Basic Information | |
---|---|
Family ID | F012260 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 282 |
Average Sequence Length | 46 residues |
Representative Sequence | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPEGLTRADPHLQITDNY |
Number of Associated Samples | 206 |
Number of Associated Scaffolds | 282 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 53.19 % |
% of genes near scaffold ends (potentially truncated) | 99.65 % |
% of genes from short scaffolds (< 2000 bps) | 93.26 % |
Associated GOLD sequencing projects | 185 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.745 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.284 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.972 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.284 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.69% β-sheet: 3.90% Coil/Unstructured: 84.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 282 Family Scaffolds |
---|---|---|
PF11138 | DUF2911 | 22.70 |
PF13784 | Fic_N | 4.26 |
PF07676 | PD40 | 2.13 |
PF04255 | DUF433 | 1.77 |
PF16277 | DUF4926 | 1.42 |
PF12870 | DUF4878 | 1.42 |
PF13453 | zf-TFIIB | 1.42 |
PF00072 | Response_reg | 1.06 |
PF13857 | Ank_5 | 1.06 |
PF01927 | Mut7-C | 0.71 |
PF01431 | Peptidase_M13 | 0.71 |
PF07995 | GSDH | 0.71 |
PF00330 | Aconitase | 0.71 |
PF05649 | Peptidase_M13_N | 0.71 |
PF13411 | MerR_1 | 0.71 |
PF10417 | 1-cysPrx_C | 0.71 |
PF12704 | MacB_PCD | 0.35 |
PF02687 | FtsX | 0.35 |
PF08241 | Methyltransf_11 | 0.35 |
PF01548 | DEDD_Tnp_IS110 | 0.35 |
PF07690 | MFS_1 | 0.35 |
PF00370 | FGGY_N | 0.35 |
PF13193 | AMP-binding_C | 0.35 |
PF12277 | DUF3618 | 0.35 |
PF01979 | Amidohydro_1 | 0.35 |
PF13910 | DUF4209 | 0.35 |
PF02371 | Transposase_20 | 0.35 |
PF13174 | TPR_6 | 0.35 |
PF01565 | FAD_binding_4 | 0.35 |
PF01850 | PIN | 0.35 |
PF13591 | MerR_2 | 0.35 |
PF01894 | UPF0047 | 0.35 |
PF13176 | TPR_7 | 0.35 |
PF13086 | AAA_11 | 0.35 |
PF01944 | SpoIIM | 0.35 |
PF00576 | Transthyretin | 0.35 |
PF02518 | HATPase_c | 0.35 |
COG ID | Name | Functional Category | % Frequency in 282 Family Scaffolds |
---|---|---|---|
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.77 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 1.42 |
COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.71 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.71 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.35 |
COG1300 | Stage II sporulation protein SpoIIM, component of the engulfment complex | Cell cycle control, cell division, chromosome partitioning [D] | 0.35 |
COG2351 | 5-hydroxyisourate hydrolase (purine catabolism), transthyretin-related family | Nucleotide transport and metabolism [F] | 0.35 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.74 % |
Unclassified | root | N/A | 4.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2040502000|ACOD_FV90NF402IA6X2 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
2140918013|NODE_2893_length_1276_cov_9.199059 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
2162886013|SwBSRL2_contig_935048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
2228664022|INPgaii200_c1157703 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0604950 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 791 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_11044594 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 791 | Open in IMG/M |
3300000559|F14TC_102773833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300000559|F14TC_112598752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300000953|JGI11615J12901_10375742 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300000956|JGI10216J12902_111986813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Phototrophicales → unclassified Phototrophicales → Phototrophicales bacterium | 853 | Open in IMG/M |
3300002120|C687J26616_10054642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1375 | Open in IMG/M |
3300003267|soilL1_10015583 | All Organisms → cellular organisms → Bacteria | 13865 | Open in IMG/M |
3300003999|Ga0055469_10035871 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300004114|Ga0062593_102353304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 600 | Open in IMG/M |
3300004114|Ga0062593_102400222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 595 | Open in IMG/M |
3300004156|Ga0062589_100643434 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300004157|Ga0062590_101914981 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300004479|Ga0062595_101486811 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300004480|Ga0062592_101185922 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300004779|Ga0062380_10169702 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300005177|Ga0066690_10630340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300005187|Ga0066675_10553557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
3300005290|Ga0065712_10750059 | Not Available | 529 | Open in IMG/M |
3300005293|Ga0065715_10595235 | Not Available | 696 | Open in IMG/M |
3300005294|Ga0065705_10781065 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300005295|Ga0065707_10374043 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300005295|Ga0065707_10951653 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300005338|Ga0068868_101467991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300005340|Ga0070689_100279387 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
3300005340|Ga0070689_101704268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300005343|Ga0070687_100895709 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300005367|Ga0070667_101862071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300005406|Ga0070703_10074687 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300005434|Ga0070709_10514761 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300005438|Ga0070701_10294367 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300005438|Ga0070701_10421445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
3300005438|Ga0070701_10507213 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300005438|Ga0070701_11240170 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300005440|Ga0070705_100888560 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300005441|Ga0070700_101593619 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005441|Ga0070700_101876466 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300005444|Ga0070694_100487978 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300005457|Ga0070662_101030580 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300005459|Ga0068867_100208888 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
3300005459|Ga0068867_100274369 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300005459|Ga0068867_100950015 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300005459|Ga0068867_102060021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300005467|Ga0070706_100647663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
3300005518|Ga0070699_101376673 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300005536|Ga0070697_100186748 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
3300005545|Ga0070695_100285476 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300005545|Ga0070695_100433262 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300005546|Ga0070696_101125859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300005547|Ga0070693_100868197 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300005547|Ga0070693_101367275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300005549|Ga0070704_101790120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300005549|Ga0070704_101930441 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005559|Ga0066700_10615488 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300005563|Ga0068855_101820102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300005564|Ga0070664_100502031 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300005566|Ga0066693_10404030 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005577|Ga0068857_102197668 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005578|Ga0068854_100402903 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300005615|Ga0070702_101061190 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300005616|Ga0068852_101465660 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300005616|Ga0068852_101506878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300005616|Ga0068852_101544567 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300005616|Ga0068852_102579264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium | 528 | Open in IMG/M |
3300005617|Ga0068859_101902039 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300005618|Ga0068864_100253582 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
3300005719|Ga0068861_102682434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300005840|Ga0068870_11083979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300005841|Ga0068863_100249903 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
3300005842|Ga0068858_101975573 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300005843|Ga0068860_100706992 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300005844|Ga0068862_101513551 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300006173|Ga0070716_100770556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300006618|Ga0101566_10497138 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300006755|Ga0079222_10041927 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
3300006755|Ga0079222_11880188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300006796|Ga0066665_10807251 | Not Available | 739 | Open in IMG/M |
3300006797|Ga0066659_10900689 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300006845|Ga0075421_100744808 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300006845|Ga0075421_101816937 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300006845|Ga0075421_102282529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300006846|Ga0075430_100661305 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300006852|Ga0075433_10256238 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
3300006852|Ga0075433_11860504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300006854|Ga0075425_102374058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300006880|Ga0075429_100546396 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300006894|Ga0079215_11535524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300006918|Ga0079216_10373957 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300006918|Ga0079216_11612419 | Not Available | 549 | Open in IMG/M |
3300006954|Ga0079219_10193941 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300007265|Ga0099794_10740846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300009089|Ga0099828_11267465 | Not Available | 653 | Open in IMG/M |
3300009094|Ga0111539_10392433 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
3300009094|Ga0111539_12257335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300009100|Ga0075418_10968268 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300009101|Ga0105247_10820834 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300009137|Ga0066709_100683753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1473 | Open in IMG/M |
3300009137|Ga0066709_102248240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
3300009137|Ga0066709_102754667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 654 | Open in IMG/M |
3300009162|Ga0075423_12912823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300009176|Ga0105242_10025985 | All Organisms → cellular organisms → Bacteria | 4637 | Open in IMG/M |
3300009176|Ga0105242_10618669 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300009177|Ga0105248_11178232 | Not Available | 866 | Open in IMG/M |
3300009177|Ga0105248_11275520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
3300009177|Ga0105248_12777328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300009545|Ga0105237_12246916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300009553|Ga0105249_13592630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300009789|Ga0126307_10705473 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300009840|Ga0126313_10401095 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300010036|Ga0126305_10125172 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae | 1574 | Open in IMG/M |
3300010040|Ga0126308_10912268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300010042|Ga0126314_11436644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300010047|Ga0126382_10007961 | All Organisms → cellular organisms → Bacteria | 4942 | Open in IMG/M |
3300010320|Ga0134109_10449587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300010326|Ga0134065_10377950 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300010329|Ga0134111_10545713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300010371|Ga0134125_10745374 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300010375|Ga0105239_11460023 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300010399|Ga0134127_10400827 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300010399|Ga0134127_10748212 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300010399|Ga0134127_11029995 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300010399|Ga0134127_11332359 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300010399|Ga0134127_12673270 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300010399|Ga0134127_13311128 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300010400|Ga0134122_11855432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300010400|Ga0134122_13096008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300010401|Ga0134121_10206951 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
3300010401|Ga0134121_10327859 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300010403|Ga0134123_10236539 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
3300010403|Ga0134123_12930886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300010403|Ga0134123_13299113 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300011003|Ga0138514_100019129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1213 | Open in IMG/M |
3300011119|Ga0105246_11722492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300011269|Ga0137392_10306714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
3300011269|Ga0137392_11010102 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300011271|Ga0137393_10281894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1413 | Open in IMG/M |
3300011333|Ga0127502_11350157 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300011431|Ga0137438_1249946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300012189|Ga0137388_10829881 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300012199|Ga0137383_10062076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2683 | Open in IMG/M |
3300012199|Ga0137383_11222614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300012202|Ga0137363_11265955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300012202|Ga0137363_11710879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300012206|Ga0137380_10490548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
3300012211|Ga0137377_10294160 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300012212|Ga0150985_110904178 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300012212|Ga0150985_118713936 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300012350|Ga0137372_10916253 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300012353|Ga0137367_10362011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1031 | Open in IMG/M |
3300012354|Ga0137366_10570468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 813 | Open in IMG/M |
3300012357|Ga0137384_10861207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
3300012360|Ga0137375_10690623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300012362|Ga0137361_10607479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
3300012362|Ga0137361_10847128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
3300012362|Ga0137361_11479977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 601 | Open in IMG/M |
3300012362|Ga0137361_11602872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300012362|Ga0137361_11885925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300012469|Ga0150984_104774680 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300012681|Ga0136613_10149982 | Not Available | 1329 | Open in IMG/M |
3300012685|Ga0137397_10192284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1517 | Open in IMG/M |
3300012896|Ga0157303_10289069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300012918|Ga0137396_10447644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
3300012918|Ga0137396_10557795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
3300012922|Ga0137394_10512720 | Not Available | 1018 | Open in IMG/M |
3300012923|Ga0137359_10083266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2810 | Open in IMG/M |
3300012923|Ga0137359_10464220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1119 | Open in IMG/M |
3300012944|Ga0137410_11755573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300012948|Ga0126375_10961107 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300012948|Ga0126375_11872727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300012951|Ga0164300_11006737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300012955|Ga0164298_10177619 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300012971|Ga0126369_12027849 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300013100|Ga0157373_10775516 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300013102|Ga0157371_11299431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 563 | Open in IMG/M |
3300013297|Ga0157378_10089238 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2799 | Open in IMG/M |
3300013297|Ga0157378_10967584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
3300013297|Ga0157378_11812877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300013297|Ga0157378_11858253 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300013308|Ga0157375_10512150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
3300013308|Ga0157375_10630206 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300013308|Ga0157375_12100308 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300014325|Ga0163163_10737184 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300014325|Ga0163163_11439709 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300014325|Ga0163163_11730819 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300015261|Ga0182006_1201778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300015371|Ga0132258_11637473 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
3300015371|Ga0132258_13519432 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300015372|Ga0132256_103431221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300015373|Ga0132257_100212310 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
3300015373|Ga0132257_101902100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300015374|Ga0132255_105266315 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300017659|Ga0134083_10134301 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300018027|Ga0184605_10264571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
3300018027|Ga0184605_10319406 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300018027|Ga0184605_10326818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
3300018054|Ga0184621_10269801 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300018061|Ga0184619_10150525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
3300018072|Ga0184635_10021253 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 2383 | Open in IMG/M |
3300018082|Ga0184639_10003950 | All Organisms → cellular organisms → Bacteria | 6750 | Open in IMG/M |
3300018084|Ga0184629_10488948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300018429|Ga0190272_12233583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300018466|Ga0190268_11688138 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 564 | Open in IMG/M |
3300018469|Ga0190270_13243847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300018476|Ga0190274_10386400 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300018482|Ga0066669_10203814 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300018482|Ga0066669_10220541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1472 | Open in IMG/M |
3300018920|Ga0190273_11199739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300018920|Ga0190273_12146402 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300020008|Ga0193757_1025094 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300020009|Ga0193740_1016915 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300021081|Ga0210379_10434937 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300022756|Ga0222622_11425700 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300024325|Ga0247678_1067142 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300025313|Ga0209431_10620925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 808 | Open in IMG/M |
3300025325|Ga0209341_10235792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1522 | Open in IMG/M |
3300025900|Ga0207710_10012874 | All Organisms → cellular organisms → Bacteria | 3523 | Open in IMG/M |
3300025907|Ga0207645_10600814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300025913|Ga0207695_11499642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300025923|Ga0207681_10637382 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300025925|Ga0207650_11254308 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300025930|Ga0207701_10661877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 886 | Open in IMG/M |
3300025930|Ga0207701_11443004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300025933|Ga0207706_10465284 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300025933|Ga0207706_10554745 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300025933|Ga0207706_11484176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300025934|Ga0207686_10521505 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300025935|Ga0207709_10696429 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300025936|Ga0207670_10863842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
3300025941|Ga0207711_11272999 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300025942|Ga0207689_10065829 | All Organisms → cellular organisms → Bacteria | 2980 | Open in IMG/M |
3300025942|Ga0207689_10516412 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300025960|Ga0207651_10973866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300025981|Ga0207640_11871865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 543 | Open in IMG/M |
3300025986|Ga0207658_10923434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
3300025986|Ga0207658_12047960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300026023|Ga0207677_12089085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300026078|Ga0207702_11134043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
3300026088|Ga0207641_10201612 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
3300026088|Ga0207641_11391665 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300026095|Ga0207676_11266301 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300026095|Ga0207676_11684143 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300026095|Ga0207676_11762860 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300026116|Ga0207674_10183625 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
3300026116|Ga0207674_11317584 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300026142|Ga0207698_12464854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300026309|Ga0209055_1243518 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300026313|Ga0209761_1147809 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300026317|Ga0209154_1135296 | Not Available | 1035 | Open in IMG/M |
3300026542|Ga0209805_1366146 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300027018|Ga0208475_1028362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300027326|Ga0209731_1001431 | All Organisms → cellular organisms → Bacteria | 2581 | Open in IMG/M |
3300027637|Ga0209818_1058242 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300027637|Ga0209818_1164897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300027787|Ga0209074_10054986 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300027840|Ga0209683_10100501 | Not Available | 1306 | Open in IMG/M |
3300027843|Ga0209798_10039801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2476 | Open in IMG/M |
3300027876|Ga0209974_10403011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300027907|Ga0207428_10149727 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
3300027909|Ga0209382_10128477 | All Organisms → cellular organisms → Bacteria | 2950 | Open in IMG/M |
3300027909|Ga0209382_11724828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300028047|Ga0209526_10081408 | All Organisms → cellular organisms → Bacteria | 2280 | Open in IMG/M |
3300028380|Ga0268265_12467702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300028381|Ga0268264_10244491 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
3300028381|Ga0268264_11697112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300028802|Ga0307503_10698008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300028802|Ga0307503_10800040 | Not Available | 538 | Open in IMG/M |
3300031152|Ga0307501_10012534 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300031229|Ga0299913_10634400 | Not Available | 1049 | Open in IMG/M |
3300031538|Ga0310888_10027061 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
3300031538|Ga0310888_10911353 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300031740|Ga0307468_102482407 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300031913|Ga0310891_10221785 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300031943|Ga0310885_10168212 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300032126|Ga0307415_100008481 | All Organisms → cellular organisms → Bacteria | 5700 | Open in IMG/M |
3300032174|Ga0307470_10936067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300032174|Ga0307470_11215267 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300032180|Ga0307471_101864857 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300034417|Ga0364941_206425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.28% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.32% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.32% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.26% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.19% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.19% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.13% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.13% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.13% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.42% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.42% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.42% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.42% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.77% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.77% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.77% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.06% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.06% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.06% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.06% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.35% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.35% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.35% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.35% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.35% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.35% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.35% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.35% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.35% |
Fungus Garden | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden | 0.35% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.35% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.35% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.35% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.35% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.35% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2040502000 | Fungus garden microbial communities from Atta colombica in Panama - dump bottom | Host-Associated | Open in IMG/M |
2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006618 | Soil microbial communities from the Leymus chinensis steppe, China - without N addition | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ACODB_1450430 | 2040502000 | Fungus Garden | MGVAKLTETNTIVPESKYARLERERRFVLEDLPEGINRADSHFQITDNYITGSR |
Iowa-Corn-GraphCirc_02592490 | 2140918013 | Soil | MGVAKLTDTNTIVPDSKYALIERERRFLLEDLPAGLSRADSHTPITD |
SwBSRL2_0352.00004780 | 2162886013 | Switchgrass Rhizosphere | MGVAKLTELNTVVPESKYARIERERRYLLPDLPEGLTRADHHLQITDNYITGT |
