLVENWFVLIAAAAGRSLSAIR
Ga0326726_112938981	3300033433	Peat Soil	NALSSNTWLPNPRLKLSGCGGRLKGKGSVLIAAAAPRSLSAIR
Ga0326726_117057621	3300033433	Peat Soil	VTKRLPNLRLKLSARGGRVVGNWIYLSAAAAGRSLSAIR
Ga0326730_10122885	3300033500	Peat Soil	VPPNQRLKLSARGGRLKGKGSILIAAAAGRSLSAIR
Ga0316628_1017188771	3300033513	Soil	VGQLAIGPPPNQRLKLAARGGRLVGNWSILSAAAAGRSLSAIR
Ga0364924_004058_292_414	3300033811	Sediment	MVAWAQPDPRLKLAARGGHVVGNGSVLSAAAAGRSLCANR
Ga0364924_007166_1059_1169	3300033811	Sediment	MPPNQRLKLSARGGRLIGKESLLIAAAAGRSLSATR
Ga0364926_140997_1_135	3300033812	Sediment	RRGLSTQKVAAYQRMKLSARGGRLVGNSSFLSAAAAGRSLSAFR
Ga0326723_0010760_178_291	3300034090	Peat Soil	MTLPNQRLKLSARGGHTCRKKSVLSVAAAGRSLSAIR
Ga0326723_0014398_2723_2836	3300034090	Peat Soil	MALPNQRLKLSARGGRLKGKDSFLLAAAAGRSLSAIR
Ga0326723_0155540_1_117	3300034090	Peat Soil	AGALPNQRLKLSVRGGRSVGNESVLIAAAAGRSLSAIR
Ga0326723_0284453_2_115	3300034090	Peat Soil	ALTSNMRLKLSAWGGRLVGNGSLLIAAAPGRSLSATR
Ga0326723_0434491_1_117	3300034090	Peat Soil	ARWLPNLRLKLSAGGGRLIAKGSVLIAAAAGRSLSAVR
Ga0364942_0125895_2_112	3300034165	Sediment	WQSNQRLKLSARGGRVVGNRVFLSAAATGCSLCAFR
Ga0364936_001106_2_124	3300034773	Sediment	VHGSEAPYQRMKLSARGGRLMRTWSVLIAAAAGRSLCAVR
Ga0364936_120481_393_527	3300034773	Sediment	VTCGAQVRQLPSKGMKLAARGGRVGGNGFVLSAAAAGRSLSAIR
Ga0373948_0053954_761_868	3300034817	Rhizosphere Soil	PPNQRLKLPARGGRVRGTGSILIAAATGRSLSAIR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.24
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.24
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F012237

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign