Basic Information | |
---|---|
Family ID | F013038 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 275 |
Average Sequence Length | 41 residues |
Representative Sequence | IGIFFVPAIFYLVEKWSGAGKEHVSGALPATPAPAEGD |
Number of Associated Samples | 205 |
Number of Associated Scaffolds | 275 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.73 % |
% of genes near scaffold ends (potentially truncated) | 96.73 % |
% of genes from short scaffolds (< 2000 bps) | 90.91 % |
Associated GOLD sequencing projects | 191 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.636 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.182 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.727 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.545 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.24% β-sheet: 0.00% Coil/Unstructured: 75.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 275 Family Scaffolds |
---|---|---|
PF02321 | OEP | 88.73 |
PF00873 | ACR_tran | 1.45 |
PF03401 | TctC | 0.36 |
PF16640 | Big_3_5 | 0.36 |
PF08240 | ADH_N | 0.36 |
PF07690 | MFS_1 | 0.36 |
PF13620 | CarboxypepD_reg | 0.36 |
PF10431 | ClpB_D2-small | 0.36 |
PF04014 | MazE_antitoxin | 0.36 |
PF00158 | Sigma54_activat | 0.36 |
PF04909 | Amidohydro_2 | 0.36 |
PF11852 | Pullul_strch_C | 0.36 |
PF13181 | TPR_8 | 0.36 |
PF03625 | DUF302 | 0.36 |
PF00440 | TetR_N | 0.36 |
PF00383 | dCMP_cyt_deam_1 | 0.36 |
PF01850 | PIN | 0.36 |
PF01263 | Aldose_epim | 0.36 |
COG ID | Name | Functional Category | % Frequency in 275 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 177.45 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.36 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.36 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.36 |
COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.64 % |
Unclassified | root | N/A | 0.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101299907 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300000550|F24TB_12320250 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300000955|JGI1027J12803_107236791 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300000955|JGI1027J12803_109076559 | All Organisms → cellular organisms → Bacteria | 2927 | Open in IMG/M |
3300001159|JGI12650J13346_1008695 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300001471|JGI12712J15308_10153991 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300002558|JGI25385J37094_10187716 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300002914|JGI25617J43924_10247671 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300002917|JGI25616J43925_10269560 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300003370|JGI26337J50220_1002166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Paracidobacterium → Paracidobacterium acidisoli | 2234 | Open in IMG/M |
3300004080|Ga0062385_10524234 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300004082|Ga0062384_100218754 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300004082|Ga0062384_100346629 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300004082|Ga0062384_100540328 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300004091|Ga0062387_101501689 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300004091|Ga0062387_101606605 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300004092|Ga0062389_103201213 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300004092|Ga0062389_103286106 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300004611|Ga0068925_1250961 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300005435|Ga0070714_102065234 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005455|Ga0070663_101537200 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
3300005467|Ga0070706_100690303 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300005537|Ga0070730_10766434 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300005541|Ga0070733_10498457 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300005542|Ga0070732_10953114 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005554|Ga0066661_10899736 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300005557|Ga0066704_10402339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
3300005559|Ga0066700_11071317 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005591|Ga0070761_10066598 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
3300005591|Ga0070761_10568000 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300005921|Ga0070766_10316571 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300005921|Ga0070766_10387124 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300005921|Ga0070766_10441348 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300005995|Ga0066790_10091222 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300006034|Ga0066656_10581469 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300006052|Ga0075029_100248543 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300006102|Ga0075015_100993880 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300006162|Ga0075030_100242448 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300006163|Ga0070715_10272773 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300006176|Ga0070765_101202986 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300006852|Ga0075433_10091821 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
3300007258|Ga0099793_10090958 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
3300007258|Ga0099793_10179646 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300007265|Ga0099794_10422585 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300009038|Ga0099829_10483007 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300009038|Ga0099829_11510777 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300009088|Ga0099830_10418677 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300009089|Ga0099828_10339949 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300009090|Ga0099827_10735013 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300009143|Ga0099792_11164578 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300009156|Ga0111538_10669563 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300009623|Ga0116133_1108015 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300009635|Ga0116117_1029636 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300010043|Ga0126380_10623482 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300010048|Ga0126373_10586957 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300010358|Ga0126370_12375939 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300010359|Ga0126376_10422534 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300010361|Ga0126378_12551388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300010361|Ga0126378_12618917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300010379|Ga0136449_104318389 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300010396|Ga0134126_11776271 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300010398|Ga0126383_11199225 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300010876|Ga0126361_10035204 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300011120|Ga0150983_13900238 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300011269|Ga0137392_10015871 | All Organisms → cellular organisms → Bacteria | 5160 | Open in IMG/M |