INPgaii200_11577031 | 2228664022 | Soil | MGVAKLTDQNTIVPESKYARIERERRYLLKDLPEGLSRVDPHLQITDNYITGTRLRIRK |
ICChiseqgaiiDRAFT_06049503 | 3300000033 | Soil | MGVAKLTEQNTVVPESKYARVERERRYLLKDLPEGLTRA |
ICChiseqgaiiFebDRAFT_110445943 | 3300000363 | Soil | MGVAKLTEQNTVVPESKYARVERERRYLLKDLPEGLTRAD |
F14TC_1027738331 | 3300000559 | Soil | MGVAKLTDQNTIVPESKYGRIERERRYLLKDLPVGMTRADDHLQITDNYITG |
F14TC_1125987521 | 3300000559 | Soil | MGVAKLTDLNTIVPDSKYARVERERRYLLQDLPEGLTRADHHLQIT |
JGI11615J12901_103757422 | 3300000953 | Soil | MGVAKLTDQNTIVPDSKYARVERERRYLLKDLPEGLTRAD |
JGI10216J12902_1119868133 | 3300000956 | Soil | MGVAKLTDQNTVLPANSKYARVERERRYLLQDLPEGLTRA |
C687J26616_100546423 | 3300002120 | Soil | MGVAKLTEQNTVLPDSKYARLELERKYLLQDLPLGL |
soilL1_1001558318 | 3300003267 | Sugarcane Root And Bulk Soil | MGVAKLTDQNTIVPESKYARLERERRYLLRDLPEGITRADPHVQITDNYIT |
Ga0055469_100358711 | 3300003999 | Natural And Restored Wetlands | MGEAKLTDQNTIVPESKYARVERERRYLLADLPEGLTRADP |
Ga0062593_1023533042 | 3300004114 | Soil | MGVAKLTDQNTVLPAESKYACVERERRFLLEDLPEGLTRASPHFQI |
Ga0062593_1024002221 | 3300004114 | Soil | MGVAKLTDQNTVLPAESKYACVERERRFLLEDLPEGLTRAS |
Ga0062589_1006434341 | 3300004156 | Soil | MGVAKLTDQNTIVPESKYARIERERRYLLQDLPEGLSRADHHLQITDNYISGTRLR |
Ga0062590_1019149812 | 3300004157 | Soil | VFIRETRGLFLFMGVAKLTDQNTVVPESKYARIERERRYLLRDLPEGITRADPHLQITDNYI |
Ga0062595_1014868112 | 3300004479 | Soil | MGVAKLTTQNTIVPESKYARVERERRYLLQDLPEGVSRADHHL |
Ga0062592_1011859221 | 3300004480 | Soil | MGVAKLTDQNTIVPESKYARLERERRYLLQDLPEGITRADPH |
Ga0062380_101697023 | 3300004779 | Wetland Sediment | MGVAKLTDQNTVVPDSKYARTERERRYLLPDLPAGLTRADHHLQITDNYITGTRLRIRK |
Ga0066690_106303401 | 3300005177 | Soil | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPAGLNRADHHLQITDNY |
Ga0066675_105535572 | 3300005187 | Soil | MGVAKLTDQNTIVPESKYARIERERRYLLQDLPEGLGRAD |
Ga0065712_107500591 | 3300005290 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLQDLPEGLARTDP |
Ga0065715_105952351 | 3300005293 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYARVERERRYLLQDLPEGVSRAD |
Ga0065705_107810652 | 3300005294 | Switchgrass Rhizosphere | MGVAKLTDQNTVVPESKYARVERERTYLLRDLPEGITRADPHIQITDNYMTGSR |
Ga0065707_103740431 | 3300005295 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLSDLPEGITRPDPHLQITDNYITG |
Ga0065707_109516531 | 3300005295 | Switchgrass Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLRDLPEGLTRVDPHLQITDNYITGTRLR |
Ga0068868_1014679911 | 3300005338 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYAKVERERRYLLRDLPEGVNRADPHLQITDNYITGTRL |
Ga0070689_1002793871 | 3300005340 | Switchgrass Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLRDLPEGLTRADPHLQITDNYMTGSRL |
Ga0070689_1017042681 | 3300005340 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYARLERERRYLLQDLPEGLTRADHHLQITDNYI |
Ga0070687_1008957092 | 3300005343 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPEGLTRADPHLQITDNYITG |
Ga0070667_1018620711 | 3300005367 | Switchgrass Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLKDLPEGMSRTDPHLQ |
Ga0070703_100746871 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPEGITRADPHLQIT |
Ga0070709_105147612 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYAHIERERRYLLQNLPEGLSRADHHLQITDN |
Ga0070701_102943671 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYARLERERRYLLQDLPEGLTRADH |
Ga0070701_104214452 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDLNTILPESKYARIERERRYLLRDLPEGLGRADHHLQITD |
Ga0070701_105072131 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVAKLTEHNTITPDSKYARIERERRYLLRDLPEGMSRTDPHLQITDNY |
Ga0070701_112401702 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYARVERERRYLLQDLPEGITRADPHLQITDNYITGTR |
Ga0070705_1008885601 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTELNTVIPESKYARVERERRYLLQDLPEGLTRADHHLQITDNYITGTRL |
Ga0070700_1015936191 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTIVPDSKYARIERERRYLLRDLPEGITRADPHLQITDNYIT |
Ga0070700_1018764662 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVARLTDQNTIVPESKYARIERERRYLLEDLPEGMTRADHHL |
Ga0070694_1004879782 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTIVPDSKYARIERERRYLLRDLPEGLARTDPHVQI |
Ga0070662_1010305802 | 3300005457 | Corn Rhizosphere | MGVAKLTDENTIVPESKYARVERERRYLLRDLPEGMSRADPHLQITD |
Ga0068867_1002088881 | 3300005459 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPDSKYARVERERRYLLRDLPEGMTRADPHLQITDNYM |
Ga0068867_1002743692 | 3300005459 | Miscanthus Rhizosphere | MGVAKLTDQNTVLPAESKYACVERERRFLLEDLPEGLTRASPH |
Ga0068867_1009500152 | 3300005459 | Miscanthus Rhizosphere | MGVAKLTDQNTVVPESKYARIERERRYLLEDLPDGMTRADHHLQITDNYITGTRLR |
Ga0068867_1020600211 | 3300005459 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYAKVERERRYLLRDLPEGVNRADPHLQITDNYI |
Ga0070706_1006476633 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTIVPAASKYARMERERRYLLQDLPEGLTRASPHVQITDNY |
Ga0070699_1013766732 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVAKLTQQNTIVPESKYARVERERRYLLQDLPAGLSRADDHLQITDNYLTG |
Ga0070697_1001867481 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTELNTIVPESRYARIERERRYLLQDLPEGLTRADHHLQITDNY |
Ga0070695_1002854762 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LGVAKLTDENTIVPESKYARVERERRYLLPDLPQGLTRADPHLQITDNYITGT |
Ga0070695_1004332621 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTVVPESKYARIERERRYLLRDLPEGITRADP |
Ga0070696_1011258591 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTILPDSKYARIERERRYLLQDLPEGLARTDPHVQITDN |
Ga0070693_1008681972 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPEGITRADPHLQITDNYITGTR |
Ga0070693_1013672752 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGAKLTDLNTVVPDSKYARVERERRYLLPDLPEGLTRADHHLQITDNY |
Ga0070704_1017901202 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTIVPDSKYARIERERRYLLQDLPEGLARNDPHVQITDNYITGT |
Ga0070704_1019304411 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTLVPDSKYAHVERERRYLLEDLPEGLTRVEHHLQI |
Ga0066700_106154882 | 3300005559 | Soil | MGVAKLTDQNTIVPESKYAQVERERRYLLEDLPEGLSRAEHHLQITD |
Ga0068855_1018201022 | 3300005563 | Corn Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLRDLPEGL |
Ga0070664_1005020311 | 3300005564 | Corn Rhizosphere | MGVAKLTEQNTVVPDSKYARVERERRYLLKDLPEGLARADPHLQITDNYITGTRLR |
Ga0066693_104040301 | 3300005566 | Soil | MGVAKLTNQNVVIPESKYARVERERRYLLRDLPEGLTRADHHLQIT |
Ga0068857_1021976681 | 3300005577 | Corn Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLRDLPEGLTRADPHLQITDNYM |
Ga0068854_1004029031 | 3300005578 | Corn Rhizosphere | MGVAKLTDQNTIVPESKYAKVERERRYLLRDLPDGVNRADP |
Ga0070702_1010611901 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVARLTEQNTVVPESKYARVERERRFLLRDLPEGLTRADPHLQITDNYITGTRL |
Ga0068852_1014656602 | 3300005616 | Corn Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYVLRDLPEGLTR |
Ga0068852_1015068782 | 3300005616 | Corn Rhizosphere | MGVAKLTDQNTIVPESRYAQVERERRYLLRDLPEGMTRADPHLQITDNY |
Ga0068852_1015445671 | 3300005616 | Corn Rhizosphere | MGVAKLTNQNTIVPESKYARVERERRYLLQDLPEGM |
Ga0068852_1025792642 | 3300005616 | Corn Rhizosphere | MGVAKLTDQNTIIPAESKYARVERERRYLLQDLPEGLSRADPH |
Ga0068859_1019020392 | 3300005617 | Switchgrass Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLRDLPEGMTRADPHLQ |
Ga0068864_1002535823 | 3300005618 | Switchgrass Rhizosphere | MGVAKLTTQNTIVPESKYARVERERRYLLQDLPEGVSRADHHLQITDNYLS |
Ga0068861_1026824342 | 3300005719 | Switchgrass Rhizosphere | MGVAKLTDQNTIMPAASKYAHVERERRYLLEDLPEELNRASPHVQITD |
