Basic Information | |
---|---|
Family ID | F012704 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 278 |
Average Sequence Length | 42 residues |
Representative Sequence | LAALAIADELHSAQRERGDREELLREQAERCLTLVERALKQTA |
Number of Associated Samples | 206 |
Number of Associated Scaffolds | 278 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.08 % |
% of genes near scaffold ends (potentially truncated) | 98.20 % |
% of genes from short scaffolds (< 2000 bps) | 91.37 % |
Associated GOLD sequencing projects | 187 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.698 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.698 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.813 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.245 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 278 Family Scaffolds |
---|---|---|
PF00248 | Aldo_ket_red | 49.28 |
PF03147 | FDX-ACB | 12.95 |
PF03795 | YCII | 6.83 |
PF03484 | B5 | 2.88 |
PF08241 | Methyltransf_11 | 2.52 |
PF13489 | Methyltransf_23 | 1.44 |
PF00950 | ABC-3 | 1.44 |
PF00106 | adh_short | 1.08 |
PF13561 | adh_short_C2 | 1.08 |
PF01738 | DLH | 1.08 |
PF05164 | ZapA | 1.08 |
PF00873 | ACR_tran | 0.72 |
PF13620 | CarboxypepD_reg | 0.72 |
PF14559 | TPR_19 | 0.72 |
PF05016 | ParE_toxin | 0.36 |
PF13701 | DDE_Tnp_1_4 | 0.36 |
PF01409 | tRNA-synt_2d | 0.36 |
PF02321 | OEP | 0.36 |
PF13649 | Methyltransf_25 | 0.36 |
PF01872 | RibD_C | 0.36 |
PF00291 | PALP | 0.36 |
PF03450 | CO_deh_flav_C | 0.36 |
COG ID | Name | Functional Category | % Frequency in 278 Family Scaffolds |
---|---|---|---|
COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 15.83 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 6.83 |
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 1.44 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 1.44 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 1.44 |
COG3027 | Cell division protein ZapA, inhibits GTPase activity of FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 1.08 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.36 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.36 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.36 |
COG2024 | O-phosphoseryl-tRNA(Cys) synthetase | Translation, ribosomal structure and biogenesis [J] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.70 % |
Unclassified | root | N/A | 22.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig19262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1263 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101244022 | Not Available | 833 | Open in IMG/M |
3300000567|JGI12270J11330_10020726 | All Organisms → cellular organisms → Bacteria | 4074 | Open in IMG/M |
3300000789|JGI1027J11758_12436497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium alhagi | 874 | Open in IMG/M |
3300001545|JGI12630J15595_10096183 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300001593|JGI12635J15846_10161690 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300003218|JGI26339J46600_10125897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300004091|Ga0062387_100937116 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300004152|Ga0062386_100131562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1942 | Open in IMG/M |
3300005175|Ga0066673_10438997 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300005177|Ga0066690_10195811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1343 | Open in IMG/M |
3300005184|Ga0066671_10142234 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
3300005293|Ga0065715_10364977 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300005437|Ga0070710_10433766 | Not Available | 887 | Open in IMG/M |
3300005466|Ga0070685_10248995 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300005537|Ga0070730_10191602 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300005537|Ga0070730_10799029 | Not Available | 594 | Open in IMG/M |
3300005541|Ga0070733_10661637 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300005557|Ga0066704_10126975 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
3300005574|Ga0066694_10265852 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300005598|Ga0066706_11228752 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300005610|Ga0070763_10321021 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300005764|Ga0066903_105060927 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300005921|Ga0070766_10132259 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300005921|Ga0070766_10138172 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
3300005921|Ga0070766_10424822 | Not Available | 874 | Open in IMG/M |
3300005937|Ga0081455_10692422 | Not Available | 650 | Open in IMG/M |
3300005993|Ga0080027_10141235 | Not Available | 921 | Open in IMG/M |
3300005994|Ga0066789_10447212 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300006050|Ga0075028_100645605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300006059|Ga0075017_101599179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300006102|Ga0075015_100409149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300006173|Ga0070716_100419625 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300006173|Ga0070716_100915094 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300006176|Ga0070765_101209111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300006794|Ga0066658_10425998 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300006797|Ga0066659_10057057 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
3300006797|Ga0066659_11714504 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300006852|Ga0075433_11438200 | Not Available | 596 | Open in IMG/M |
3300006871|Ga0075434_100090201 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
3300006893|Ga0073928_10294478 | Not Available | 1221 | Open in IMG/M |
3300006904|Ga0075424_101463558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium alhagi | 725 | Open in IMG/M |
3300006954|Ga0079219_10009307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3212 | Open in IMG/M |
3300007265|Ga0099794_10298089 | Not Available | 835 | Open in IMG/M |
3300009012|Ga0066710_104603748 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300009038|Ga0099829_10379404 | Not Available | 1167 | Open in IMG/M |
3300009038|Ga0099829_10491147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
3300009038|Ga0099829_10783551 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300009038|Ga0099829_11606261 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300009038|Ga0099829_11790238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300009088|Ga0099830_10124179 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