3300011269|Ga0137392_11258298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300011270|Ga0137391_10221447 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
3300011270|Ga0137391_10725406 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300011271|Ga0137393_11717089 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300012189|Ga0137388_10997729 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300012189|Ga0137388_11836460 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300012199|Ga0137383_10187056 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300012202|Ga0137363_10123046 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
3300012202|Ga0137363_10408833 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300012202|Ga0137363_10794610 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300012203|Ga0137399_10429643 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300012203|Ga0137399_10443467 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300012205|Ga0137362_10005273 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 8900 | Open in IMG/M |
3300012205|Ga0137362_10399200 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300012206|Ga0137380_11403279 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300012207|Ga0137381_10714422 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300012209|Ga0137379_10515705 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300012210|Ga0137378_10288236 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300012285|Ga0137370_10779609 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300012351|Ga0137386_10995525 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300012361|Ga0137360_10432441 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300012361|Ga0137360_10464436 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300012361|Ga0137360_10945527 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300012393|Ga0134052_1183587 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300012582|Ga0137358_10216302 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300012683|Ga0137398_10457427 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300012685|Ga0137397_10488409 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300012685|Ga0137397_10538819 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300012685|Ga0137397_10974342 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300012917|Ga0137395_10221873 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
3300012918|Ga0137396_10283560 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300012918|Ga0137396_10897488 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300012923|Ga0137359_10062774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3239 | Open in IMG/M |
3300012924|Ga0137413_11782312 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300012925|Ga0137419_10930561 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300012925|Ga0137419_11906723 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300012927|Ga0137416_11493648 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300012929|Ga0137404_10520107 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300012929|Ga0137404_11045914 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300012930|Ga0137407_10500043 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300012930|Ga0137407_12189832 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300014169|Ga0181531_10226782 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300015052|Ga0137411_1056218 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
3300015052|Ga0137411_1312737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4329 | Open in IMG/M |
3300015052|Ga0137411_1329796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2782 | Open in IMG/M |
3300015358|Ga0134089_10347895 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300015371|Ga0132258_11725513 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
3300016698|Ga0181503_1133479 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300017822|Ga0187802_10462584 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300017823|Ga0187818_10058620 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
3300017823|Ga0187818_10107169 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300017928|Ga0187806_1185349 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300017933|Ga0187801_10109653 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300017955|Ga0187817_10707776 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300017961|Ga0187778_10106998 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
3300017961|Ga0187778_10434097 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300017961|Ga0187778_10505246 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300017961|Ga0187778_10894753 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300018019|Ga0187874_10047907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1997 | Open in IMG/M |
3300018030|Ga0187869_10028826 | All Organisms → cellular organisms → Bacteria | 3080 | Open in IMG/M |
3300018034|Ga0187863_10549871 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300018038|Ga0187855_10710699 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300018042|Ga0187871_10170541 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300018047|Ga0187859_10066046 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
3300018060|Ga0187765_10130701 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300018062|Ga0187784_10596572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
3300018088|Ga0187771_10307670 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300018090|Ga0187770_11213780 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300018431|Ga0066655_11290282 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300019268|Ga0181514_1559537 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300019767|Ga0190267_11646502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
3300019789|Ga0137408_1031541 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
3300020199|Ga0179592_10314846 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300020199|Ga0179592_10380215 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300020579|Ga0210407_10066070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2711 | Open in IMG/M |
3300020579|Ga0210407_10761469 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300020580|Ga0210403_10011062 | All Organisms → cellular organisms → Bacteria | 7329 | Open in IMG/M |
3300020580|Ga0210403_10018873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5507 | Open in IMG/M |
3300020580|Ga0210403_11037804 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300020580|Ga0210403_11476478 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300020581|Ga0210399_11134959 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300020581|Ga0210399_11189884 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300020582|Ga0210395_10968549 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300020582|Ga0210395_11091268 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300020583|Ga0210401_11390688 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300021086|Ga0179596_10176519 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300021088|Ga0210404_10869501 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300021168|Ga0210406_10058649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3344 | Open in IMG/M |
3300021170|Ga0210400_10791129 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300021171|Ga0210405_10196852 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
3300021178|Ga0210408_11373037 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300021180|Ga0210396_11623499 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300021181|Ga0210388_10291413 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
3300021402|Ga0210385_10373038 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300021402|Ga0210385_10390450 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300021402|Ga0210385_10648819 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300021402|Ga0210385_11203689 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300021403|Ga0210397_10343585 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300021406|Ga0210386_10379944 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300021420|Ga0210394_10310806 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
3300021432|Ga0210384_10006833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12096 | Open in IMG/M |
3300021432|Ga0210384_10077459 | All Organisms → cellular organisms → Bacteria | 2990 | Open in IMG/M |
3300021432|Ga0210384_11406825 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300021433|Ga0210391_10065196 | All Organisms → cellular organisms → Bacteria | 2887 | Open in IMG/M |
3300021477|Ga0210398_10446991 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300021477|Ga0210398_10834613 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300021477|Ga0210398_11065776 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300021477|Ga0210398_11460199 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300021479|Ga0210410_11263214 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300021559|Ga0210409_10777198 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300021560|Ga0126371_12578991 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300022533|Ga0242662_10186895 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300024271|Ga0224564_1042356 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300024330|Ga0137417_1131445 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300024330|Ga0137417_1311052 | All Organisms → cellular organisms → Bacteria | 3416 | Open in IMG/M |
3300024330|Ga0137417_1389984 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
3300025612|Ga0208691_1130551 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300025910|Ga0207684_11249065 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300026359|Ga0257163_1034755 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300026446|Ga0257178_1018981 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300026482|Ga0257172_1017075 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300026496|Ga0257157_1077709 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300026497|Ga0257164_1088261 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300026507|Ga0257165_1075964 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300026551|Ga0209648_10017016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6341 | Open in IMG/M |
3300026551|Ga0209648_10657216 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300026557|Ga0179587_11198772 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300027061|Ga0209729_1008074 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300027109|Ga0208603_1067916 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300027297|Ga0208241_1026145 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300027326|Ga0209731_1033087 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300027537|Ga0209419_1041937 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300027605|Ga0209329_1084621 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300027609|Ga0209221_1103840 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300027610|Ga0209528_1034207 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300027610|Ga0209528_1148360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300027629|Ga0209422_1022101 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
3300027629|Ga0209422_1124102 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300027652|Ga0209007_1150176 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300027652|Ga0209007_1173497 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300027674|Ga0209118_1190218 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300027698|Ga0209446_1127453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 657 | Open in IMG/M |