Ga0068870_110839792 | 3300005840 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPGSKYARMERERRYLLRDLPEGMTRADPHLQITDNY |
Ga0068863_1002499031 | 3300005841 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYARMERERRYLLRDLPEGMTRADPHLQITDNYMTGSRLR |
Ga0068858_1019755731 | 3300005842 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYARVERERRYLLQDLPEGITRADPHLQITDNYI |
Ga0068860_1007069921 | 3300005843 | Switchgrass Rhizosphere | MGVARLTEQNTVVPESKYARVERERRYLLKDLPEGLTRADPHLQITDNYITGTRL |
Ga0068862_1015135511 | 3300005844 | Switchgrass Rhizosphere | MGLAKLTDQNTIVPESKYARVERERRYLLRDLPEGMTRAD |
Ga0070716_1007705562 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDLNTVVPDSKYARVERERRYLLPDLPEGLTRAD |
Ga0101566_104971381 | 3300006618 | Soil | MGVAKLTDQNTVVPESKYARVERERRYLLNDLPEGLIRTDPHLQITDNY |
Ga0079222_100419271 | 3300006755 | Agricultural Soil | MGVAKLTDQNTIVPESKYARVERERRFLLADLPEGLTRADPH |
Ga0079222_118801881 | 3300006755 | Agricultural Soil | MGVAKLTDQNTVVPASKYARVERERRYLLRDLPEGITRADPHLQI |
Ga0066665_108072511 | 3300006796 | Soil | MGVAKLTDLNTIVPASKYARTERERRYLLHDLPEGLSR |
Ga0066659_109006893 | 3300006797 | Soil | MGVAKLTDQNTVVPESKYARIERERRYLLEDLPEGLTRAEHHLQITDNYITG |
Ga0075421_1007448081 | 3300006845 | Populus Rhizosphere | MGVAKLTEQNTVVPESKYARVERERRYLLKDLPEGLTRADPHLQITDNYITGTRL |
Ga0075421_1018169371 | 3300006845 | Populus Rhizosphere | MGVAKLTDQNTIVPDSKYARVERERRYLLRDLPEGMTRA |
Ga0075421_1022825291 | 3300006845 | Populus Rhizosphere | MGVAKLTDANTIVPESKYARVERERRYLLSDLPEGLTRADPHLQIT |
Ga0075430_1006613052 | 3300006846 | Populus Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPEGMTR |
Ga0075433_102562383 | 3300006852 | Populus Rhizosphere | MGVAKLTDQNTIVPESKYARMERERRYLLRDLPEGMTRADPH |
Ga0075433_118605041 | 3300006852 | Populus Rhizosphere | VGIAKLTNENVIVPDSKYARVERERRYLLHDLPEGLSRADHH |
Ga0075425_1023740582 | 3300006854 | Populus Rhizosphere | MGVAKLTDQNTILPDSKYARIERERRYLLQDLPEGLAR |
Ga0075429_1005463962 | 3300006880 | Populus Rhizosphere | MGVAKLTNENTVVPESKYSRIERERRYLLQDLPPAL |
Ga0079215_115355241 | 3300006894 | Agricultural Soil | MGVAKLTDQNTIVPESKYARVERERRYLLKDLPDGL |
Ga0079216_103739572 | 3300006918 | Agricultural Soil | MGVAKLTDQNTILPDSKYARVERERRYLLRDLPEGMTRADPHLQITDNYITGT |
Ga0079216_116124192 | 3300006918 | Agricultural Soil | MGVAKLTDQNTIVPESKYARIERERRYLLQDLPEGLT |
Ga0079219_101939411 | 3300006954 | Agricultural Soil | MGVAKLTDENTIVPESKYARVERERRFLLADLPEGLTRADPHLQITDNYITGTR |
Ga0099794_107408461 | 3300007265 | Vadose Zone Soil | MGVAKLTDLNTIVPDSRYARVERERRYLLQDLPEGLTRADHHLQI |
Ga0099828_112674651 | 3300009089 | Vadose Zone Soil | MGVAELTDQNTFVPESKYARVERERRYLLQDLPEGLSRADHHFQITDNYMTG |
Ga0111539_103924331 | 3300009094 | Populus Rhizosphere | MGVAKLTEQNTVVPDSKYARVERERRFLLKDLPEGLTRADPHLQITDNYITG |
Ga0111539_122573351 | 3300009094 | Populus Rhizosphere | MGVAKLTDQNTIVPESKYAQLERERRYLLRDLPEGVTRADPHLQITDN |
Ga0075418_109682682 | 3300009100 | Populus Rhizosphere | MGVAKLTEQNTVVPESKYARIERERRYVLQDLPPGLTRVDPHLQITDN |
Ga0105247_108208341 | 3300009101 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYARVERERRYLLRDLPEGLTRADP |
Ga0066709_1006837531 | 3300009137 | Grasslands Soil | MGIAKLTDQNVVIPESKYARLERERRYLLQDLPEGLNRAEHHQQIT |
Ga0066709_1022482401 | 3300009137 | Grasslands Soil | MGVAKLTDLNTIVPDSKYARVERERRYLLPDLPEGLTRADYHLQITDNYIT |
Ga0066709_1027546673 | 3300009137 | Grasslands Soil | MGFAKLTDRNKIVPESKDARVERDRRYLLQDVPEGLSGAYHHFHIAGNYITGKRL |
Ga0075423_129128232 | 3300009162 | Populus Rhizosphere | MGVAKLTDQNTIVPESKDARVERERRYLLADLPEGLTRADPHLQITDN |
Ga0105242_100259854 | 3300009176 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYARLERERRYLLQDLPEGLTRADHHLQITDNYITGSRL |
Ga0105242_106186692 | 3300009176 | Miscanthus Rhizosphere | MGVAKLTDQNTIMPAASKYAHVERERRYLLEDLPEELNRASPHVQITDNY |
Ga0105248_111782321 | 3300009177 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYARVERERRYLLQDLPEGVSRADHHLQITDNYLSGTRLR |
Ga0105248_112755202 | 3300009177 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLKDLPEGLSRTDPHVQITD |
Ga0105248_127773281 | 3300009177 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYAHIERERRYLLRDLPEGVTRADPHLQITDNYMT |
Ga0105237_122469161 | 3300009545 | Corn Rhizosphere | MGVAKLTDQNTIVPESRYAQVERERRYLLRDLPEGMTRADPHLQITDNYMTGSRLR |
Ga0105249_135926302 | 3300009553 | Switchgrass Rhizosphere | VGVAKLTDQNTIIPDSKYARVERERRYLLRDLPAGL |
Ga0126307_107054732 | 3300009789 | Serpentine Soil | MGVAKLTDQNTVVPESKYARVERERRYLLRDLPEGITRADPHVQITDNYIT |
Ga0126313_104010952 | 3300009840 | Serpentine Soil | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPEGMTRADPHLQIT |
Ga0126305_101251723 | 3300010036 | Serpentine Soil | MGVAKLTDQNTIVPDSKYALIERERRYLLEDLPSGISRADNHLQIT |
Ga0126308_109122682 | 3300010040 | Serpentine Soil | MGLAKLTDQNTIVPDSKYARIERERRYLLRDLPEGLTRADQHVQITDNYITGTRL |
Ga0126314_114366441 | 3300010042 | Serpentine Soil | MGIAKLTEQNTIIPESKYARVERERRYLLRDLPEGMTRADPHLQITDNYITGSR |
Ga0126382_100079611 | 3300010047 | Tropical Forest Soil | MGVAKLTDQNTMVPESKYARVERERRYLLQELPAG |
Ga0134109_104495872 | 3300010320 | Grasslands Soil | MGVAKLTNQNTLVPESKYARVERERRYLLQDLPAGLS |
Ga0134065_103779502 | 3300010326 | Grasslands Soil | MGIAKLTDQNTIVPESKYARVERERRYLLPDLPEGL |
Ga0134111_105457131 | 3300010329 | Grasslands Soil | MGVAKLTDRNTIVPQSKYARIELERRYLLQDLPAGLSRADFHLQITDNYITGT |
Ga0134125_107453741 | 3300010371 | Terrestrial Soil | MGVAKLTDQNTIVPESRYARVERERRYLLRDLPEGITRADPHLQITDNYIT |
Ga0105239_114600231 | 3300010375 | Corn Rhizosphere | VGVAKLTDQNTIIPDSKYARVERERRYVLRDLPEGLTRADPHLQITDNYITGTR |
Ga0134127_104008271 | 3300010399 | Terrestrial Soil | MGVAKLTDQNTVLPAESKYARVERERRYLLQDLPEGLTRASPHVQITDNYIT |
Ga0134127_107482121 | 3300010399 | Terrestrial Soil | MGVAKLTDQNTIVPAESKYARIELERRYLLQDLPEGLT |
Ga0134127_110299952 | 3300010399 | Terrestrial Soil | MGVAKLTDQNTIVPAESKYARVERERRYLLQDLPEGLTRAS |
Ga0134127_113323591 | 3300010399 | Terrestrial Soil | MGVAKLTDQNTIVPESRYARIERERRYLLRDLPEGVTRADPHLQ |
Ga0134127_126732701 | 3300010399 | Terrestrial Soil | MGVAKLTDRNTVVPESKYARSELERRYLLEDLPEGLTRAEHHLQI |
Ga0134127_133111282 | 3300010399 | Terrestrial Soil | MGVAKLTDQNTIVPAAGKYARVERERRYLLQDLPEGLTRADSHLQITD |
Ga0134122_118554321 | 3300010400 | Terrestrial Soil | MGVAKLTDQNTIVPAESKYARLERERRYLLQDLPEGLTRASPHVQITDNYL |
Ga0134122_130960082 | 3300010400 | Terrestrial Soil | VGVAKLTDQNTIIPDSKYARVERERRYLLRDLPEGLTRADPHVQITDNYI |
Ga0134121_102069511 | 3300010401 | Terrestrial Soil | MGVAKLTDQNTIVPESKYARFERERRYLLRDLPEGITRADRHVQ |
Ga0134121_103278592 | 3300010401 | Terrestrial Soil | MGVAKLTDQNTIVPDSKYARIERERRYLLRDLPDGLARTDPHMQITDN |
Ga0134123_102365393 | 3300010403 | Terrestrial Soil | MGVAKLTDQNTIIPESKYAQVERERRYLLRDLPEGMTRADPHLQITDNYMTGS |
Ga0134123_129308861 | 3300010403 | Terrestrial Soil | VGVAKLTDLNTIVPAESKYARVERERRYLLQDLPEGLTRADPHLQITDNYI |
Ga0134123_132991132 | 3300010403 | Terrestrial Soil | MEERHVVMGVAKLTDQNTIVPESKYARIERERRYVLRDL |
Ga0138514_1000191291 | 3300011003 | Soil | MGVAKLTDQNTIVPAGSKYARVERERRYLLQDLPEGLTRASPHVQITDNYITGT |
Ga0105246_117224922 | 3300011119 | Miscanthus Rhizosphere | MGVAKLTDQNTVVPESKYARVERECRYLLRDLPEGLTRADPHLQITDNYMTGSRL |
Ga0137392_103067141 | 3300011269 | Vadose Zone Soil | MGVAKLTDLNTVVPDSKYARVERERRYLLADLPAGLTRADHHLQITDNYITGT |
Ga0137392_110101022 | 3300011269 | Vadose Zone Soil | MGVARLTDQNTIVPDSKYARIERERRYLLKDLPEGLTRADHHLQITDNYITG |
Ga0137393_102818943 | 3300011271 | Vadose Zone Soil | MGVAKLTDLNTIVPDSKYARVERERRYLLQDLPEGLTRADNHLQITDNYITG |