3300009088|Ga0099830_10370576 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300009088|Ga0099830_10665280 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300009089|Ga0099828_10776900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
3300009089|Ga0099828_11201403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
3300009090|Ga0099827_10733507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
3300009090|Ga0099827_11344540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300009137|Ga0066709_102768710 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300009143|Ga0099792_10745857 | Not Available | 637 | Open in IMG/M |
3300009698|Ga0116216_10113887 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
3300010048|Ga0126373_11122820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
3300010048|Ga0126373_12166668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300010320|Ga0134109_10245823 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300010320|Ga0134109_10280857 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300010325|Ga0134064_10155592 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300010339|Ga0074046_10646967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300010358|Ga0126370_10093412 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
3300010358|Ga0126370_11860303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300010361|Ga0126378_11469219 | Not Available | 773 | Open in IMG/M |
3300010366|Ga0126379_12308444 | Not Available | 638 | Open in IMG/M |
3300010366|Ga0126379_13068835 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300010366|Ga0126379_13745811 | Not Available | 509 | Open in IMG/M |
3300010376|Ga0126381_100983527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
3300010376|Ga0126381_101347952 | Not Available | 1031 | Open in IMG/M |
3300010376|Ga0126381_104396555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300010379|Ga0136449_103382080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300010396|Ga0134126_12780913 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300011107|Ga0151490_1471063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300011269|Ga0137392_10526394 | Not Available | 982 | Open in IMG/M |
3300011269|Ga0137392_10951682 | Not Available | 706 | Open in IMG/M |
3300011270|Ga0137391_10870136 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300011270|Ga0137391_10986483 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300011270|Ga0137391_10992339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300011270|Ga0137391_11165903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300011271|Ga0137393_10193358 | Not Available | 1714 | Open in IMG/M |
3300011271|Ga0137393_10420848 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300011271|Ga0137393_10649475 | Not Available | 904 | Open in IMG/M |
3300011271|Ga0137393_10784664 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300011271|Ga0137393_11692284 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300012096|Ga0137389_10752786 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300012096|Ga0137389_11448158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300012096|Ga0137389_11815434 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300012199|Ga0137383_10284383 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300012202|Ga0137363_10666005 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300012202|Ga0137363_11279886 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300012203|Ga0137399_10776691 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300012205|Ga0137362_10384425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1216 | Open in IMG/M |
3300012208|Ga0137376_11511672 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300012211|Ga0137377_10530917 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300012285|Ga0137370_10403882 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300012349|Ga0137387_10068392 | All Organisms → cellular organisms → Bacteria | 2413 | Open in IMG/M |
3300012349|Ga0137387_10774850 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300012357|Ga0137384_11065038 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300012357|Ga0137384_11599264 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300012361|Ga0137360_10992331 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300012361|Ga0137360_11843358 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300012362|Ga0137361_11473597 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300012363|Ga0137390_10269851 | Not Available | 1686 | Open in IMG/M |
3300012363|Ga0137390_10428080 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300012363|Ga0137390_10588362 | Not Available | 1081 | Open in IMG/M |
3300012582|Ga0137358_10615560 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300012582|Ga0137358_10707915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300012685|Ga0137397_10398461 | Not Available | 1025 | Open in IMG/M |
3300012685|Ga0137397_10491834 | Not Available | 914 | Open in IMG/M |
3300012918|Ga0137396_10507497 | Not Available | 893 | Open in IMG/M |
3300012918|Ga0137396_10676246 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300012922|Ga0137394_10927397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
3300012922|Ga0137394_11284865 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300012923|Ga0137359_10367748 | Not Available | 1278 | Open in IMG/M |
3300012924|Ga0137413_10275662 | Not Available | 1165 | Open in IMG/M |
3300012924|Ga0137413_10311951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
3300012925|Ga0137419_11166132 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300012927|Ga0137416_10975863 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300012927|Ga0137416_11211335 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300012927|Ga0137416_11379288 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300012929|Ga0137404_11826954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300012930|Ga0137407_10674369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
3300012930|Ga0137407_11522060 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300012930|Ga0137407_11828094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300012931|Ga0153915_10184262 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
3300012931|Ga0153915_12076649 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300012944|Ga0137410_11055398 | Not Available | 694 | Open in IMG/M |
3300012964|Ga0153916_13162835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300012971|Ga0126369_12637506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300013296|Ga0157374_12312064 | Not Available | 565 | Open in IMG/M |
3300013307|Ga0157372_11070168 | Not Available | 933 | Open in IMG/M |
3300014200|Ga0181526_10107816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1781 | Open in IMG/M |
3300014968|Ga0157379_11602010 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300015052|Ga0137411_1074955 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300015054|Ga0137420_1091875 | Not Available | 1091 | Open in IMG/M |
3300015054|Ga0137420_1181097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300015054|Ga0137420_1329523 | Not Available | 4062 | Open in IMG/M |
3300015054|Ga0137420_1389551 | Not Available | 1972 | Open in IMG/M |
3300015241|Ga0137418_10415749 | Not Available | 1094 | Open in IMG/M |
3300015372|Ga0132256_101328462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
3300016270|Ga0182036_10431109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
3300016319|Ga0182033_11038298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300016341|Ga0182035_11696244 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300016371|Ga0182034_10666752 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300016371|Ga0182034_11449585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300016387|Ga0182040_11817611 | Not Available | 522 | Open in IMG/M |
3300016404|Ga0182037_11659691 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300016422|Ga0182039_10493494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
3300016445|Ga0182038_10764787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300016445|Ga0182038_11217118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300016750|Ga0181505_10192844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300017924|Ga0187820_1049332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
3300017930|Ga0187825_10204350 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300017932|Ga0187814_10375107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300017937|Ga0187809_10029454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1754 | Open in IMG/M |
3300017943|Ga0187819_10230205 | Not Available | 1088 | Open in IMG/M |
3300017955|Ga0187817_10797950 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300017966|Ga0187776_10761904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300017993|Ga0187823_10381387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 509 | Open in IMG/M |
3300017995|Ga0187816_10277437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
3300017999|Ga0187767_10008426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1952 | Open in IMG/M |
3300018006|Ga0187804_10012992 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
3300018006|Ga0187804_10154848 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300018006|Ga0187804_10576603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300018021|Ga0187882_1058019 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
3300018040|Ga0187862_10694092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 595 | Open in IMG/M |
3300018077|Ga0184633_10565087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300018431|Ga0066655_11441178 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300018482|Ga0066669_10094165 | All Organisms → cellular organisms → Bacteria | 2059 | Open in IMG/M |
3300018482|Ga0066669_12300346 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300019887|Ga0193729_1284754 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300019999|Ga0193718_1085042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
3300020170|Ga0179594_10106677 | Not Available | 1011 | Open in IMG/M |
3300020580|Ga0210403_10944332 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300020580|Ga0210403_10992402 | Not Available | 657 | Open in IMG/M |
3300020581|Ga0210399_11327624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300020582|Ga0210395_11205902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300020583|Ga0210401_10023232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5944 | Open in IMG/M |
3300020583|Ga0210401_10884041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
3300021046|Ga0215015_11085130 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300021168|Ga0210406_11153513 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300021170|Ga0210400_10944110 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300021171|Ga0210405_10234621 | Not Available | 1452 | Open in IMG/M |
3300021363|Ga0193699_10371171 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300021402|Ga0210385_10520163 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300021402|Ga0210385_10679343 | Not Available | 788 | Open in IMG/M |
3300021404|Ga0210389_10283243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
3300021420|Ga0210394_10809165 | Not Available | 818 | Open in IMG/M |
3300021432|Ga0210384_10080401 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
3300021432|Ga0210384_10686969 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300021433|Ga0210391_10581435 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300021433|Ga0210391_10699463 | Not Available | 794 | Open in IMG/M |
3300021474|Ga0210390_11146435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 630 | Open in IMG/M |
3300021475|Ga0210392_10190511 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
3300021475|Ga0210392_10478449 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300021478|Ga0210402_10371480 | Not Available | 1327 | Open in IMG/M |
3300021478|Ga0210402_10991661 | Not Available | 767 | Open in IMG/M |
3300021559|Ga0210409_10922805 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300022504|Ga0242642_1039687 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300022557|Ga0212123_10046000 | All Organisms → cellular organisms → Bacteria | 4091 | Open in IMG/M |
3300024219|Ga0247665_1045093 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300024232|Ga0247664_1162350 | Not Available | 527 | Open in IMG/M |
3300024284|Ga0247671_1001611 | All Organisms → cellular organisms → Bacteria | 5262 | Open in IMG/M |
3300024347|Ga0179591_1158772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2528 | Open in IMG/M |
3300025165|Ga0209108_10058725 | Not Available | 2120 | Open in IMG/M |
3300025174|Ga0209324_10268606 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1111 | Open in IMG/M |
3300025898|Ga0207692_10504766 | Not Available | 768 | Open in IMG/M |
3300025899|Ga0207642_10667454 | Not Available | 653 | Open in IMG/M |
3300025906|Ga0207699_10163479 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
3300025907|Ga0207645_10648198 | Not Available | 717 | Open in IMG/M |
3300025929|Ga0207664_10123953 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
3300026281|Ga0209863_10086046 | Not Available | 927 | Open in IMG/M |
3300026285|Ga0209438_1213334 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300026295|Ga0209234_1301612 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300026301|Ga0209238_1149532 | Not Available | 715 | Open in IMG/M |
3300026325|Ga0209152_10343648 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300026326|Ga0209801_1216635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
3300026335|Ga0209804_1023124 | All Organisms → cellular organisms → Bacteria | 3221 | Open in IMG/M |
3300026552|Ga0209577_10616592 | Not Available | 642 | Open in IMG/M |
3300026555|Ga0179593_1223575 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
3300026879|Ga0207763_1024651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300026999|Ga0207949_1008707 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300027288|Ga0208525_1003952 | Not Available | 1526 | Open in IMG/M |
3300027330|Ga0207777_1079829 | Not Available | 569 | Open in IMG/M |
3300027381|Ga0208983_1083955 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300027603|Ga0209331_1066573 | Not Available | 901 | Open in IMG/M |
3300027729|Ga0209248_10115741 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300027812|Ga0209656_10068536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1940 | Open in IMG/M |
3300027853|Ga0209274_10551485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300027862|Ga0209701_10472021 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300027867|Ga0209167_10587418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300027867|Ga0209167_10661935 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300027902|Ga0209048_10892505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300028536|Ga0137415_10041511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4495 | Open in IMG/M |
3300028806|Ga0302221_10025497 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
3300029636|Ga0222749_10521658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300030906|Ga0302314_11123825 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300031231|Ga0170824_115336173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300031231|Ga0170824_128390510 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300031251|Ga0265327_10438982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300031446|Ga0170820_11103151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300031474|Ga0170818_103649336 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300031474|Ga0170818_107124679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300031668|Ga0318542_10614363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300031708|Ga0310686_101492533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4282 | Open in IMG/M |
3300031708|Ga0310686_104041471 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300031720|Ga0307469_11485698 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300031720|Ga0307469_11498268 | Not Available | 646 | Open in IMG/M |
3300031736|Ga0318501_10347962 | Not Available | 796 | Open in IMG/M |
3300031744|Ga0306918_11166329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300031765|Ga0318554_10190758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1166 | Open in IMG/M |
3300031765|Ga0318554_10479196 | Not Available | 705 | Open in IMG/M |
3300031779|Ga0318566_10405217 | Not Available | 671 | Open in IMG/M |
3300031796|Ga0318576_10419145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300031820|Ga0307473_10889445 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300031879|Ga0306919_10504939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
3300031910|Ga0306923_12267631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300031941|Ga0310912_10663214 | Not Available | 810 | Open in IMG/M |
3300031941|Ga0310912_10665329 | Not Available | 808 | Open in IMG/M |
3300031962|Ga0307479_10050685 | All Organisms → cellular organisms → Bacteria | 3989 | Open in IMG/M |
3300031962|Ga0307479_11438256 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300031962|Ga0307479_12025203 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300032001|Ga0306922_10961620 | Not Available | 884 | Open in IMG/M |
3300032067|Ga0318524_10023244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2796 | Open in IMG/M |
3300032076|Ga0306924_10950061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
3300032076|Ga0306924_11692556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 663 | Open in IMG/M |
3300032180|Ga0307471_102030696 | Not Available | 722 | Open in IMG/M |
3300032180|Ga0307471_103174642 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300032205|Ga0307472_101009895 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300032893|Ga0335069_11845588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 641 | Open in IMG/M |
3300032955|Ga0335076_10342416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1382 | Open in IMG/M |
3300033004|Ga0335084_11380516 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300033290|Ga0318519_10195258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.04% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.32% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.16% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.16% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.80% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.80% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.80% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.08% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.08% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.08% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.08% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.08% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.08% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.08% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.72% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.72% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.36% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.36% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.36% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.36% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.36% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.36% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.36% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.36% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0262.00001950 | 2166559005 | Simulated | VLTALAIADELNSLRKEKSDREELLKEQAERCLTLVERALKQSE |
INPhiseqgaiiFebDRAFT_1012440221 | 3300000364 | Soil | AALAIADELHSGLRDRTDREELLREQAERCLTLVERALKQTA* |
JGI12270J11330_100207261 | 3300000567 | Peatlands Soil | ELHSSRKEKGVREELLKEQAERCLTLVERALKQTE* |
JGI1027J11758_124364971 | 3300000789 | Soil | AIADELHSGLRDRTEHEELLREQAERCLTLVERALKQTA* |
JGI12630J15595_100961832 | 3300001545 | Forest Soil | AALAIADELHTIRKDRTEEEELLREQAERCLTLVERALKQTA* |
JGI12635J15846_101616903 | 3300001593 | Forest Soil | LAALAIADELHSAQRDLGYREDVLREQAERCLVLVERALKQSA* |
JGI26339J46600_101258971 | 3300003218 | Bog Forest Soil | LAIADELYRLREERGEREEILKEQAERCLTLVERALRKTE* |
Ga0062387_1009371162 | 3300004091 | Bog Forest Soil | LAALAIADELHNAQMEKGEREELLREQADRCLTLVERALKQTA* |
Ga0062386_1001315623 | 3300004152 | Bog Forest Soil | VLAALAIADELHSSRKEKGAREEVLKEQAERCLTFVERALKQTE* |
Ga0066673_104389971 | 3300005175 | Soil | KVAVLAALAIADELHNIQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0066690_101958113 | 3300005177 | Soil | ALAIADELHSSKREIGEREEMLKEQAERCLTLVERALKQTA* |
Ga0066671_101422341 | 3300005184 | Soil | TQKAAVLAALAIADELHSGLRERSEQEELLREQAERCLTLVERALKQTA* |
Ga0065715_103649771 | 3300005293 | Miscanthus Rhizosphere | KVAVLAALSIADELHTTQRDRGETDELLREQAERCLTLVERALKQTA* |
Ga0070710_104337662 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AVLAALSIADELHSTQRDLGENNELLREQAERCLNLVERALKQTA* |
Ga0070685_102489951 | 3300005466 | Switchgrass Rhizosphere | AVLAALAIADELHAGLRERGEHEELLREQAERCLTLVERALKQTA* |
Ga0070730_101916024 | 3300005537 | Surface Soil | AALAIADELHNGLRERNEREDLLREQAERCLTLVERALKQTA* |
Ga0070730_107990292 | 3300005537 | Surface Soil | AIADEFHSLKTELTDEEEMLREQAERCLTLVERALKQTA* |
Ga0070733_106616372 | 3300005541 | Surface Soil | VDTHKIAVLAALAIADELHSTQRDLGEHNDLLREQAERCLTLVERALKQTA* |
Ga0066704_101269754 | 3300005557 | Soil | ALAIADELHTLRREKNDHEELLREQAERCLTLVERALKQTA* |
Ga0066694_102658521 | 3300005574 | Soil | VLAALAIADELHNMQRDRGDHEELLREQAERCLTLVERALKQTA* |
Ga0066706_112287521 | 3300005598 | Soil | DTQKVAVLAALAIADELHNIQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0070763_103210211 | 3300005610 | Soil | AALAIADELHSTQKDRGDREELLREQAERCLTLVERALKQTA* |
Ga0066903_1050609272 | 3300005764 | Tropical Forest Soil | AIADELHSLKTEVTEEEEMLREQAERCLTLVERALKQTA* |
Ga0070766_101322591 | 3300005921 | Soil | ELHNIQNDRGTREELLREQADRCLTLVERALKQTA* |
Ga0070766_101381721 | 3300005921 | Soil | LHSTQKDRGDREELLREQAERCLTLVERALKQTA* |
Ga0070766_104248222 | 3300005921 | Soil | HKIAVLAALSIADELHTTQRDLGEHSEMLREQAERCLTLVERALKQTA* |
Ga0081455_106924222 | 3300005937 | Tabebuia Heterophylla Rhizosphere | ADELHAGLRERGEHEELLREQAERCLTLVERALKQTA* |
Ga0080027_101412352 | 3300005993 | Prmafrost Soil | LAALAIADELHSAQRDIGYREDVLREQAERCLTLVERALKQSA* |
Ga0066789_104472121 | 3300005994 | Soil | LHTAQRDRGYREDVLREQAERCLTLVERALKQSA* |
Ga0075028_1006456052 | 3300006050 | Watersheds | AALAIADELHGIQRERGEREELMREQAERCLTLVERALKQTA* |
Ga0075017_1015991791 | 3300006059 | Watersheds | LHSLRKERGEREELLKEQAERCLTLVERALKQAE* |
Ga0075015_1004091491 | 3300006102 | Watersheds | QKVAVLAALAIADELHSMQRDRGESEELLREQAERCLTLVERALKQTA* |
Ga0070716_1004196253 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AAVLAALAIADELHSGMRERGEREDLLREQAERCLTLVERALKQTA* |
Ga0070716_1009150941 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAALAIADELHSMQRDLGDHDELMREQAERCLTLVERALKQTA* |
Ga0070765_1012091111 | 3300006176 | Soil | IADELHSTQRDLGENNELIREQAERCLMLVERALKQTA* |
Ga0066658_104259982 | 3300006794 | Soil | ADELHNMQRDRGDHEELLREQAERCLTLVERALKQTA* |
Ga0066659_100570574 | 3300006797 | Soil | ALAIADELHSMQRDLGDHDELMREQAERCLTLVERALKQTA* |
Ga0066659_117145042 | 3300006797 | Soil | AALAIADELHSGLRERSEQEELLREQAERCLTLVERALKQTA* |
Ga0075433_114382002 | 3300006852 | Populus Rhizosphere | KAAVLAALAIADELHAGLRDRTEHEELLREQAERCLTLVERALKQTA* |
Ga0075434_1000902015 | 3300006871 | Populus Rhizosphere | AIADELHAGLRERGEQEELLREQAERCLTLVERALKQTA* |
Ga0073928_102944782 | 3300006893 | Iron-Sulfur Acid Spring | IADELHSAQRDLGYREGVLREQAERCLVLVERALKQSA* |
Ga0075424_1014635581 | 3300006904 | Populus Rhizosphere | AALAIADELHAGLRERGEQEELLREQAERCLTLVERALKQTA* |
Ga0079219_100093071 | 3300006954 | Agricultural Soil | LAVADELQTLQSQRSEDAELLREQAERCLTLVERALKQTA* |
Ga0099794_102980891 | 3300007265 | Vadose Zone Soil | LAIADELHSMQRERNDREELLSEQAERCLTLVERALKQTA* |
Ga0066710_1046037482 | 3300009012 | Grasslands Soil | AVLAALAIADELQSAQRDRGDREELLREQAERCLTLVERALKQTA |
Ga0099829_103794041 | 3300009038 | Vadose Zone Soil | VAVLSALAIADELHSLRNERETLDGTLREQAERCLTLVERALKQTA* |
Ga0099829_104911471 | 3300009038 | Vadose Zone Soil | LKVAVLSALAIADELHSLRNERETLDGTLREQAERCLTLVERALKQTA* |
Ga0099829_107835512 | 3300009038 | Vadose Zone Soil | DELHSIQRDRGEHEELLREQAERCLTLVERALKQTA* |
Ga0099829_116062611 | 3300009038 | Vadose Zone Soil | KVAVLAALAIADELHSIQRDRGEHEELLREQAERCLTLVERALKQTA* |
Ga0099829_117902381 | 3300009038 | Vadose Zone Soil | QKAAVLAALAIADELLSIRKEGGDREEMLREKAERCLTLVERALKQTA* |
Ga0099830_101241791 | 3300009088 | Vadose Zone Soil | TQKVAVLAALAIADELHTIRKDRTDQEDLLREQAERCLTLVERALKQTA* |
Ga0099830_103705763 | 3300009088 | Vadose Zone Soil | AALAIADELHSMQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0099830_106652801 | 3300009088 | Vadose Zone Soil | VAVLAALAIADELHSMQRDRGDHEELMREQAERCLTLVERALKQTA* |
Ga0099828_107769001 | 3300009089 | Vadose Zone Soil | VLAALAIADELLSIRKEGGDREEMLREKAERCLTLVERALKQTA* |
Ga0099828_112014032 | 3300009089 | Vadose Zone Soil | VLAALAIADELHSMQRDRGDHKELMREQAERCLTLVERALKQTA* |
Ga0099827_107335072 | 3300009090 | Vadose Zone Soil | AIADELHSLRKERGEQKELLREQAERCLTLVERALKQTA* |
Ga0099827_113445402 | 3300009090 | Vadose Zone Soil | IADELHSLRNERETLDGTLREQAERCLTLVERALKQTA* |
Ga0066709_1027687102 | 3300009137 | Grasslands Soil | TQKVAVLAALAIADELHNIQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0099792_107458572 | 3300009143 | Vadose Zone Soil | TVDSQKAAVLAALAIADELHSGLRERGEQEELLREQAERCLTLVERALKQTA* |
Ga0116216_101138871 | 3300009698 | Peatlands Soil | LESLRQEHTRRDASVRERAERCLTLVERALRQSA* |
Ga0126373_111228202 | 3300010048 | Tropical Forest Soil | AILAALAITDELHSLKKERGEREELLKEQAERCLTLVERALRQTE* |
Ga0126373_121666682 | 3300010048 | Tropical Forest Soil | AALAIADELHSLRKERGEREELLKEQAERCLTLVERALRQTE* |
Ga0134109_102458231 | 3300010320 | Grasslands Soil | QKVAVLAALAIADELHNIQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0134109_102808572 | 3300010320 | Grasslands Soil | LAALAIADELHSLQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0134064_101555921 | 3300010325 | Grasslands Soil | IADELHSLQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0074046_106469671 | 3300010339 | Bog Forest Soil | LAALSIADELHSSRKEKGVREELLKEQAERCLMLVERALKQTE* |
Ga0126370_100934121 | 3300010358 | Tropical Forest Soil | LHSLKTKATDEEELLREQAERCLSLVERALKQTA* |
Ga0126370_118603031 | 3300010358 | Tropical Forest Soil | LAIADELHSLKTEVTEEEEMLREQAERCLTLVERALKQTA* |
Ga0126378_114692191 | 3300010361 | Tropical Forest Soil | AALAIADELHSLKTEVTDEEQLLREQAERCLTLVERALKQTA* |
Ga0126379_123084442 | 3300010366 | Tropical Forest Soil | VLAALAIADELHAGLRERGEQEELLREQAERCLTLVERALKQTA* |
Ga0126379_130688351 | 3300010366 | Tropical Forest Soil | TVKVAVLAALSIADELHTTQRDRGETHELLREQAERCLTLVERALKQTA* |
Ga0126379_137458111 | 3300010366 | Tropical Forest Soil | ELYSGLRERGEREELLREQAERCLTLVERALKQTA* |
Ga0126381_1009835272 | 3300010376 | Tropical Forest Soil | LTALAIADELNTLRKEKSDREELLKEQAERCLTLVERALKQSE* |
Ga0126381_1013479521 | 3300010376 | Tropical Forest Soil | DELHSLQQQHGEREEILKEQAERCLNLVERALTKKE* |
Ga0126381_1043965551 | 3300010376 | Tropical Forest Soil | LALADELHSLKKERGEREELLKEQAERCLTLVERALRQTE* |
Ga0136449_1033820802 | 3300010379 | Peatlands Soil | ADELHSSRKEKGAREELLKEQAERCLTSVERALKQTE* |
Ga0134126_127809132 | 3300010396 | Terrestrial Soil | VAVLAALAIADELHSIQKDRGDREELMREQAERCLTLVERALKQTA* |
Ga0151490_14710632 | 3300011107 | Soil | VDTQKAAVLAALAIADELHAGLRDRGEHEELLREQAERCLTLVEHALKQTA* |
Ga0137392_105263941 | 3300011269 | Vadose Zone Soil | AIADELHSARKDRTDQDDLLREQAERCLTLVERALKQTA* |
Ga0137392_109516821 | 3300011269 | Vadose Zone Soil | AALAIADELHSARKDRTDQDDLLREQAERCLTLVERALKQTA* |
Ga0137391_108701362 | 3300011270 | Vadose Zone Soil | LHSIQRDRGEHEGLLREQAERCLTLVERALKQTA* |
Ga0137391_109864831 | 3300011270 | Vadose Zone Soil | KVAVLSALSIADELHTSQRDRGETDGLLREQAERCLTLVERALKQTA* |
Ga0137391_109923391 | 3300011270 | Vadose Zone Soil | LAIADELHSLRQGQGEMERSLRERAERCLTLVERALKQSA* |
Ga0137391_111659031 | 3300011270 | Vadose Zone Soil | AIADELHRVREERGEREEILKEQAERCLTLVERALRRTE* |
Ga0137393_101933581 | 3300011271 | Vadose Zone Soil | LHSIQRDRGEHEELLREQAERCLTLVERSLKQTA* |
Ga0137393_104208481 | 3300011271 | Vadose Zone Soil | ALAIADELHSMQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0137393_106494751 | 3300011271 | Vadose Zone Soil | IADELHTIRKDRTDQEELLREQAERCLTLVERALKQSA* |
Ga0137393_107846642 | 3300011271 | Vadose Zone Soil | QKVAVLAALAIADELHSLQRDRGDHEELMREQAERCLTLVERALKQTA* |
Ga0137393_116922842 | 3300011271 | Vadose Zone Soil | LCLPMALVGAIAALAIADELHSLKTELTDEEELLREQAERCLTLVERALKQTA* |
Ga0137389_107527861 | 3300012096 | Vadose Zone Soil | AVLAALAIADELHSARKDRTDQDDLLREQAERCLTLVERALKQTA* |
Ga0137389_114481581 | 3300012096 | Vadose Zone Soil | AAVLAALAIADELHSLRKERGEQKELLREQAERCLTLVERALKQTA* |
Ga0137389_118154342 | 3300012096 | Vadose Zone Soil | VAVLAALAIADELHSMQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0137383_102843831 | 3300012199 | Vadose Zone Soil | DELHSGLRERGEQEELLREQAERCLTLVERALKQTA* |
Ga0137363_106660052 | 3300012202 | Vadose Zone Soil | TQKVAVLAALAIADELHSMQRDLGDHDELMREQAERCLTLVERALKQTA* |
Ga0137363_112798862 | 3300012202 | Vadose Zone Soil | IADELHNMQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0137399_107766911 | 3300012203 | Vadose Zone Soil | KVAVLAALAIADELHSARKDRTDQDDLLREQAERCLTLVERALKQTA* |
Ga0137362_103844252 | 3300012205 | Vadose Zone Soil | DELHSMQRERNDREELLSEQAERCLTLVERALKQTA* |
Ga0137376_115116721 | 3300012208 | Vadose Zone Soil | VAVLAALAIADELHSMQRDLGDHDELMREQAERCLTLVERALKQTA* |
Ga0137377_105309173 | 3300012211 | Vadose Zone Soil | LAALAIADELHNMQRDRGDHEELLREQAERCLTLVERALKQTA* |
Ga0137370_104038822 | 3300012285 | Vadose Zone Soil | LAALAIADELHSMQRDLGDHDELMREQAERCLTLVERALKQTA* |
Ga0137387_100683924 | 3300012349 | Vadose Zone Soil | IADELHSLKTEVTDEEQLLREQAERCLTLVERALKQTA* |
Ga0137387_107748501 | 3300012349 | Vadose Zone Soil | IADELHSGLRERTEQEELLREQAERCLTLVERALKQTA* |
Ga0137384_110650381 | 3300012357 | Vadose Zone Soil | VAVLAALAIADELHSIQRDRGDHHELLREQAERCLTLVERALKQTA* |
Ga0137384_115992642 | 3300012357 | Vadose Zone Soil | AAVLVALAIADELHTLRREKNDHEELLREQAERCLTLVERALKQTA* |
Ga0137360_109923312 | 3300012361 | Vadose Zone Soil | DELHSLQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0137360_118433582 | 3300012361 | Vadose Zone Soil | LHSMQRERNEREELLSEKAERCLTLVERALKQTA* |
Ga0137361_114735971 | 3300012362 | Vadose Zone Soil | KVAVLAALAIADELHSMQRDRGDHEQLMREQAERCLTLVERALKQTA* |
Ga0137390_102698512 | 3300012363 | Vadose Zone Soil | QKLAVLAALAIADELHSLKTELTDEEELLREQAERCLTLVERALKQTA* |
Ga0137390_104280803 | 3300012363 | Vadose Zone Soil | AVLAALAIADELHTIRKDRTDQEDLLREQAERCLTLVERALKQTA* |
Ga0137390_105883621 | 3300012363 | Vadose Zone Soil | TQKVAVLAALAIADESHSARKDRTDQDDLLREQAERCLTLVERALKQTA* |
Ga0137358_106155602 | 3300012582 | Vadose Zone Soil | DELHNMQRERNDREELLSEQAERCLTLVERALKQTA* |
Ga0137358_107079152 | 3300012582 | Vadose Zone Soil | VDTQKAAVLAALAIADELHSGLRERGEQEELLREQTERCLTLVERALKQTA* |
Ga0137397_103984612 | 3300012685 | Vadose Zone Soil | LHSSKREIGEREEMLKEQAERCLTLVERALKQTA* |
Ga0137397_104918342 | 3300012685 | Vadose Zone Soil | LTALAIADELHSMQRERNDREELLSEQAERCLTLVERALKQTA* |
Ga0137396_105074972 | 3300012918 | Vadose Zone Soil | IADELHSTQKERGDQEELLREQAERCLTLVERALKQTA* |
Ga0137396_106762461 | 3300012918 | Vadose Zone Soil | IADELHSMQRDLGDHDELLREQAERCLTLVERALKQTA* |
Ga0137394_109273972 | 3300012922 | Vadose Zone Soil | AVLAALAIADELHSGLRERGEQEELLREQAERCLTLVERALKQTA* |
Ga0137394_112848651 | 3300012922 | Vadose Zone Soil | KVAVLAALAIADELHTTRKDRTEEEELLREQAERCLTLVERALKQTA* |
Ga0137359_103677482 | 3300012923 | Vadose Zone Soil | AALAIADGLHTIRKDRTEEEELVREQAERCVTLVEGALEQTAQQLRNFY* |
Ga0137413_102756621 | 3300012924 | Vadose Zone Soil | LHTSRKDRTEEEELLREQAERCLTLVERALKQTA* |
Ga0137413_103119511 | 3300012924 | Vadose Zone Soil | RAAVLAALAIADELHSMRKGRGEQDELLREQAERCLTLVERALKQTA* |
Ga0137419_111661321 | 3300012925 | Vadose Zone Soil | VAVLAALAIADELHSMQRDLGDHDELLREQAERCLTLVERALKQTA* |
Ga0137416_109758632 | 3300012927 | Vadose Zone Soil | DELHSTQRDLGEHNEMLREQAERCITLVERALKQTA* |
Ga0137416_112113351 | 3300012927 | Vadose Zone Soil | QKVAVLAALAIADELHSMQRDLGDHDELLREQAERCLTLVERALKQTA* |
Ga0137416_113792882 | 3300012927 | Vadose Zone Soil | LAIADELHNTQKERGDQEELLREQAERCLTLVERALKQTA* |
Ga0137404_118269541 | 3300012929 | Vadose Zone Soil | AIADELHSGLRERGEQEELLREQAERCLTLVERALKQTA* |
Ga0137407_106743691 | 3300012930 | Vadose Zone Soil | ALAIADELHSGLRERGEQEELLREQAERCLTLVERALKQTA* |
Ga0137407_115220601 | 3300012930 | Vadose Zone Soil | QKAAVLAALAIADELHSGLRERGEQEELLREQAERCLTLVERALKQTA* |
Ga0137407_118280941 | 3300012930 | Vadose Zone Soil | VDTQKVAVLAALAIPDELHILQRDRGDHERLMREQAERCLTLVERALKQTA* |
Ga0153915_101842621 | 3300012931 | Freshwater Wetlands | AAVLAALAIADELHSSRRERGEREELLREQAERCLALVERALKQTA* |
Ga0153915_120766491 | 3300012931 | Freshwater Wetlands | LAALAIADELHSARHERGEREELLREQAERCLALVERALKQTA* |
Ga0137410_110553981 | 3300012944 | Vadose Zone Soil | QKVAVLTALAIADELHSMQRERNDREELLSEQAERCLTLVERALKQTA* |
Ga0153916_131628352 | 3300012964 | Freshwater Wetlands | AALAIADELHSARHERGEHEELLREQAERCLALVERALKQTA* |
Ga0126369_126375062 | 3300012971 | Tropical Forest Soil | AIADELHSMQRERSDEEELLREQAERCLTLVERALKQTA* |
Ga0157374_123120642 | 3300013296 | Miscanthus Rhizosphere | ELHSGLRDRTEREELLREQAERCLTLVERALKQTA* |
Ga0157372_110701682 | 3300013307 | Corn Rhizosphere | SIADELHTTQRDRGETDELLREQAERCLTLVERALKQTA* |
Ga0181526_101078161 | 3300014200 | Bog | ALAIADELHSLRKERGEREELLKEQAERCLTLVERALKQAD* |
Ga0157379_116020102 | 3300014968 | Switchgrass Rhizosphere | AALSIADELHSAQRDLGENNELIREQAERCLMLVERALKQTA* |
Ga0137411_10749551 | 3300015052 | Vadose Zone Soil | AVLAALAIADELHNMQRERNDREELLSEQAERCLTLVERALKQTA* |
Ga0137420_10918752 | 3300015054 | Vadose Zone Soil | VLAALAIADELHTTRKDRTEEEELLREQAERCLTLVERALKQTA* |
Ga0137420_11810971 | 3300015054 | Vadose Zone Soil | VLAALAQKVAVLAALAIADELHSMQRDLGDHDELLREQAERCLTLVERALKQTA* |
Ga0137420_13295232 | 3300015054 | Vadose Zone Soil | VLAALAIADELHSMQRDLGDHDELLREQAERCLTLVERALSQNA* |
Ga0137420_13895513 | 3300015054 | Vadose Zone Soil | VLAALAIADELHSMQRDLGDHDELLREQAERCLTLVERALKQTA* |
Ga0137418_104157491 | 3300015241 | Vadose Zone Soil | ADELHTTRKDRTEEEELLREQAERCLTLVERALKQTA* |
Ga0132256_1013284621 | 3300015372 | Arabidopsis Rhizosphere | AAVLAALAIADELHSGLRDRTEREELLREQAERCLTLVERALKQTA* |
Ga0182036_104311092 | 3300016270 | Soil | AILAALAIADELHSLRKERGEREELLKEQAERCLTLVERALRQTE |
Ga0182033_110382982 | 3300016319 | Soil | LAALAIADELHSLREERGEREELLKEQAERCLTLVERALKQTD |
Ga0182035_116962442 | 3300016341 | Soil | AAVLAALAIADELHSTQRERGEREQLLREQAERCLTLVERALKQTA |
Ga0182034_106667521 | 3300016371 | Soil | TVDTQKAAVLAALAIADELHTGLRESGEQEELLREQAERCLTLVERALKQTA |
Ga0182034_114495851 | 3300016371 | Soil | IADELHSLRKERGEREELLKEQAERCLTLVERALRQTE |
Ga0182040_118176111 | 3300016387 | Soil | KLAVLAALAIADELHSLKTEVTDEEQLLREQAERCLTLVERALKQTA |
Ga0182037_116596912 | 3300016404 | Soil | ADELHNMQRERSDEEELLREQAERCLNLVERALKQTA |
Ga0182039_104934942 | 3300016422 | Soil | AIADELHSLKKERGEREELLKEQAERCLTLVERALRQTE |
Ga0182038_107647871 | 3300016445 | Soil | IADELHSLKKERGEREELLKEQAERCLTLVERALRQTE |
Ga0182038_112171181 | 3300016445 | Soil | VAILAALAIADELHSLKKERGEREELLKEQAERCLTLVERALRQTE |
Ga0181505_101928442 | 3300016750 | Peatland | ILAALAIADELHSLRKERGEREELLKEQAERCLTLVERALKQAD |
Ga0187820_10493321 | 3300017924 | Freshwater Sediment | KVAVLAALAIADELHTLREERGEREELLKEQAERCLTLVERALKQTD |
Ga0187825_102043501 | 3300017930 | Freshwater Sediment | ELHTLQKDRGDREELLREQAERCLTLVERALKQTA |
Ga0187814_103751071 | 3300017932 | Freshwater Sediment | QKVAMLAALAIADELYSLRTEKGEREELLKEQAERCLTLVERALKQSE |
Ga0187809_100294541 | 3300017937 | Freshwater Sediment | AALAIADELHTLREERGEREELLKEQAERCLTLVERALKQTD |
Ga0187819_102302052 | 3300017943 | Freshwater Sediment | AIADELHSLKNERSDHEDLLREQAERCLTLVERALKQTA |
Ga0187817_107979501 | 3300017955 | Freshwater Sediment | ELHSLKNERSDHEDLLREQAERCLTLVERALKQTA |
Ga0187776_107619042 | 3300017966 | Tropical Peatland | ELHSLRNERNAREELLKEQAERCLTLVERALKQSD |
Ga0187823_103813872 | 3300017993 | Freshwater Sediment | DTQKAAVLAALAIADELHNGLRERNEREDLLREQAERCLTLVERALKQTA |
Ga0187816_102774373 | 3300017995 | Freshwater Sediment | DELHSSRKEKGEREELLKEQAERCLTLVERALKQTE |
Ga0187767_100084262 | 3300017999 | Tropical Peatland | AMAIADELHSLRKERGEREELLKEQAERCLTLVERALKQSD |
Ga0187804_100129924 | 3300018006 | Freshwater Sediment | ADELHSLKNERSDHEDLLREQAERCLTLVERALKQTA |
Ga0187804_101548481 | 3300018006 | Freshwater Sediment | KVAVLAALAIADELHSLKNERDDHEDLLREQAERCLTLVERALKQTA |
Ga0187804_105766032 | 3300018006 | Freshwater Sediment | VLAALAIADELHVALEDQGEREGELKARAERCLNLVERALSGKE |
Ga0187882_10580193 | 3300018021 | Peatland | DLVKVAVLIALAIADELHFLREDRNEDAERFRECAERCLNLVERALRQMA |
Ga0187862_106940922 | 3300018040 | Peatland | LTALAIADELHSLREDRNEDAERLRERAERCLNLVERALRQTA |
Ga0184633_105650872 | 3300018077 | Groundwater Sediment | QRVAVLAALAVADELQTLRAEREEVEGKLRDRAQRCLTLVERALKQTA |
Ga0066655_114411782 | 3300018431 | Grasslands Soil | IADELHTTQRDRGESDELLREQAERCLTLVERALKQTA |
Ga0066669_100941651 | 3300018482 | Grasslands Soil | KAAVLAALAIADELHSGMRERSEQEELLREQAERCLTLVERALKQTA |
Ga0066669_123003462 | 3300018482 | Grasslands Soil | AALAIADELHNMQRDRGDHEELLREQAERCLTLVERALKQTA |
Ga0193729_12847541 | 3300019887 | Soil | LAIADELHSGLRERGEQEELLREQAERCLTLVERALKQTA |
Ga0193718_10850421 | 3300019999 | Soil | VLAALAIADELHGARRDLGDREDLLREQAERCLTLVERALRQSA |
Ga0179594_101066772 | 3300020170 | Vadose Zone Soil | VAVLAALAIADELHTTRKDRTEEEELLREQAERCLTLVERALKQTA |
Ga0210403_109443321 | 3300020580 | Soil | DELHSLRKDRGDREELLREQAERCLTLVERALRQTA |
Ga0210403_109924021 | 3300020580 | Soil | AIADELHRVREERGEREEILKEQAERCLTLVERALRKTE |
Ga0210399_113276241 | 3300020581 | Soil | ELHRLREERGEREEILKEQAERCLTLVERALRKTE |
Ga0210395_112059022 | 3300020582 | Soil | KVAVLAALAIADELHRLREERGEREEILKEQAERCLTLVERALRKTE |
Ga0210401_100232327 | 3300020583 | Soil | ALAIADELHRLREERGEREEILKEQAERCLTLVERALRKTE |
Ga0210401_108840412 | 3300020583 | Soil | LAIADDLKSLRDDGGRYKDQLKEQAERCLTLVERALKRTE |
Ga0215015_110851302 | 3300021046 | Soil | QKLAVLAALAIADELHNTQKERGDQEELLREQAERCLTLVERALKQTA |
Ga0210406_111535132 | 3300021168 | Soil | IADELHNMQRDRSDSEELLREQAERCLTLVERALKKSA |
Ga0210400_109441101 | 3300021170 | Soil | DELHSLQRDRGDHEQLMREQAERCLTLVERALKQTV |
Ga0210405_102346212 | 3300021171 | Soil | DTHKVAVLAALAIADELNTVQDELRNAQTAHGEHDELLREQAERCLTLVERALKQTA |
Ga0193699_103711712 | 3300021363 | Soil | AALAIADELHSAQRDIGYREDVLREQAERCLTLVERALKQSA |
Ga0210385_105201633 | 3300021402 | Soil | DELHSTQRDLGENNELIREQAERCLMLVERALKQTA |
Ga0210385_106793432 | 3300021402 | Soil | AALSIADELHSTQRDLGEHNDLLREQAERCLTLVERALKQTA |
Ga0210389_102832431 | 3300021404 | Soil | KVATFAALAIADELHTLRKERGEQNELMKEQAERCLTLVERALKQTE |
Ga0210394_108091651 | 3300021420 | Soil | KVAVLAALAIADELHSSQKDRGDREALLAEQAERCLTLVERALRQTA |
Ga0210384_100804011 | 3300021432 | Soil | AVLTALAIADELHRLREERGEREEILKEQAERCLTLVERALRKTE |
Ga0210384_106869692 | 3300021432 | Soil | KVAVLAALAIADELHSMQRDRGDHEQLMREQAERCLTLVERALKQTA |
Ga0210391_105814353 | 3300021433 | Soil | SRLADELHSIQKDRGDREDLMREQAERCLTLVERALKQTA |
Ga0210391_106994631 | 3300021433 | Soil | IAVLAALSIADELHSTQRDLGEHNDLLREQAERCLTLVERALKQTA |
Ga0210390_111464352 | 3300021474 | Soil | KVAVLTALAIADELHRLREERGEREEILKEQAERCLTLVERALRKTE |
Ga0210392_101905111 | 3300021475 | Soil | LAALAIADELHSRLRERGEHEDLLREQAERCLTLVERALKQTA |
Ga0210392_104784492 | 3300021475 | Soil | QKAAVLAALAIADELHSGLRERTEQEELLREQAERCLTLVERALKQTA |
Ga0210402_103714803 | 3300021478 | Soil | DELHNMQRDRGDHEQLMREQAERCLTLVERALKQTA |
Ga0210402_109916612 | 3300021478 | Soil | AIADEFHTIRRDRTDQEDLLREQAERCLTLVERALKQTA |
Ga0210409_109228051 | 3300021559 | Soil | VLAALSIADELHSTQRDLGEHNDLLREQAERCLTLVERALKQTA |
Ga0242642_10396871 | 3300022504 | Soil | DTHKVAVLAALAIADELNSVQDQLLTAQNARGEHDELLREQAERCLTLVERALKQTA |
Ga0212123_100460007 | 3300022557 | Iron-Sulfur Acid Spring | DELHTIRKDRTEEEELLREQAERCLTLVERALKQTA |
Ga0247665_10450932 | 3300024219 | Soil | LAIADELHSIQKDRGDREELMREQAERCLTLVERALKQTA |
Ga0247664_11623501 | 3300024232 | Soil | DELHSGLRDRTEREELLREQAERCLTLVERALKQTA |
Ga0247671_10016111 | 3300024284 | Soil | ELHSIQKDRGDREELMREQAERCLTLVERALKQTA |
Ga0179591_11587725 | 3300024347 | Vadose Zone Soil | HRVRERGAGERKIEILKEQAERCLTLVERALRRTEIA |
Ga0209108_100587253 | 3300025165 | Soil | ELQTLRAEREDVEGKLRDRAQRCLTLVERALKQTA |
Ga0209324_102686061 | 3300025174 | Soil | LNIADELHSLRERHSELESDLRQHTERCLTLVEQALKSA |
Ga0207692_105047662 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | IAVLAALSIADELHSTQRDLGENNELLREQAERCLNLVERALKQTA |
Ga0207642_106674542 | 3300025899 | Miscanthus Rhizosphere | ADEPHAGLRDRSEHEELLREQAERCLTLVERALKQTA |
Ga0207699_101634791 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TQKAAVLAALAIADELHSGLRERGEQEELLREQAERCLTLVERALKQTA |
Ga0207645_106481982 | 3300025907 | Miscanthus Rhizosphere | KVAVLAALSIADELHTTQRDRGETDELLREQAERCLTLVERALKQNTRNM |
Ga0207664_101239534 | 3300025929 | Agricultural Soil | DELHSTQRDLGENNELLREQAERCLNLVERALKQTA |
Ga0209863_100860462 | 3300026281 | Prmafrost Soil | VLAALAIADELHSAQRDIGYREDVLREQAERCLTLVERALKQSA |
Ga0209438_12133342 | 3300026285 | Grasslands Soil | AIADELHTTRKDRTEEEELLREQAERCLTLVERALKQTA |
Ga0209234_13016122 | 3300026295 | Grasslands Soil | IADELHSMQRDLGDHDELMREQAERCLTLVERALKQTA |
Ga0209238_11495321 | 3300026301 | Grasslands Soil | LAALAIADELHSSKREIGEREEMLKEQAERCLTLVERALKQTA |
Ga0209152_103436482 | 3300026325 | Soil | ADELHNMQRDRGDHEELLREQAERCLTLVERALKQTA |
Ga0209801_12166351 | 3300026326 | Soil | VLAALAIADELHSSKREIGEREEMLKEQAERCLTLVERALKQTA |
Ga0209804_10231241 | 3300026335 | Soil | KVAVLAALAIADELHNMQRDRGDHEELLREQAERCLTLVERALKQTA |
Ga0209577_106165921 | 3300026552 | Soil | LAIADELHSLKTEVTDEEHMLREQAERCLTLVERALKQTA |
Ga0179593_12235755 | 3300026555 | Vadose Zone Soil | AIADELHSLQRDRGDHEQLMREQAERCLTLVERALKQTA |
Ga0207763_10246512 | 3300026879 | Tropical Forest Soil | VMAALAIADELHNLREERNDREELLKEQAERCLSLVERALKHSE |
Ga0207949_10087072 | 3300026999 | Forest Soil | VLAALSIADELHSTQRDLGEHNEMLREQAERCLTLVERALKQTA |
Ga0208525_10039521 | 3300027288 | Soil | VLAALAIADELHSSQREIGEREEMLKEQAERCLTLVERALKQTA |
Ga0207777_10798293 | 3300027330 | Tropical Forest Soil | ELYSTRRERSSREELLKEQAERCLTLVERAIQKTE |
Ga0208983_10839551 | 3300027381 | Forest Soil | IADELHSMQRERNDREELLSEQAERCLTLVERALKQTA |
Ga0209331_10665731 | 3300027603 | Forest Soil | ELHTIRKDRTEEEELLREQAERCLTLVERALKQTA |
Ga0209248_101157411 | 3300027729 | Bog Forest Soil | ADEFHSTQRDRGGREELLREQAERCLTLVERALKQTA |
Ga0209656_100685362 | 3300027812 | Bog Forest Soil | DELYRLREERGEREEILKEQAERCLTLVERALRKTE |
Ga0209274_105514851 | 3300027853 | Soil | AIADELYSTQKDRGDREELLREQAERCLTLVERALKQTA |
Ga0209701_104720211 | 3300027862 | Vadose Zone Soil | DELHSTQKERGDREDLLREQAERCLTLVERALKQTA |
Ga0209167_105874181 | 3300027867 | Surface Soil | QRAAVLAALAIADELHSLRKGRGEQDELLREQAERCLTLVERALKQTA |
Ga0209167_106619351 | 3300027867 | Surface Soil | VDTHKIAVLAALAIADELHSTQRDLGEHNDLLREQAERCLTLVERALKQTA |
Ga0209048_108925053 | 3300027902 | Freshwater Lake Sediment | ELYGARRERGSREELLKEQAERCLTLVERAIAKTE |
Ga0137415_100415115 | 3300028536 | Vadose Zone Soil | KVAVLTALAIADELHSVQRERNDREELLSEQAERCLTLVERALKQTA |
Ga0302221_100254971 | 3300028806 | Palsa | AALAIADELHTIRKDRGEHDEMLREQAERCLTLVERALKQTA |
Ga0222749_105216581 | 3300029636 | Soil | IADELNSLRKEKSDREELLKEQAERCLTLVERALKQSE |
Ga0302314_111238252 | 3300030906 | Palsa | ADELHNAQNDRGEREELLREQADRCLTLVERALKQTA |
Ga0170824_1153361732 | 3300031231 | Forest Soil | VLTALTIADELNSLRKEKSDREELLKEQAERCLTLVERALKQSE |
Ga0170824_1283905102 | 3300031231 | Forest Soil | VLAALAIADELHSGLRERTEQEELLREQAERCLTLVERALKQTA |
Ga0265327_104389821 | 3300031251 | Rhizosphere | QKASVLAALSIADELYSLRKERGNREELLKEQAERCLTLVERAIKQTE |
Ga0170820_111031511 | 3300031446 | Forest Soil | DELHRLREERGEREEILKEQAERCLTLVERALRKTE |
Ga0170818_1036493361 | 3300031474 | Forest Soil | DTQKAAVLAALAIADELHSGLRERTEQEELLREQAERCLTLVERALKQTA |
Ga0170818_1071246791 | 3300031474 | Forest Soil | VAVLAALAIADELHRLREERGEREEILKEQAERCLTLVERALRKTE |
Ga0318542_106143632 | 3300031668 | Soil | KVAILAALAIADELHSLKKERGEREELLKEQAERCLTLVERALRQTE |
Ga0310686_1014925336 | 3300031708 | Soil | ALAIADELHNAQNDRGEREELLREQADRCLTLVERALKQTA |
Ga0310686_1040414711 | 3300031708 | Soil | ELHSMQRERSDSEELLREQAERCLTLVERALKKSA |
Ga0307469_114856982 | 3300031720 | Hardwood Forest Soil | LAALAIADELHSAQRERGDREELLREQAERCLTLVERALKQTA |
Ga0307469_114982681 | 3300031720 | Hardwood Forest Soil | AVLAALAIADELHSGLRERGEQEELLREQAERCLTLVERALKQTA |
Ga0318501_103479621 | 3300031736 | Soil | IDTQKAAVLAALAIADELHAGLRERGEQEELLREQAERCLTLVERALKQTA |
Ga0306918_111663291 | 3300031744 | Soil | LAIADELHSSKKEKGEREELLKEQAERCLTLVERALRQTE |
Ga0318554_101907581 | 3300031765 | Soil | LAIADELHAGLRERGEQEELLREQAERCLTLVERALKQTA |
Ga0318554_104791961 | 3300031765 | Soil | LAIADELHTGLRERAEREDLLREQAERCLTLVERALKQTA |
Ga0318566_104052171 | 3300031779 | Soil | QKAAVLAALAIADELHAGLRERGEQEELLREQAERCLTLVERALKQTA |
Ga0318576_104191452 | 3300031796 | Soil | VFLAALAIADELHSLKKERGEREELLKEQAERCLTLVERALRQTE |
Ga0307473_108894452 | 3300031820 | Hardwood Forest Soil | TQKVAVLAALAIADELQNMQRERGDHEELLREQAERCLTLVERALKQTA |
Ga0306919_105049392 | 3300031879 | Soil | LAALAIADELHSLKKERGEREELLKEQAERCLTLVERALRQTE |
Ga0306923_122676311 | 3300031910 | Soil | ELHSLKKERGEREELLKEQAERCLTLVERALRQTE |
Ga0310912_106632143 | 3300031941 | Soil | QKAAVLAALAIADELHTGLRERGEREELLREQAERCLTLVERALKQTA |
Ga0310912_106653291 | 3300031941 | Soil | AIADELHSLREQRHDNEELLKEQAERCLNLVERALKQTE |
Ga0307479_100506851 | 3300031962 | Hardwood Forest Soil | ADELHSGLRERGEQEELLREQAERCLTLVERALKQTA |
Ga0307479_114382562 | 3300031962 | Hardwood Forest Soil | ELHTIRKDRTDQEDLLREQAERCLTLVERALKQTA |
Ga0307479_120252032 | 3300031962 | Hardwood Forest Soil | AVLTALAIADELHSLQRDRGDHEQLMREQAERCLTLVERALKQTA |
Ga0306922_109616202 | 3300032001 | Soil | AALAIADVLHSLREERNDREGLLKEQAERCLNLVERALKQTE |
Ga0318524_100232445 | 3300032067 | Soil | LAALAIADELHAGLRERGEQEELLREQAERCLTLVERALKQTA |
Ga0306924_109500611 | 3300032076 | Soil | ELHTGLRERGEREELLREQAERCLTLVERALKQTA |
Ga0306924_116925561 | 3300032076 | Soil | VAVLAAISIADELHRLREERGEREEILKEQAERCLTLVERALRKTD |
Ga0307471_1020306962 | 3300032180 | Hardwood Forest Soil | IADELHSSQREIGEREEMLKEQAERCLTLVERALKQTA |
Ga0307471_1031746422 | 3300032180 | Hardwood Forest Soil | QKVAVLAALAIADELHSTQKDRGDREDLLREQAERCLTIVERALKQTA |
Ga0307472_1010098952 | 3300032205 | Hardwood Forest Soil | LAIADELHGMQRERNDREELLSEQAERCLTLVERALKQTA |
Ga0335069_118455881 | 3300032893 | Soil | ADELHRVREERGEREEILKEQAERCLTLVERALKKTE |
Ga0335076_103424161 | 3300032955 | Soil | AAMAIADELHSLRKERGEREDLLKEQAERCLTLVERALKQSE |
Ga0335084_113805161 | 3300033004 | Soil | ADELHSSQREIGEREEMLKEQAERCLTLVERALKQTA |
Ga0318519_101952581 | 3300033290 | Soil | DELHSLRKERGEREELLKEQAERCLTLVERALRQTE |
⦗Top⦘ |