3300027729|Ga0209248_10224655 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300027737|Ga0209038_10234189 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300027768|Ga0209772_10052220 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300027768|Ga0209772_10082612 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300027768|Ga0209772_10128618 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300027795|Ga0209139_10280518 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300027829|Ga0209773_10228075 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300027829|Ga0209773_10359941 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300027867|Ga0209167_10042971 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
3300027869|Ga0209579_10372182 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300027879|Ga0209169_10719078 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300027884|Ga0209275_10354334 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300027889|Ga0209380_10673807 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300028747|Ga0302219_10149952 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300028780|Ga0302225_10174439 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300028780|Ga0302225_10483317 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300028783|Ga0302279_10244237 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300028806|Ga0302221_10296802 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300028906|Ga0308309_10380854 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300028906|Ga0308309_10817836 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300029883|Ga0311327_10445332 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300029911|Ga0311361_11420796 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300029919|Ga0302141_1023869 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
3300029943|Ga0311340_10082018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 3636 | Open in IMG/M |
3300029944|Ga0311352_11102947 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300029999|Ga0311339_10325662 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
3300030007|Ga0311338_10296696 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
3300030007|Ga0311338_11713557 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300030053|Ga0302177_10712214 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300030399|Ga0311353_10781294 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300030507|Ga0302192_10435743 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300030524|Ga0311357_10892518 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300030617|Ga0311356_10170870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2238 | Open in IMG/M |
3300030617|Ga0311356_10337671 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300030617|Ga0311356_12031092 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300030760|Ga0265762_1191066 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300031028|Ga0302180_10388316 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300031231|Ga0170824_128632797 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300031234|Ga0302325_10350752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2344 | Open in IMG/M |
3300031234|Ga0302325_11914567 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300031236|Ga0302324_103307703 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031524|Ga0302320_10166593 | Not Available | 3265 | Open in IMG/M |
3300031708|Ga0310686_109659259 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300031708|Ga0310686_114948583 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
3300031708|Ga0310686_115369529 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
3300031715|Ga0307476_10266664 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300031715|Ga0307476_10637023 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300031715|Ga0307476_11171548 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300031715|Ga0307476_11363575 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300031718|Ga0307474_10709413 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300031719|Ga0306917_10601103 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300031720|Ga0307469_11397828 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300031736|Ga0318501_10232938 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300031748|Ga0318492_10711318 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300031753|Ga0307477_10112656 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
3300031754|Ga0307475_10190261 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
3300031754|Ga0307475_10251085 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300031754|Ga0307475_11381691 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300031879|Ga0306919_11468255 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300031910|Ga0306923_11157755 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300031945|Ga0310913_11219234 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031954|Ga0306926_12838315 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300031962|Ga0307479_10434406 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300031962|Ga0307479_11164233 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300032180|Ga0307471_102189639 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300032782|Ga0335082_11208251 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300032892|Ga0335081_11471339 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300033158|Ga0335077_10307765 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.36% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.91% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.55% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.18% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.73% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.91% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.55% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.18% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.18% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.18% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.45% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.09% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.09% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.09% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.09% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.73% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.73% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.73% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.36% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.36% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.36% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004611 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1012999072 | 3300000364 | Soil | IGIFFVPAIFTLVEKWSGAGKEHVSGALPATAPAEGD* |