Ga0127502_113501572 | 3300011333 | Soil | MGVAKLTDQNTVVPESKYARVERERRYLLQDLPEGLTRADPHLQITDNYIT |
Ga0137438_12499461 | 3300011431 | Soil | MGVAKLTDQNTIVPGESKYARVERERRYLLQDLPEGLTRASPHLQITDS |
Ga0137388_108298811 | 3300012189 | Vadose Zone Soil | MGVARLTDQNTIVPDSKYARIERERRYLLKDLPEGLTRAD |
Ga0137383_100620764 | 3300012199 | Vadose Zone Soil | MGVAKLTELNTLLPESSYARVGRERRYLLHDLPEGLTRASRHLQIT |
Ga0137383_112226142 | 3300012199 | Vadose Zone Soil | MGVAKVTDENTIVPESRYARLERERRYLLHDLPEGLT |
Ga0137363_112659551 | 3300012202 | Vadose Zone Soil | MGVAKLTDLNTVVPDSKYARVERERRYLLPDLPEGLTRADHHLQITDN |
Ga0137363_117108792 | 3300012202 | Vadose Zone Soil | MGVAKLTDQNTIVPDSKYARVERERRYLLADLPEGITRADHHLQITDNY |
Ga0137380_104905482 | 3300012206 | Vadose Zone Soil | MGVAKLTDQNTLTPESKYARVERERRYLLQDLPAGLNRADHHLQITDNYLTST |
Ga0137377_102941604 | 3300012211 | Vadose Zone Soil | MGVAKLTNQNTILPAESKYARVERERRYLLQDLPEGL |
Ga0150985_1109041782 | 3300012212 | Avena Fatua Rhizosphere | MFVLNMGVAKLTDQNTTVPESKYAHVERERRYLIRDLPE |
Ga0150985_1187139361 | 3300012212 | Avena Fatua Rhizosphere | VGVAKLTDQNTIIPDSKYARIERERRYVLPDLPEGLTRADPHLQ |
Ga0137372_109162531 | 3300012350 | Vadose Zone Soil | MGVARLTDQNTIVPESKYSRLERERRYLLPDLPEGLSRADHHLQITDNYLTGT |
Ga0137367_103620111 | 3300012353 | Vadose Zone Soil | MGVAKLTERNTLVPASKYAQLERERRYLLRDLPQGLTRASRHTQITDNYITGT |
Ga0137366_105704681 | 3300012354 | Vadose Zone Soil | MGVGKLTERNTLVPASKYAQLERERRYLLRDLPQGLTRASRHT |
Ga0137384_108612071 | 3300012357 | Vadose Zone Soil | MGVAKLTDQNTVIPEQSKYARVERERKFLLDSLPEGLTPASPHVQITDNYITGTRLR |
Ga0137375_106906232 | 3300012360 | Vadose Zone Soil | MGVAKLTDQNTIVPVSKYARLERERRYLLQDLPSGLTRADRHLQITDNYITGTRL |
Ga0137361_106074792 | 3300012362 | Vadose Zone Soil | MGVARLTDQNTVVPESKYARVERERRYLLQDLPEGLSRA |
Ga0137361_108471281 | 3300012362 | Vadose Zone Soil | MGVAKLTELNTVVPESKYARIERERRYLLQDLPEGLTR |
Ga0137361_114799772 | 3300012362 | Vadose Zone Soil | MGVAKLTDQNTVVPEQSKYARVERERKFLLDRMPEGLTPA |
Ga0137361_116028722 | 3300012362 | Vadose Zone Soil | MGVAKLTDLNTVVPESKYASVERERRYLLADLPAGLTRA |
Ga0137361_118859251 | 3300012362 | Vadose Zone Soil | MGVAKLTDHNTIVPESKYARLERERRYLLQNLPEGLT |
Ga0150984_1047746802 | 3300012469 | Avena Fatua Rhizosphere | MFVLNMGVAKLTDQNTTVPESKYAHVERERCYLIRDLPEGLTRADHHLQIT |
Ga0136613_101499821 | 3300012681 | Polar Desert Sand | MGVAKLTDQNTFVPESKYARLERERRYLLQDLPEGLTRADPHVQITDNYITGTRL |
Ga0137397_101922844 | 3300012685 | Vadose Zone Soil | MGVAKLTDQNTIVPAESKYARVERERRYLLQDLPEDLTRASPHVQITDNYITG |
Ga0157303_102890692 | 3300012896 | Soil | MGVAKLTDQNTIVPESKYARVERERRYLLQDLPEGLT |
Ga0137396_104476441 | 3300012918 | Vadose Zone Soil | VGVAKLTEQNTIVPGESKYARVERERRYLLQDLPEGLTRANPHLQITDN |
Ga0137396_105577951 | 3300012918 | Vadose Zone Soil | MGVAKLTDLNTIVPDSRYARVERERRYLLQDLPEGLTR |
Ga0137394_105127201 | 3300012922 | Vadose Zone Soil | MGVAKLTDQNTVVPVESKYARVERERRYLLQDLPE |
Ga0137359_100832663 | 3300012923 | Vadose Zone Soil | MGVARLTDQNTVVPESKYARVERERRYLLQDLPEGLSRADHHLQI |
Ga0137359_104642202 | 3300012923 | Vadose Zone Soil | MGVAKLTDQNTVVPESKYARVERERRYLLQDLPEGLSRADHHLQI |
Ga0137410_117555732 | 3300012944 | Vadose Zone Soil | MGVAKLTDLNTIVPDSKYARVERERRYLLQDLPEGLTRADHH |
Ga0126375_109611071 | 3300012948 | Tropical Forest Soil | MGVAKLTDQNTIVPFSKYAKVERERRYLLQDLPEGLTRVDPHFQITDNYITGTRLRI |
Ga0126375_118727271 | 3300012948 | Tropical Forest Soil | MGVAKLTDQNTIVPESKYARVERERRYLLQELPAGLTRAD |
Ga0164300_110067372 | 3300012951 | Soil | MGVAKLTDQNTVIPESKYARIERERRYLLQDLPAGMTRADHHLQIT |
Ga0164298_101776192 | 3300012955 | Soil | MGVAKLTDHNTLVPDSKYAQVERERRYLLEDLPEGLTRVEHHLQIT |
Ga0126369_120278492 | 3300012971 | Tropical Forest Soil | MGVARLTDQNTVVPDSKYACVERERRYLLADLPEG |
Ga0157373_107755161 | 3300013100 | Corn Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPEGLTRADPHLQITDNY |
Ga0157371_112994312 | 3300013102 | Corn Rhizosphere | MGVAKLTDQNTVLPAESKYACVERERRFLLEDLPE |
Ga0157378_100892381 | 3300013297 | Miscanthus Rhizosphere | VGVAKLTEHNTITPDSKYARIERERRYLLRDLPEGMSRTDPHLQITDNYITGSRLRIRK |
Ga0157378_109675842 | 3300013297 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPDSKYARIERERRYLLRDLPEGLARTDPHMQI |
Ga0157378_118128771 | 3300013297 | Miscanthus Rhizosphere | MGVAKLTDQNTITPESKYARLERERRYLLKDLPEGLS |
Ga0157378_118582532 | 3300013297 | Miscanthus Rhizosphere | MGVAKLTEQNVVVPESKFARIERERRYLLKDLPEGLTRADPHLQITDNYITGTRLR |
Ga0157375_105121501 | 3300013308 | Miscanthus Rhizosphere | MGVAKLTDQNTLVPDSKYARVERERRYLLEDLPEGLTRAEH |
Ga0157375_106302062 | 3300013308 | Miscanthus Rhizosphere | VGVAKLTEHNTITPDSKYARIERERRYLLRDLPEGLSRT |
Ga0157375_121003081 | 3300013308 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPDSKYARIERERRYLLEDLPEGLTRAEHHLQITDNYI |
Ga0163163_107371842 | 3300014325 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPDSKYARVERERRYLLRDLPEGMTRADPHLQITDNY |
Ga0163163_114397091 | 3300014325 | Switchgrass Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLRDLPEGLTRAD |
Ga0163163_117308191 | 3300014325 | Switchgrass Rhizosphere | MGVAKLTTQNTVVPESKYARVERERRYLLQDLPEGV |
Ga0182006_12017782 | 3300015261 | Rhizosphere | MGVAKLTDQNTVVPESKYAHVERERRYLLRDLPEGITRADPHLQITDNYM |
Ga0132258_116374732 | 3300015371 | Arabidopsis Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLHDLPEGLSRVDHHLQITDNYITG |
Ga0132258_135194322 | 3300015371 | Arabidopsis Rhizosphere | MGVAKLTDSNTIVPESKYAHIERERRYLLRDLPEGMTRADPHLQITDNYITGT |
Ga0132256_1034312211 | 3300015372 | Arabidopsis Rhizosphere | MGVAKLTNDNVVVPQSKYARVERERRFLLNDLPEGI |
Ga0132257_1002123101 | 3300015373 | Arabidopsis Rhizosphere | MGVAKLTESNTIVPESKYARIERERRFVLENLPEGLTRAEPHLQITDNYMTG |
Ga0132257_1019021001 | 3300015373 | Arabidopsis Rhizosphere | MGVAKLTDQNTIVPESKYARLERERRYLLQDLPEGLTRADHHLQITDNYITG |
Ga0132255_1052663151 | 3300015374 | Arabidopsis Rhizosphere | MGVAKLTDQNTLVPDSKYAHVERERRYLLEDLPEGLTRAEHHLQITDNYITGTRLR |
Ga0134083_101343013 | 3300017659 | Grasslands Soil | MGVAKLTDQNTIVPESKYARVERERRYLLQDLPEGLSRADHHFQ |
Ga0184605_102645712 | 3300018027 | Groundwater Sediment | MGVAKLTDQNTIVPAESKYARIERERRYLLQDLPE |
Ga0184605_103194061 | 3300018027 | Groundwater Sediment | MGVAKLTDQNTVLPAESKYALVERERRYLLQDLPEGLTRPDPHVQITDNYITGTRL |
Ga0184605_103268181 | 3300018027 | Groundwater Sediment | MGVAKLTDLNTIVPESKYSRVERERRYLLQDLPEGLTRADYHLQITDNYITG |
Ga0184621_102698012 | 3300018054 | Groundwater Sediment | MGVAKLTDQNTIVHAASKYARVERERRYLLQDLPEGLTRA |
Ga0184619_101505251 | 3300018061 | Groundwater Sediment | MGVAKLTDQNTIVPDASKYARVERERRYLLPDLPEGLTRADLHVQITDNYIT |
Ga0184635_100212531 | 3300018072 | Groundwater Sediment | MGVAKLTDQNTIVPDSKYARVERERRYLLQDLPEGMSRADHHLQITD |
Ga0184639_100039507 | 3300018082 | Groundwater Sediment | MGVAKLTDQNTIVPAESKYARVERERRYLLQDLPEGVNRASPHVQITDNYLTGT |
Ga0184629_104889481 | 3300018084 | Groundwater Sediment | MGVAKLTDQNTIVPKSRYARLERERRYLLDGLPEGLTPASPHVQ |
Ga0190272_122335832 | 3300018429 | Soil | MGVAKLTDQNTVVPAESKYARVERERRYLLQDLPEGLSRADPHVQI |
Ga0190268_116881381 | 3300018466 | Soil | MGVAKLTDQNTIVPESKYARVERERRYLLNDLPEGLARTDPHRQITDNYITGT |
Ga0190270_132438471 | 3300018469 | Soil | MGVAKLTDQNTVVPAESKYARLERERRYLLQDLPEGLTRASP |
Ga0190274_103864002 | 3300018476 | Soil | MGVAKLTDQNTVVPESKYAQVERERRYLLRDLPEGITRPDP |
Ga0066669_102038141 | 3300018482 | Grasslands Soil | MGVAKLTDLNTIVPDSKYARVERERRYLLTDLPEGLTRADHHLQITDNY |
Ga0066669_102205412 | 3300018482 | Grasslands Soil | MGVAKLTDQNTVIPESSKYARVERERKFLLDCLPEELTPASPH |
Ga0190273_111997391 | 3300018920 | Soil | MGVAKLTDQNTVVPAESKYARVERERRYLLQDLPE |
Ga0190273_121464022 | 3300018920 | Soil | MGVAKLTDQNTIVPESKYARIERERRYLLQDLPEGMTRAD |
Ga0193757_10250942 | 3300020008 | Soil | MGVAKLTDQNVVIPESKYARVERERRYLLRDLPEGLTRADHHLQITDNYIT |
Ga0193740_10169154 | 3300020009 | Soil | MGVAKLTDQNTIVPVESKYAQVERERRYLLQDLPEGMNRASP |
Ga0210379_104349371 | 3300021081 | Groundwater Sediment | MGVAKLTDQNTIVPAESKYARVERERRYLLQDLPEGLTRASPHVQITDNY |
Ga0222622_114257001 | 3300022756 | Groundwater Sediment | MGVAKLTEQNTIVPSESKYALVERERRYLLQDLPEGLTRASP |
Ga0247678_10671421 | 3300024325 | Soil | MGVAKLTDQNTIVPESKYARVERERRYLLQDLPDGLTRVDPH |
Ga0209431_106209253 | 3300025313 | Soil | MGVAKLTNENTLVPASSRYAQVELERRYILQDLPEGLTR |
Ga0209341_102357921 | 3300025325 | Soil | MGVAKLTPQNTVVPESKYSLLERERRYLLQDLPGGLSRSDAHLQITDNYLTGTR |
Ga0207710_100128743 | 3300025900 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPEG |
Ga0207645_106008141 | 3300025907 | Miscanthus Rhizosphere | VGVAKLTDQNTIVPAESKYARVERERRYLLLDLPDGLTRADPHLQITDNYIT |
Ga0207695_114996421 | 3300025913 | Corn Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPEGLTRADPHLQITDNYITGTRLR |
Ga0207681_106373822 | 3300025923 | Switchgrass Rhizosphere | MGVAKLTDQNTLVPDSKYAHVERERRYLLEDLPEGLTRAEHHLQITDNYITGT |
Ga0207650_112543082 | 3300025925 | Switchgrass Rhizosphere | MGVAKLTDQNTVVPADSKYARIERERRYLLQDLPE |
Ga0207701_106618772 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYAQVERERRYLLQDLPEGLSRADHHLQITDNYITGTSLRIRK |
Ga0207701_114430041 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAKLTDQNTLVPDSKYAHVERERRYLLEDLPEGLTRAEHH |
Ga0207706_104652841 | 3300025933 | Corn Rhizosphere | MGVAKLTDQNTIVPESKYARLERERRYLLQDLPEGLTRADHHLQIT |
Ga0207706_105547451 | 3300025933 | Corn Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYVLRDLPEGLTRA |
Ga0207706_114841762 | 3300025933 | Corn Rhizosphere | MGVAKLTDQNTIVPESKYGRIERERRYLLRDLPEGMTRADDHLQ |
Ga0207686_105215051 | 3300025934 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPESRYAQVERERRYLLRDLPEGMTRADPHLQITDNYM |
Ga0207709_106964291 | 3300025935 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPESKYARIERERRYLLRDLPEGLTRADP |
Ga0207670_108638422 | 3300025936 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYARLERERRYLLQDLPEGLTRADHHLQITDNYITGSRLR |
Ga0207711_112729992 | 3300025941 | Switchgrass Rhizosphere | MGVAKLTTQNTIVPESKYARVERERRYLLQDLPEGVSRAD |
Ga0207689_100658294 | 3300025942 | Miscanthus Rhizosphere | MGVAKLTDQNTIVPADSKYARVERERRYLLQDLPEGLTRASPHVQITDNYITG |
Ga0207689_105164122 | 3300025942 | Miscanthus Rhizosphere | MGVAKLTEANTIVPESKYARIERERRYLLRDLPEGLMRADPHLQITD |
Ga0207651_109738662 | 3300025960 | Switchgrass Rhizosphere | MGVARLTEQNTVVPESKYARVERERRFLLRDLPEGLTRADPHLQITDNYITGTR |
Ga0207640_118718651 | 3300025981 | Corn Rhizosphere | MGVAKLTDQNTVLPAESKYACVERERRFLLEDLPEGLTRASPHFQITDNY |
Ga0207658_109234341 | 3300025986 | Switchgrass Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLKDLPEGMSRTDPHLQITDN |
Ga0207658_120479601 | 3300025986 | Switchgrass Rhizosphere | MGVAKLTESNTIVPDSKYARVERERRYLLRDLPEGLTRADPHVQITDNYIT |
Ga0207677_120890851 | 3300026023 | Miscanthus Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLQDLPEGLSRVDDHLQITDNYITG |
Ga0207702_111340431 | 3300026078 | Corn Rhizosphere | MGVAKLTDQNTIVPESKYARVERERRYLLQDLPEGLTRADPHL |
Ga0207641_102016121 | 3300026088 | Switchgrass Rhizosphere | MGVAKLTDQNTILPDSKYARIERERRYLLRDLPEGLARTDPHVQITDNYITGT |
Ga0207641_113916652 | 3300026088 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPDSKYARVERERRYLLRDVPEGMTRA |
Ga0207676_112663012 | 3300026095 | Switchgrass Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLRDLPEGVTRADP |
Ga0207676_116841432 | 3300026095 | Switchgrass Rhizosphere | MGVAKLTEQITVVPESKYARLERERRYVLQDLPPGL |
Ga0207676_117628601 | 3300026095 | Switchgrass Rhizosphere | MGIAKLTDQNTIVPAESKYARVERERRYLLQDLPEGLTRASPHLQITDNYITGT |
Ga0207674_101836251 | 3300026116 | Corn Rhizosphere | VGVAKLTDQNTIIPDSKYARIERERRYLLRDLPEGLTRADPHLQITDNYITGTRL |
Ga0207674_113175842 | 3300026116 | Corn Rhizosphere | VGVAKLTDENTIVPESKYARVERERRYLLRDLPEGMTRADPHLQITDNYITGSRL |
Ga0207698_124648541 | 3300026142 | Corn Rhizosphere | MGVAKLTDTNTIVPDSKYALIERERRFLLEDLPEGLSRADSHTQITDNYI |
Ga0209055_12435181 | 3300026309 | Soil | MGVAKLTDQNTVVPDSKYARVERERRYLLADLPEGLTRAEHHL |
Ga0209761_11478091 | 3300026313 | Grasslands Soil | MGVAKLTDQNTIVPESKYARVERERRYLLQDLPEGLSRA |
Ga0209154_11352962 | 3300026317 | Soil | MGVAKLTDFNTIVPESKYARVERERRYLLHDLPEG |
Ga0209805_13661461 | 3300026542 | Soil | MGVAKLTNQNTIVPESKYAHIERERRYLLQDLPEGLNRA |
Ga0208475_10283622 | 3300027018 | Soil | MGVAKLTDQNTIVPESKYARIERERRYLLKDLPEGLSRVDPHLQITDNYIT |
Ga0209731_10014311 | 3300027326 | Forest Soil | MGVAKLTDQNTVVPESKYARVERERRYLLRDLPEGIT |
Ga0209818_10582421 | 3300027637 | Agricultural Soil | MGVAKLTDQNTVVPESRYARVERERRYLLQDLPEGLTRADPHVQI |
Ga0209818_11648971 | 3300027637 | Agricultural Soil | MGVAKLTDQNTILPESKYARLELERRYLLLDLPDGLSRADLHV |
Ga0209074_100549861 | 3300027787 | Agricultural Soil | MGVAKLTDQNTIVPESKYARVERERRFLLADLPEGLTRADPHLQITDNYITGTRL |
Ga0209683_101005011 | 3300027840 | Wetland Sediment | MGVAKLTDQNTLVPAESKYARAERERRYLLEDLHEGLTR |
Ga0209798_100398011 | 3300027843 | Wetland Sediment | MGVAKLTDQNTLVPAESKYARAERERRYLLEDLPEGLTRASPHVQITDNYLTG |
Ga0209974_104030112 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MGVAKLTDQNTILPESKYARLELERRYLLQDLPDGLTRADPHVQIT |
Ga0207428_101497271 | 3300027907 | Populus Rhizosphere | MGVAKLTEQNTVVPESKYARIERERRYVLQDLPPGLTRVDPHL |
Ga0209382_101284773 | 3300027909 | Populus Rhizosphere | MGVAKLTDQNTVVPESKYARVERERRYLLRDLPEGLT |
Ga0209382_117248281 | 3300027909 | Populus Rhizosphere | VGVAKLTDQNTIVPESKYARVERERRYLLRDLPEGLTRADPHFQITDNYI |
Ga0209526_100814081 | 3300028047 | Forest Soil | MGVAKLTDQNTVVPAESKYARVERERRYLLQDLPEGLTRPDPHVQITDNYI |
Ga0268265_124677021 | 3300028380 | Switchgrass Rhizosphere | MGVAKLTDQNTIVPESKYGRIERERRYLLKDLPEG |
Ga0268264_102444913 | 3300028381 | Switchgrass Rhizosphere | VGVAKLTEHNTITPDSKYARIERERRYLLRDLPEG |
Ga0268264_116971121 | 3300028381 | Switchgrass Rhizosphere | MGVARLTEQNTVVPESKYARVERERRYLLKDLPEGLTRADPHLQITDNYITGTRLR |
Ga0307503_106980081 | 3300028802 | Soil | MGVAKLTDQNTIVPESKYARIERERRYLLQDLPEGLTRADHHLQITDNYITGSRL |
Ga0307503_108000401 | 3300028802 | Soil | MGVAKLTNQNTVVPESKYARVERERRYLLQDLPEGVSRADHHLQITDNYITGT |
Ga0307501_100125341 | 3300031152 | Soil | MGVAKLTDQNTIVPAESRYARVERERRYLLQDLPEGLTR |
Ga0299913_106344001 | 3300031229 | Soil | MGVAKLTPQNTVVPESRYARCERERRYLLRDLPDGLTRASPHVQITDNYI |
Ga0310888_100270611 | 3300031538 | Soil | MGVAKLTEQNTVVPESKYARIERERRYVLQDLPPGLTRVDPHLQITDNYIT |
Ga0310888_109113532 | 3300031538 | Soil | MGVAKLTDENTIVPESKYARVERERRYLLRDLPEGLT |
Ga0307468_1024824072 | 3300031740 | Hardwood Forest Soil | MGVAKLTDQNVVIPESKYARVERERRYLLRDLPEGLTRADHHLQITDN |
Ga0310891_102217851 | 3300031913 | Soil | MGVAKLTEQNTVVPESKYARIERERRYVLQDLPPGLTRVDPHVQITD |
Ga0310885_101682122 | 3300031943 | Soil | MGVAKLTEQNTVVPESKYARIERERRYVLQDLPPGLTRVDP |
Ga0307415_1000084814 | 3300032126 | Rhizosphere | MGVAKLTDQNTIVPESKYAQVERERRYLLRDLPEGLTRADPHLQITDNYMTGSRLR |
Ga0307470_109360671 | 3300032174 | Hardwood Forest Soil | MGVAKLTDQNTIVPESKYARVERERRYLLQDLPEGLTRADHHLQITDNYIT |
Ga0307470_112152673 | 3300032174 | Hardwood Forest Soil | MGVAKLTDLNTIVPESKYARVERERRYLLQDLPEGLTRADHHLQI |
Ga0307471_1018648572 | 3300032180 | Hardwood Forest Soil | MGVAKLTDLNTIVPASSKYARVERERRYLLEDLPE |
Ga0364941_206425_2_121 | 3300034417 | Sediment | MGVAKLTDQNTIVPDSKYSRVERERRYLLEDLPNGMSRAD |
⦗Top⦘ |