F24TB_123202501 | 3300000550 | Soil | VAASIIGIFFVPAIFYAVEKWSSSGKEPVSGTLPASSPATGD* |
JGI1027J12803_1072367913 | 3300000955 | Soil | SAVGIFFIPAIFYLVEKWSGGEREADSRSLPGTVVAQTGD* |
JGI1027J12803_1090765592 | 3300000955 | Soil | MVAASAVGIFFVPAIFYLVEKLSGAGKESASGILPAAPAPAPGD*RVRQRD |
JGI12650J13346_10086951 | 3300001159 | Forest Soil | ASAIGIFFIPGIFYTVEKWSGAGKEHASGMLPAAPSPAPGD* |
JGI12712J15308_101539912 | 3300001471 | Forest Soil | GGMMMASGIGIFFVPGIFYLVEKWSGAGQQPSAGTLPATPAPVPGD* |
JGI25385J37094_101877162 | 3300002558 | Grasslands Soil | SLIGIFFVPAIFYIVEKWSGAGKERASGALPAAPAPAEAD* |
JGI25617J43924_102476712 | 3300002914 | Grasslands Soil | GGMIAASAIGIFFVPAIFYLVEKWSGAGKEHASGSLPAATAPAEAD* |
JGI25616J43925_102695602 | 3300002917 | Grasslands Soil | TVFGIFLIPAIFYLVEKWSGAGKEHGLAPAPGTPAPAPGD* |
JGI26337J50220_10021664 | 3300003370 | Bog Forest Soil | ASFLGIFLVPAIFCLIEKWSGAGKKDSAAAAPATPAPAPGD* |
Ga0062385_105242342 | 3300004080 | Bog Forest Soil | AASAIGIFFIPAIFYFVERWSGAGNEAASSSLPATAVPETGD* |
Ga0062384_1002187542 | 3300004082 | Bog Forest Soil | GMLSASLIGIFFVPAIFYLVEKWSGEGKEPIATALPPMPEPAKGD* |
Ga0062384_1003466291 | 3300004082 | Bog Forest Soil | LIGIFFVPAIFYLVEKWSGAGKEPVRTALPGTPAPAEGD* |
Ga0062384_1005403281 | 3300004082 | Bog Forest Soil | AASLIGIFFVPAIFYLVEKWSGAGKESASTAVPLTPSPAEGD* |
Ga0062387_1015016892 | 3300004091 | Bog Forest Soil | SIIGIFFVPAVFYLVEKWSGAGKEAVGATSLPRTSAPAEAD* |
Ga0062387_1016066051 | 3300004091 | Bog Forest Soil | LIGIFFVPAIFYLVEKWSGAGREPISATLPGTAAPAEGD* |
Ga0062389_1032012132 | 3300004092 | Bog Forest Soil | ASAFGIFFVPGIFYLVEKLSGAGQEHMAAPLPKTPSPEPGD* |
Ga0062389_1032861061 | 3300004092 | Bog Forest Soil | AASFLAIFLVPAIFYLVEKWSGAGKKDAAAAAPPAPAPAPGD* |
Ga0068925_12509612 | 3300004611 | Peatlands Soil | AASALGIFFVPAIFYLVEKWSGAGKEPASGSLPATPAPVPGD* |
Ga0070714_1020652342 | 3300005435 | Agricultural Soil | AASVIGIFFVPAIFYAVEKWSSFGKEPASGTLEAPSPATGD* |
Ga0070663_1015372002 | 3300005455 | Corn Rhizosphere | AASGIGIFFVPAIFYLVEKWSGAGREHIAASLPQKQTPVEAD* |
Ga0070706_1006903032 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SVIGIFFVPAIFYLVEKWSDAGKEHVSGALPAAPAAAEGD* |
Ga0070730_107664342 | 3300005537 | Surface Soil | GIFFIPAIFYLVEKWSGADNERAAGSVPAEPLPAPGD* |
Ga0070733_104984572 | 3300005541 | Surface Soil | FFVPVIFYVVEKWSGASTESAPTAAPDAPAPAPGD* |
Ga0070732_109531142 | 3300005542 | Surface Soil | LAASLIGIFFVPAIFFLVEKWSGAGKEHTAVASPITPAPQEGD* |
Ga0066661_108997361 | 3300005554 | Soil | AASVIGIFFVPAIFYLVEKWSGAGKQQVPVALPAAPTPAEAD* |
Ga0066704_104023392 | 3300005557 | Soil | VIGGMIAASAIGIFFVPGVFYMVEKWSGAGKQPESGMLPASPSPVPGD* |
Ga0066700_110713172 | 3300005559 | Soil | ASVIGIFFVPAIFYLVEKWSGAGKEHASGTLPATPAPAEAD* |
Ga0070761_100665981 | 3300005591 | Soil | MIAASAIGIFFVPGIFYLVEKWSGAGKEPASGPLPAAPAPAPGD* |
Ga0070761_105680002 | 3300005591 | Soil | ASFLAIFLVPAIFYLVEKWSGAGKKDAAAAAPQTPAPAPGD* |
Ga0070766_103165711 | 3300005921 | Soil | LGIFFIPAIFYLVEKWSGADKERAEGSLPAEPAPAPGD* |
Ga0070766_103871242 | 3300005921 | Soil | MVAASAIGIFFIPGIFYVVEKWSGAGKESASGILPAAPSPAPGD* |
Ga0070766_104413482 | 3300005921 | Soil | AASLIGIFFVPAIFYLVEKWSGASSKESASSALPGTPAPAEGD* |
Ga0066790_100912222 | 3300005995 | Soil | MMAASAVGIFFIPGIFYLVEKWSGAGKEPASGTLPTTPVPVPGD* |
Ga0066656_105814692 | 3300006034 | Soil | ASVIGIFFVPAIFYAVEKWSSSGKELGSGTLPASSPATGD* |
Ga0075029_1002485432 | 3300006052 | Watersheds | ASAVGIFFVPGIFYMVEKWSAAGKEPEAGILPVTPSPAPGD* |
Ga0075015_1009938802 | 3300006102 | Watersheds | SAIGIFFVPAIFFMVEKWSGAGKERASGALPATPAPAEAD* |
Ga0075030_1002424482 | 3300006162 | Watersheds | AAASALGIFFIPAIFYMVEKWSGAENERAAGSAPAEPLPAPGD* |
Ga0070715_102727732 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | IFFVPAIFYLVEKWSAGKEPEAGILPVTPSPAAGD* |
Ga0070765_1012029862 | 3300006176 | Soil | AASVIGIFFVPSIFYLVEKWSGAGKEEVSGALPATPAPAEGD* |
Ga0075433_100918213 | 3300006852 | Populus Rhizosphere | LAASVIGIFFVPAIFYLVEKWSGVGKEQVSGTLPTTLAPAEGD* |
Ga0099793_100909581 | 3300007258 | Vadose Zone Soil | ASAIGIFFVPAIFYLVEKWSGAGKEQAPGALPAEPAPAPAD* |
Ga0099793_101796462 | 3300007258 | Vadose Zone Soil | MLAASVIGIFFVPAIFYLVEKWSGAGKERVPEALPTGPTPAEAD* |
Ga0099794_104225851 | 3300007265 | Vadose Zone Soil | LIPAIFYLVEKWSGAGKERGLAGAPGTPAPAPGD* |
Ga0099829_104830071 | 3300009038 | Vadose Zone Soil | ASAIGIFFIPAIFYMVEKWSGADKERATGSLPAATAPAPGD* |
Ga0099829_115107771 | 3300009038 | Vadose Zone Soil | MLAASAFGIFLIPPIFYLVEKWSGAGKESGRAEVPATPSPAAGD* |
Ga0099830_104186772 | 3300009088 | Vadose Zone Soil | AATVFGIFLIPAIFYLVEKWSGAGKEHGLAPAPGTPAPAPGD* |
Ga0099828_103399491 | 3300009089 | Vadose Zone Soil | AATVFGIFLIPAIFYLVEKWSGAGKERGLAGAPGTPAPAPGD* |
Ga0099827_107350132 | 3300009090 | Vadose Zone Soil | AIFLIPAIFYLVEKWSGAGKERVSRALPATPAPAEGD* |
Ga0099792_111645782 | 3300009143 | Vadose Zone Soil | FGIFLIPAIFYLVEKWSAGKERGLAEVPATPSPAPGD* |
Ga0111538_106695631 | 3300009156 | Populus Rhizosphere | GIGIFFVPAIFYLVEKWSGAGREHIAASLPQKQTPVEAD* |
Ga0116133_11080152 | 3300009623 | Peatland | MGTAVIGGMVAASAIGIFFIPGIFFMVEKWTSAGKESSSGILPAAPSPAPGD* |
Ga0116117_10296362 | 3300009635 | Peatland | FLVPAIFYLIEKWSGAGKKDAAAAAPAMPAPASGD* |
Ga0126380_106234823 | 3300010043 | Tropical Forest Soil | MLAASGIGIFFVPVIFYLVEKWSGAEKEHAARALPSAVPSEAD* |
Ga0126373_105869572 | 3300010048 | Tropical Forest Soil | AAASVIGIFFVPAIFYLVEKWSGTRKEEAPGAVPETSPAPGD* |
Ga0126370_123759392 | 3300010358 | Tropical Forest Soil | AASVIGIFFVPAIFYAVEKWLSSGRELASGMLAARSPATGD* |
Ga0126376_104225342 | 3300010359 | Tropical Forest Soil | GMVAASVIGIFFVPAIFYAVEKWSSSGKEPASGTLPAPSPDTGD* |
Ga0126378_125513882 | 3300010361 | Tropical Forest Soil | LAASFIGIFLVPAIFYLVERVSGAGREHSPAILPPTTAPAEGD* |
Ga0126378_126189171 | 3300010361 | Tropical Forest Soil | GMMAASLIGIFFVPAIFCVVEKVSGSEKEHTRAILPHEPAPAKGD* |
Ga0136449_1043183892 | 3300010379 | Peatlands Soil | FIGNFFVPDLFYMVEKWSSTSKERASGALPATPSPAPGD* |
Ga0134126_117762712 | 3300010396 | Terrestrial Soil | GGMMAASALGIFFVPGIFYLVEKWSGAGEHASVPLPKTPSPETGD* |
Ga0126383_111992252 | 3300010398 | Tropical Forest Soil | VGIFFVPAVFYMVEKWSGAAREPEAGTLPASRSPVPGD* |
Ga0126361_100352042 | 3300010876 | Boreal Forest Soil | LIPGIFYLVEKWSGAGKEPASGTLPTTPVPVPGD* |
Ga0150983_139002381 | 3300011120 | Forest Soil | ASAIGIFFVPAIFYLVEKWSGAGKERASGALPATPTPVEAD* |
Ga0137392_100158711 | 3300011269 | Vadose Zone Soil | IFFIPAIFYLVEKWSGAGKEHAPGALPAAPAPAEAD* |
Ga0137392_112582982 | 3300011269 | Vadose Zone Soil | LAASAIGIFLIPAIFYLVEKLSGAGREHAAAILPQNPAPAQGD* |
Ga0137391_102214473 | 3300011270 | Vadose Zone Soil | IFFIPAIFCLVEKWSGAGKEHVSGALPATPAPAEGD* |
Ga0137391_107254061 | 3300011270 | Vadose Zone Soil | GMLAASAIGIFLIPAIFYLVEKLSGAGREHAAAILPQNPAPAQGD* |
Ga0137393_117170892 | 3300011271 | Vadose Zone Soil | MLAASVIGIFLIPAIFYLIEIWSGAGKERAPAALPAAPAPAKGD* |
Ga0137388_109977292 | 3300012189 | Vadose Zone Soil | GSAIGIFFIPAIFYMVEKWSGAGKEHASGALPAAPAPAEAD* |
Ga0137388_118364601 | 3300012189 | Vadose Zone Soil | VIGIFFVPAIFTLVEKWSGAGKEHVPGTLPATPAPAGGD* |
Ga0137383_101870561 | 3300012199 | Vadose Zone Soil | IGIFFVPAICYLGEKWSGAGKEPASGGVPGAPAPAEAD* |
Ga0137363_101230463 | 3300012202 | Vadose Zone Soil | RLAATVFGLFLSPAGFYLVEEWFAGKTRGLAVVPATPSPAPGD* |
Ga0137363_104088331 | 3300012202 | Vadose Zone Soil | SAIGIFFVPAVFYMVEKWSGTGKEFDSPALPAPPEPAEGD* |
Ga0137363_107946101 | 3300012202 | Vadose Zone Soil | SAIGIFFVPAIFYLVEKWSGAGKEQASRALPGEPAPAPAD* |
Ga0137399_104296432 | 3300012203 | Vadose Zone Soil | FFIPAIFYLVEKWSGAGKEHVSRALPATPAPAEGD* |
Ga0137399_104434672 | 3300012203 | Vadose Zone Soil | GIFFIPAIFYLVEKWSGAGKEHASGALPAAPAPAEAD* |
Ga0137362_100052731 | 3300012205 | Vadose Zone Soil | IGIFFVPAIFYLVEKWSGAGKERASGALPAAPAPAEAD* |
Ga0137362_103992001 | 3300012205 | Vadose Zone Soil | IFFVPAIFYLVEKWSGAGKERVPTALPGTPAPAEGD* |
Ga0137380_114032792 | 3300012206 | Vadose Zone Soil | ASVVGIFFVPAIFYLVEKWSGAGKEHAAGALPAAPAPAEAD* |
Ga0137381_107144222 | 3300012207 | Vadose Zone Soil | LAASALGIFFIPAIFYLVEKWSGAAKERVRAGAPGTPATAEGN* |
Ga0137379_105157051 | 3300012209 | Vadose Zone Soil | AASVIGIFFVPAIFYLVEKWSGAGKEPVSGALPASPAPAEAD* |
Ga0137378_102882361 | 3300012210 | Vadose Zone Soil | IFFVPAIFYLVEKWSGAGKEPVSGALPASPAPAEAD* |
Ga0137370_107796092 | 3300012285 | Vadose Zone Soil | FFVPAIFYLVEKWSGAGKERVPEALPTGPTPAEAD* |
Ga0137386_109955252 | 3300012351 | Vadose Zone Soil | FFVPAIFYLVEKWSGAGKEPASGPLPATSAPAEAD* |
Ga0137360_104324412 | 3300012361 | Vadose Zone Soil | LAASVIGIFLIPVIFYLVEKWSGAGKEHAPAAVPATPAPAPGD* |
Ga0137360_104644361 | 3300012361 | Vadose Zone Soil | LGIFFIPAIFYFVEKWSGAGKEHASGALPAAPTPAEAD* |
Ga0137360_109455272 | 3300012361 | Vadose Zone Soil | FFIPAIFYLVEKWSGAGKEHVSGALPAAPAPAEAD* |
Ga0134052_11835872 | 3300012393 | Grasslands Soil | FFVPAIFYLVEKWSGAGKEPVSGALPASPAPAEAD* |
Ga0137358_102163021 | 3300012582 | Vadose Zone Soil | MLAASAIGIFFVPAIFYLVEKWSGAGKEQAPGALPAEPAPAPAD* |
Ga0137398_104574271 | 3300012683 | Vadose Zone Soil | SVIGIFLIPAIFYLVEKWSGAGKELAPSVLPAAPAPAEGEGD* |
Ga0137397_104884092 | 3300012685 | Vadose Zone Soil | IFLIPAIFYLVEKWSGAGKEHGLAPAPGTPAPAPGD* |
Ga0137397_105388191 | 3300012685 | Vadose Zone Soil | AASVIGIFFVPAIFCLVEKWSGAGKEHVSGALPATPAPAEGD* |
Ga0137397_109743422 | 3300012685 | Vadose Zone Soil | CAIGIFFIPAIFYLVEKWSGAGKEHASGALPAAPAPAEAD* |
Ga0137395_102218732 | 3300012917 | Vadose Zone Soil | IGIFFIPAIFYLVETLSGAGKEHTAEILPQTPAGAEGD* |
Ga0137396_102835602 | 3300012918 | Vadose Zone Soil | IGIFFVPAIFYLVEKWSGAGKEHVSGALPATPAPAEGD* |
Ga0137396_108974881 | 3300012918 | Vadose Zone Soil | IFFVPAIFYLVEKWSGAGKERAPGTLPAAPTPAEAD* |
Ga0137359_100627741 | 3300012923 | Vadose Zone Soil | ASVIGIFFVPAIFYLVEKWSGAGKERVSGSLPATSARAEAD* |
Ga0137413_117823122 | 3300012924 | Vadose Zone Soil | AASALGIFFIPAIFYMVEKWSGADKERAGGSLPAEPAPAPGD* |
Ga0137419_109305611 | 3300012925 | Vadose Zone Soil | VIGIFFVPAIFCLVEKWSGAGKEHVSGVLPATPAPAEGD* |
Ga0137419_119067232 | 3300012925 | Vadose Zone Soil | FIPAIFCLVEKWSGAGKEHVSGALPATPAPAEGD* |
Ga0137416_114936482 | 3300012927 | Vadose Zone Soil | GIFFIPAIFYLVEKWSGAGKEHVSGALPATPAPAEGD* |
Ga0137404_105201071 | 3300012929 | Vadose Zone Soil | ASVIGIFFVPAIFTLVEKWSGAGKEHVPGALPATPAPAEGD* |
Ga0137404_110459141 | 3300012929 | Vadose Zone Soil | VIGIFFVPAIFYLVEKWSGAGRELAPTSLPGPSVPAEGD* |
Ga0137407_105000432 | 3300012930 | Vadose Zone Soil | FFIPAIFYMVEKWSGADKERAGGSLPAEAAPAPGD* |
Ga0137407_121898322 | 3300012930 | Vadose Zone Soil | MLAASVIGIFFVPAIFYLVEKWSGAGKERASGALPAAPTPAEAD* |
Ga0181531_102267822 | 3300014169 | Bog | GMLAASAIGIFFIPAIFYGVEKWLNSAEEPAPSAVPATLPATGD* |
Ga0137411_10562182 | 3300015052 | Vadose Zone Soil | VIGIFFVPAIFYLVEKWSGAGKEHVSGALPAAPAPAPGD* |
Ga0137411_13127377 | 3300015052 | Vadose Zone Soil | MLAASCIGIFFIPAIFYLVEKWSGAGKEVASSSLPTTPAAEMGD* |
Ga0137411_13297967 | 3300015052 | Vadose Zone Soil | MLAGCAIGIFFIPAIFYLVEKWSGAGKEHASGALPAAPAPAEAD* |
Ga0134089_103478951 | 3300015358 | Grasslands Soil | IFFVPAIFYIVEKLSGAGKERASGALPAAPAPAEAD* |
Ga0132258_117255132 | 3300015371 | Arabidopsis Rhizosphere | ASVIGIFFVPAVFYAVEKWSSSGKEAASGTLPASSPATGD* |
Ga0181503_11334791 | 3300016698 | Peatland | GGMIAASAIGLFLVPGIFYVVEKWSGAGQEPAPDIMRASPSPAPGD |
Ga0187802_104625841 | 3300017822 | Freshwater Sediment | MLAASFIGIFFVPAIFYLVEKWSGAGKERVSGALPATPSPAPGD |
Ga0187818_100586201 | 3300017823 | Freshwater Sediment | ASVIGIFFVPAIFFLVEKWSGASKEQSPTALPGTPAPAEGD |
Ga0187818_101071692 | 3300017823 | Freshwater Sediment | FFIPGIFYMVEKWTSAGKEPASGMLPAAPSPAPGD |
Ga0187806_11853492 | 3300017928 | Freshwater Sediment | FFVPGVFYMVEKWSGAEKEHLAGALPATPAPSEAD |
Ga0187801_101096531 | 3300017933 | Freshwater Sediment | IGIFFIPGIFYMVEKWTSAGKEPASGMLPAAPSPAPGD |
Ga0187817_107077762 | 3300017955 | Freshwater Sediment | GIFFVPAIFYLVEKWSGAGKERVSGALPATPSPAPGD |
Ga0187778_101069981 | 3300017961 | Tropical Peatland | GMMAASAIGIFFVPGIFYMVENWSGAGKQPESGMLPTPSPAPGD |
Ga0187778_104340971 | 3300017961 | Tropical Peatland | AIGIFFVPAVFYLVEKWSGARSEPATGSLPAAPEPVPGD |
Ga0187778_105052462 | 3300017961 | Tropical Peatland | GVFFLPAIFYMVEKWAGTEPASGALPTAPAPEPGD |
Ga0187778_108947531 | 3300017961 | Tropical Peatland | GMLAASLIGIFFVPAIFYLVEKWSRVGTEAASGALPAATEPAPGD |
Ga0187874_100479073 | 3300018019 | Peatland | FFVPAIFYMVERWSGASQERVPNAIPGTPAPAEGD |
Ga0187869_100288261 | 3300018030 | Peatland | GMMAASAIGIFFVPAIFYLVEKWSGAGKEAASSSLPTTAVPETGD |
Ga0187863_105498712 | 3300018034 | Peatland | MLAASLIGIFFVPGIFYLVEKWSGARNEPASGTLPAQPAPAPAD |
Ga0187855_107106992 | 3300018038 | Peatland | MMAASLIGIFFVPAIFYLVEKWSGAGTEPVRNALPGTPAPAEGD |
Ga0187871_101705412 | 3300018042 | Peatland | LAASFIAIFLVPAIFYLVEKWSGAGKEPAPGGVQPTPAPAEGD |
Ga0187859_100660462 | 3300018047 | Peatland | VIGIFFVPAIFFLVEKWSGASKERIAAALPGTAAPAEGD |
Ga0187765_101307011 | 3300018060 | Tropical Peatland | TAVIGGMFAASAMGIFFVPGIFYMVETWSGAGKEPASNTLPARPSPAPGD |
Ga0187784_105965721 | 3300018062 | Tropical Peatland | MAAASLIGIFFVPAIFYVVEKRSGAGKEPALTGMPQMRQMLA |
Ga0187771_103076702 | 3300018088 | Tropical Peatland | FFVPAIFYLVEKWSGVTQQETPTAFPATPAPETVD |
Ga0187770_112137801 | 3300018090 | Tropical Peatland | SFIGIFFVPGVFYLVEKWSRAGQEHAGGALPATPAPAETD |
Ga0066655_112902821 | 3300018431 | Grasslands Soil | TIRILFVPAIFYLVEKWSGAGKEHVPGALPATPAPAEGD |
Ga0181514_15595372 | 3300019268 | Peatland | ASLIGIFFVPAIFFMVEKWSSSETVPKSAAVPGAPAPAEGD |
Ga0190267_116465021 | 3300019767 | Soil | ASGIGIFFVPAIFCLVEKWSGAGREHVAASLPQRQAPAEAD |
Ga0137408_10315411 | 3300019789 | Vadose Zone Soil | NILYIPAIFCLVEKWSGAGKEHVSGALPAAPAPAEGD |
Ga0179592_103148462 | 3300020199 | Vadose Zone Soil | IIGIFFVPGVFYLVEKWSGAGKEHATGALPATPSPAPGD |
Ga0179592_103802151 | 3300020199 | Vadose Zone Soil | SALGIFFIPAIFYMVEKWSGADKERAGGSLPAEPAPAPGD |
Ga0210407_100660701 | 3300020579 | Soil | GMLTASAIGIFFIPGIFYMVEKWSGAGKEPASTILPAAPSPALGD |
Ga0210407_107614692 | 3300020579 | Soil | MAAASALGIFFIPAIFYMVEKWSGADKERAAGSLPAEPLPAPGD |
Ga0210403_100110621 | 3300020580 | Soil | IFFSPAIFYMVEKWSGADKERAAGSLPAEPLPAPGD |
Ga0210403_100188735 | 3300020580 | Soil | AASALGIFFIPAIFYFVEKWSGADKERAEGSLPAEPAPAPGD |
Ga0210403_110378042 | 3300020580 | Soil | GGMLAASAIGIFFIPAIFYLVEKWSGAGKEHASGALPAAPAPAEAD |
Ga0210403_114764782 | 3300020580 | Soil | GMAAASALGIFFIPAIFYFVEKWSGADKERAAGSLPAEPAPAPGD |
Ga0210399_111349592 | 3300020581 | Soil | AIGIFFVPAIFYLVEKWSGAGKQSPSGALPAAPAPAEAD |
Ga0210399_111898842 | 3300020581 | Soil | GIFFVPAIFYLVEKWSSAEQAPGTLPAEPSPAPGA |
Ga0210395_109685491 | 3300020582 | Soil | GIFFIPGIFYVVEKWSGAGKESASGILPAAPSPAPGD |
Ga0210395_110912681 | 3300020582 | Soil | IGIFLIPVIFYLVEKWSGASTQPASAGAEPSPAPAPGD |
Ga0210401_113906881 | 3300020583 | Soil | ASVIGIFLIPAIFYLVEKWSGAGKEHAPSAVPATPAPATGD |
Ga0179596_101765192 | 3300021086 | Vadose Zone Soil | AASIIGIFFVPGVFYLVEKWSGAGKEHATGALPATPSPAPGD |
Ga0210404_108695011 | 3300021088 | Soil | IFLIPAIFYLVEKWSGAGKERGPAELPVTPSPAPGD |
Ga0210406_100586494 | 3300021168 | Soil | FFIPAIFYMVEKWSGADKERAAGSLPAEPLPAPGD |
Ga0210400_107911292 | 3300021170 | Soil | LAASFIGIFLVPAIFYLVERVSGAGKERAPAILPRTPAPAEGD |
Ga0210405_101968521 | 3300021171 | Soil | IGIFFVPAIFYVVEKWSGAGKEPASGIVPAAPSPAPGD |
Ga0210408_113730372 | 3300021178 | Soil | FFVPAIFYLVEKWSGAGKEQASGALPAEPAPAPAD |
Ga0210396_116234991 | 3300021180 | Soil | IAASAIGIFFVPAIFYMVEKWSGAGKEHASGALPASPAPAEAD |
Ga0210388_102914132 | 3300021181 | Soil | MLAASVFGIFLIPPIFYLVEKWSGAGKQAGPSEAPATPSPASGD |
Ga0210385_103730382 | 3300021402 | Soil | MAASAIGIFFVPAIFYAVEKWSGAGKEPASGIFPEATSPAPGD |
Ga0210385_103904502 | 3300021402 | Soil | AIFLVPAIFYLVEKWSGAGKEPAPGGVQPSPAPAEGD |
Ga0210385_106488191 | 3300021402 | Soil | SFIGIFLIPVIFYLVEKWSGAGKEPVPAGAQTTPAPAQGD |
Ga0210385_112036891 | 3300021402 | Soil | IFFVPAIFYLVEKWSGAGREHAPGALPAEPAPAPGD |
Ga0210397_103435851 | 3300021403 | Soil | ASVIGIFLIPVIFYLVEKWSGVGKEHASAAVPATPAPAPGD |
Ga0210386_103799441 | 3300021406 | Soil | FFVPAIFYLVEKWSGAGKEHAPGALPAEPAPAPGD |
Ga0210394_103108061 | 3300021420 | Soil | AASFIGIFLIPAIFYLVEKWSGAGRERASTEGSPAPAPAPGD |
Ga0210384_100068331 | 3300021432 | Soil | IAASALGIFFIPAIFYLVEKWSGADKERAEGSLPAEPAPAPGD |
Ga0210384_100774591 | 3300021432 | Soil | VIGGMVAASAIGIFFVPAVFYMVEKWSGTGKENVSPVLPAPPEPAEGD |
Ga0210384_114068252 | 3300021432 | Soil | IFLVPAIFYLVEKWSGAGKEHAPAGLPASPEPAKGD |
Ga0210391_100651961 | 3300021433 | Soil | GPPRILGMMAASIIGIFFVPAIFYLVEKWPGGEKDHAALASPAAPAPAEGD |
Ga0210398_104469911 | 3300021477 | Soil | LGIFFIPAIFYMVEKWSGADKERAAGSLPVEPAPAPGD |
Ga0210398_108346131 | 3300021477 | Soil | AIGIFFVPGIFYMVEKWAGAGQEPASGAVPATPSPAPGD |
Ga0210398_110657761 | 3300021477 | Soil | FFVPAIFYMVEKWSGAGTEHAAGALPAAAAPAPAEAD |
Ga0210398_114601992 | 3300021477 | Soil | IGIFFVPAVFYMVEKWSGARGEQVSPALPAAPEPAEGD |
Ga0210410_112632142 | 3300021479 | Soil | SFIGIFLIPAIFYLVEKWSGAGKEHAPAATALPAPAPGD |
Ga0210409_107771981 | 3300021559 | Soil | LAGTVFAIFLIPAIFYLVEKWSGAGNEQAPTVLPAAPAPAEGEGD |
Ga0126371_125789911 | 3300021560 | Tropical Forest Soil | LAASVIGIFFVPAIFYMVERWSGAGEEPVAGALPAAPEPTPGD |
Ga0242662_101868952 | 3300022533 | Soil | ASAIGIFLIPVIFYLVEKWSGAGKEHAPAVMPATPEPAPGD |
Ga0224564_10423561 | 3300024271 | Soil | SFLAIFLVPVIFYLVEKWSGAGKKDAAAAAPAMPAPAPGD |
Ga0137417_11314452 | 3300024330 | Vadose Zone Soil | FGIFLIPAIFYLVEKWSGAGKEHGLAPAPGTPAPAPGD |
Ga0137417_13110522 | 3300024330 | Vadose Zone Soil | MLAATVFRIFLIPAIFYLVEKWSGAGKEHGLAGAPGTTCSGAGRLR |
Ga0137417_13899841 | 3300024330 | Vadose Zone Soil | MLAATVFGIFLIPAIFYLVEKWSGAGKEHGLAPAPGTPAPAPGD |
Ga0208691_11305511 | 3300025612 | Peatland | VGGMLAASLIGIFFVPAIFFMVEKWSGAGRERAARSPASSSPASAAPAEAD |
Ga0207684_112490651 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GIFFVPAIFYLVEKWSGGDKERVSGALPTTPSPAEAD |
Ga0257163_10347552 | 3300026359 | Soil | MLAGSVIGIFLIPAIFYLVEKWSGAGKELAPSVLPATPAPAEGEGD |
Ga0257178_10189811 | 3300026446 | Soil | GIFFVPGVFYLVEKLSGAGKEHATGAMPATPSPAPGD |
Ga0257172_10170752 | 3300026482 | Soil | FLIPAIFYLVEKWSGAGKELAPSVLPAAPAPAEGEGD |
Ga0257157_10777091 | 3300026496 | Soil | FLIPAIFYLVEKWSGAGKELAPSVLPATPAPAEGEGD |
Ga0257164_10882611 | 3300026497 | Soil | LGIFFIPAIFYLVEKWSGADKERASGSLPAETAPAPGD |
Ga0257165_10759642 | 3300026507 | Soil | FLIPAIFYLVEKWSGAGKEHGLAPAPGTPAPAPGD |
Ga0209648_100170161 | 3300026551 | Grasslands Soil | AGCAIGIFFIPAIFCLVEKWSGAGKEHVSGALLATPAAAEGD |
Ga0209648_106572162 | 3300026551 | Grasslands Soil | IFFIPAIFYLVEKWSGAGKEHASGALPAAPAPAEAD |
Ga0179587_111987721 | 3300026557 | Vadose Zone Soil | GIFFIPAIFCLVEKWSGAGKEHVSGALPAAPAPAEGN |
Ga0209729_10080741 | 3300027061 | Forest Soil | AASAIGIFFVPAIFYVVEKWSGAGKEPASGMLPATPSPAPGD |
Ga0208603_10679162 | 3300027109 | Forest Soil | ASAIGIFFVPGIFYMVEKWSGAGKERISTAPPQTAAPAEGD |
Ga0208241_10261451 | 3300027297 | Forest Soil | LAASLIGIFFVPAIFFLVEKWSGAGKEHASGTLPASPAPAETD |
Ga0209731_10330871 | 3300027326 | Forest Soil | MLAASIIAIFLVPAIFYLVEKWSGAGKEPAAAAGLSSTPGPAPGD |
Ga0209419_10419372 | 3300027537 | Forest Soil | GIFFVPAIFYLVEKWSGAGKEHASGALPAAAAAAEAD |
Ga0209329_10846211 | 3300027605 | Forest Soil | LAASVIGIFLIPAIFYLVEKWSGADKEHAPSSVPATPAPATGE |
Ga0209221_11038401 | 3300027609 | Forest Soil | GGMMLASAVGIFFVPAVFYLVEKWSGTGKERASGELPAAPAPAPGD |
Ga0209528_10342072 | 3300027610 | Forest Soil | SLIGIFFVPAIFYLVERWSGAGKEPVPAELPATPEPAEGD |
Ga0209528_11483602 | 3300027610 | Forest Soil | SVIGIFLIPVIFYLVEKWSGAGKEHASAIVPATPAPAPGD |
Ga0209422_10221011 | 3300027629 | Forest Soil | IIGIFFVPAIFFLVEKWSGAGKEQASGALPAEPAPAPAD |
Ga0209422_11241021 | 3300027629 | Forest Soil | MLAASVIGIFLIPAIFYLVEKWSGAGNEHAPSPVPATPAPATGD |
Ga0209007_11501761 | 3300027652 | Forest Soil | AVIGGMVAASAIGIFFVPGIFYMVEKWAGAGQQPASGAVPATPSPAPGD |
Ga0209007_11734971 | 3300027652 | Forest Soil | AASIIGIFFVPAIFYLVEKWSGGEKDHAALASPAAPAPAEGD |
Ga0209118_11902181 | 3300027674 | Forest Soil | ATVFGIFLIPAIFYLVEKWSGAGKEHGLAPAPGTPAPAPGD |
Ga0209446_11274531 | 3300027698 | Bog Forest Soil | GIFLVPAVFYLVEKWSGPGKEPASGPLPAMPTPVPGD |
Ga0209248_102246552 | 3300027729 | Bog Forest Soil | LAASFIAIFLVPAIFYLVEKWSGAGKEPAAGGVQTRPAPAEGD |
Ga0209038_102341892 | 3300027737 | Bog Forest Soil | AASAIGIFLVPAIFYMVEKYSGADVERAAGTLSANPAPKGGD |
Ga0209772_100522202 | 3300027768 | Bog Forest Soil | AASALGIFFIPAIFYLVEKWSGAEKQHAPGTLPAAPEPARGD |
Ga0209772_100826121 | 3300027768 | Bog Forest Soil | LIGIFFVPAIFYMVEKWSGAGKDPAPTSLPGIPAPAEGD |
Ga0209772_101286181 | 3300027768 | Bog Forest Soil | FFVPGIFYMVEKWSGAGPEHAAGALPATPAPAPAEGD |
Ga0209139_102805182 | 3300027795 | Bog Forest Soil | ASLIGIFFVPAIFYMVEKWSGAGKEQASAAVPGTPAPAEGD |
Ga0209773_102280752 | 3300027829 | Bog Forest Soil | ASAIGIFFIPGIFYLVEKWSGAGKEPAPGALPATPATAPGD |
Ga0209773_103599411 | 3300027829 | Bog Forest Soil | VPGIFYMVEKWSGAGKEHAPGTLPATPAPAPAEGD |
Ga0209167_100429713 | 3300027867 | Surface Soil | MLASSFLAIFLVPVIFYLVEKWSGAGKKDAAAAAPAMPAPAPGD |
Ga0209579_103721821 | 3300027869 | Surface Soil | GGMLAASAIGIFFIPAIFYLVEKLSGAGKEHVAVILPQIPEPVQGD |
Ga0209169_107190782 | 3300027879 | Soil | AMGIFFIPGIFYIVEKWSGAGKEPAPGIVPATPSPAPGD |
Ga0209275_103543341 | 3300027884 | Soil | IFFVPAIFYAVEKWSGAGKEPAPGMLPGTPSPAPGD |
Ga0209380_106738072 | 3300027889 | Soil | IFFVPAIFYVVEKWSGAGKEPASGMLPGTPSPAPGD |
Ga0302219_101499521 | 3300028747 | Palsa | LAASAIGIFFIPGIFYMVEKWTSAGKETASGILPPAPSPAPGD |
Ga0302225_101744391 | 3300028780 | Palsa | LTASAMGIFFIPGIFYIVEKWSGAGKETASGILPAAPSPAPGD |
Ga0302225_104833171 | 3300028780 | Palsa | GIFFVPAIFYLVEKWSGAGKEPVRTVLPGTPAPAEGD |
Ga0302279_102442371 | 3300028783 | Bog | IGIFFIPAIFYLVEKWSGARREAASSSLPATAVPEAGD |
Ga0302221_102968022 | 3300028806 | Palsa | LIGIFFVPAIFYLIEKWSGADEEHVSGALPTTPAPAEGD |
Ga0308309_103808541 | 3300028906 | Soil | SAFGIFFVPGIFYLVEKLSGAGQEHVVASLPKTPSPEPGD |
Ga0308309_108178362 | 3300028906 | Soil | GGMLPARAIGIFFIPGIFYMVEKWSGAGKEPASGVLPAAPSPAPGD |
Ga0311327_104453321 | 3300029883 | Bog | GGMLAASTVGIFFIPAIFYLVEKWSGARSEAPSSSLPVTPVPEAGD |
Ga0311361_114207962 | 3300029911 | Bog | GIGIFFVPGIFYLVEKLSGAGKESVPGMMPATPAPAPGD |
Ga0302141_10238691 | 3300029919 | Bog | AASAIGIFFIPAIFYLVEKWSGARREAASSSLPATAVPEAGD |
Ga0311340_100820181 | 3300029943 | Palsa | AASAIGIFFVPGIFYMVEKWSGAGKEAASGILPAAPSPAPGD |
Ga0311352_111029472 | 3300029944 | Palsa | MLAASAIGIFFVPGIFYMVEKWSGAGKEAASGILPAAPSPAPGD |
Ga0311339_103256622 | 3300029999 | Palsa | MLAASLIGIFLIPAIFYLVEKWSGAGTEHAVSGTPETPAPAPGD |
Ga0311338_102966961 | 3300030007 | Palsa | AIGIFFVPGIFYMVEKWSGAGKEAAPGILPVAPSPAPGD |
Ga0311338_117135571 | 3300030007 | Palsa | GIFFVPAIFYLVEKWSGAGGQPAPAALRETTVASEGD |
Ga0302177_107122142 | 3300030053 | Palsa | LAASLVGIFFVPAIFYLVEMWSGAGGQPAPAALRETTVASEGD |
Ga0311353_107812941 | 3300030399 | Palsa | GGMLAASAFGIFFVPGIFYLVEKLSGAGQEHMAAPLPKTPSPETGD |
Ga0302192_104357431 | 3300030507 | Bog | AASTVGIFFIPAIFYLVEKWSGARSEAPSSSLPVTPVPEAGD |
Ga0311357_108925181 | 3300030524 | Palsa | GMLAASLVGIFFVPAIFYLVEKLSGAGKHPAPAALRETTVASEGD |
Ga0311356_101708702 | 3300030617 | Palsa | TASAIGIFFIPGIFYIVEKWSGAGKEPAPGVVPATPSPAPGD |
Ga0311356_103376712 | 3300030617 | Palsa | GGMMAASAIGIFFVPGIFYLVEKWSGGKEQAAEQLPGTPTLVEGD |
Ga0311356_120310921 | 3300030617 | Palsa | IFFVPAIFYMVEKWSGAGKHPAPAALRETTVASEGD |
Ga0265762_11910662 | 3300030760 | Soil | AASFIAIFLVPAIFYLVEKWSGAGREPAAAGLPPKPAPAEGD |
Ga0302180_103883162 | 3300031028 | Palsa | GIFFVPAIFYLVEKWSGAAQQPAATPLPRSPAPSEGD |
Ga0170824_1286327972 | 3300031231 | Forest Soil | GIFFVPAIFYLVEKWSGADKERVSGALPATPSPAPGD |
Ga0302325_103507523 | 3300031234 | Palsa | MAASSLIGIFFVPAIFYLVEKWSGAGKQPAAAAIPQTPAPSEGD |
Ga0302325_119145672 | 3300031234 | Palsa | LAASGIGIFFVPGIFYMVEKWSGAGKEAAPGILPVAPSPAPGD |
Ga0302324_1033077032 | 3300031236 | Palsa | IGGMLAASAIGIFFIPGIFYLVEKWSGAGKEPASGIVRVTPSPAPGD |
Ga0302320_101665931 | 3300031524 | Bog | AIAIFFIPVIFYLVERIAGKKPAAPAAAAPAPAPEH |
Ga0310686_1096592592 | 3300031708 | Soil | ASAIGIFFIPGIFYMVEKWSGAGKEPASGVVPATPSPAPGD |
Ga0310686_1149485831 | 3300031708 | Soil | IFLVPAIFYLVEKWSGAGREPAAAGLPPKPAPAEGD |
Ga0310686_1153695291 | 3300031708 | Soil | MLTASLIGIFFVPAISYMVEKWSGAGKHPAPAALRETTVASEGD |
Ga0307476_102666642 | 3300031715 | Hardwood Forest Soil | MIAASAMGIFLVPGIFYVVEKWSGAGQEPAPGIMPASPSPAPGD |
Ga0307476_106370231 | 3300031715 | Hardwood Forest Soil | IGGMVAASGIGIFLIPAIFYLVEKWSGAVPVAGALPASPPPAPGD |
Ga0307476_111715482 | 3300031715 | Hardwood Forest Soil | IFFVPGIFYMVEKWSGAGKEHASGALPAEPAAAPGD |
Ga0307476_113635751 | 3300031715 | Hardwood Forest Soil | GIFFIPAIFYLVEKRSGAGKEAASSSLPATAVPETGD |
Ga0307474_107094131 | 3300031718 | Hardwood Forest Soil | MAASAFGIFFVPGIFYLVEKLSGAGHEPMAAPLPKTPSPEPGD |
Ga0306917_106011031 | 3300031719 | Soil | GIFFVPAIFYFVEKWSGAGKEPVAGALPASPEPAPGD |
Ga0307469_113978281 | 3300031720 | Hardwood Forest Soil | MLAASFIGIFLIPGIFYLVEKWSGAGKEPATAALPSAPAPQEGD |
Ga0318501_102329382 | 3300031736 | Soil | GMAAASVIGIFFVPAIFYLVEKWSGTRKEEAPGAVPDTSPAPGD |
Ga0318492_107113181 | 3300031748 | Soil | AASLIGIFFVPAIFYMVENWSGAAQERAEGALPVMPAEAEGD |
Ga0307477_101126563 | 3300031753 | Hardwood Forest Soil | ILAASMIGIFFVPAIFYMVEKWSGAGKEHASGPLPAAPTPAEAD |
Ga0307475_101902611 | 3300031754 | Hardwood Forest Soil | MAASAIGIFFVPAIFYMVEKWSGPGEEHVSPALPAPPEPAEGD |
Ga0307475_102510851 | 3300031754 | Hardwood Forest Soil | ASALGIFFIPAIFYMVEKWSGADKERAAGSLPAEPAPAPGD |
Ga0307475_113816912 | 3300031754 | Hardwood Forest Soil | LAASLIGIFFIPAIFYLVEKWSGAGTEPVRAPMPGTPAPAEGD |
Ga0306919_114682552 | 3300031879 | Soil | GGMLAASAIGIFFVPGVFYLVEKLAVARREPAPGMLPDSPAPAAGD |
Ga0306923_111577552 | 3300031910 | Soil | SVIGIFFVPAIFYLVEKWSGAEKDHAAEVLPAAPSPAEAD |
Ga0310913_112192342 | 3300031945 | Soil | IFFVPAIFYLVEKWSGAENEAAPGALRATPSPAEAD |
Ga0306926_128383151 | 3300031954 | Soil | IAASAIGIFFVPAIFYMVEKWSAAGKEPETGILPVTPSPAPED |
Ga0307479_104344062 | 3300031962 | Hardwood Forest Soil | FFIPAIFYLVEKWSGAGNEVASSSLPTTPAAELGD |
Ga0307479_111642331 | 3300031962 | Hardwood Forest Soil | SAIGIFFIPGVFYMVEKWSGPGNEPASGIVPATPSPAPGD |
Ga0307471_1021896392 | 3300032180 | Hardwood Forest Soil | IFFVPAIFTLVEKWSGAGKERASGALPATPTPAEAD |
Ga0335082_112082511 | 3300032782 | Soil | MLAASILAIFLVPAIFYLVEKWSGAGKEAAAGLSSTPAPAPGD |
Ga0335081_114713392 | 3300032892 | Soil | AIGIFFVPGIFYLVEKWSGAGREPAPGSLPAAPAPVPGD |
Ga0335077_103077652 | 3300033158 | Soil | GIFFVPAIFYLVEKWSGAGPERVSTALPGTPAPAEGD |
⦗Top⦘ |