Basic Information | |
---|---|
Family ID | F013434 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 271 |
Average Sequence Length | 38 residues |
Representative Sequence | EVLPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG |
Number of Associated Samples | 221 |
Number of Associated Scaffolds | 271 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.88 % |
% of genes near scaffold ends (potentially truncated) | 82.29 % |
% of genes from short scaffolds (< 2000 bps) | 73.06 % |
Associated GOLD sequencing projects | 207 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.598 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.343 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.996 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.720 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.68% β-sheet: 0.00% Coil/Unstructured: 60.32% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 271 Family Scaffolds |
---|---|---|
PF00149 | Metallophos | 15.50 |
PF17164 | DUF5122 | 2.21 |
PF08281 | Sigma70_r4_2 | 1.85 |
PF04238 | DUF420 | 1.85 |
PF13473 | Cupredoxin_1 | 1.85 |
PF00165 | HTH_AraC | 1.48 |
PF00175 | NAD_binding_1 | 1.11 |
PF00127 | Copper-bind | 1.11 |
PF13439 | Glyco_transf_4 | 0.74 |
PF04542 | Sigma70_r2 | 0.74 |
PF03746 | LamB_YcsF | 0.74 |
PF00392 | GntR | 0.74 |
PF12833 | HTH_18 | 0.74 |
PF07885 | Ion_trans_2 | 0.74 |
PF02836 | Glyco_hydro_2_C | 0.37 |
PF01791 | DeoC | 0.37 |
PF13419 | HAD_2 | 0.37 |
PF11453 | DUF2950 | 0.37 |
PF13551 | HTH_29 | 0.37 |
PF00248 | Aldo_ket_red | 0.37 |
PF12439 | GDE_N | 0.37 |
PF01757 | Acyl_transf_3 | 0.37 |
PF13560 | HTH_31 | 0.37 |
PF13181 | TPR_8 | 0.37 |
PF02321 | OEP | 0.37 |
PF09723 | Zn-ribbon_8 | 0.37 |
PF09348 | DUF1990 | 0.37 |
PF13649 | Methyltransf_25 | 0.37 |
PF02518 | HATPase_c | 0.37 |
PF12142 | PPO1_DWL | 0.37 |
PF01878 | EVE | 0.37 |
PF02416 | TatA_B_E | 0.37 |
PF04366 | Ysc84 | 0.37 |
PF07250 | Glyoxal_oxid_N | 0.37 |
PF01841 | Transglut_core | 0.37 |
PF03061 | 4HBT | 0.37 |
PF02585 | PIG-L | 0.37 |
PF13191 | AAA_16 | 0.37 |
PF07729 | FCD | 0.37 |
PF01493 | GXGXG | 0.37 |
PF13519 | VWA_2 | 0.37 |
PF13561 | adh_short_C2 | 0.37 |
PF00534 | Glycos_transf_1 | 0.37 |
PF02878 | PGM_PMM_I | 0.37 |
PF00078 | RVT_1 | 0.37 |
PF07859 | Abhydrolase_3 | 0.37 |
PF00902 | TatC | 0.37 |
PF00903 | Glyoxalase | 0.37 |
PF00440 | TetR_N | 0.37 |
PF03781 | FGE-sulfatase | 0.37 |
PF13545 | HTH_Crp_2 | 0.37 |
PF00535 | Glycos_transf_2 | 0.37 |
PF13247 | Fer4_11 | 0.37 |
PF09990 | DUF2231 | 0.37 |
PF00970 | FAD_binding_6 | 0.37 |
COG ID | Name | Functional Category | % Frequency in 271 Family Scaffolds |
---|---|---|---|
COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 1.85 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.74 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.74 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
COG1540 | 5-oxoprolinase subunit A | Amino acid transport and metabolism [E] | 0.74 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.74 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.74 |
COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.37 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.37 |
COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.37 |
COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.37 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.37 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.37 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.37 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.37 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.37 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.37 |
COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.37 |
COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.37 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.60 % |
Unclassified | root | N/A | 21.40 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001100|JGI12703J13194_106919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 571 | Open in IMG/M |
3300001175|JGI12649J13570_1013198 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300001546|JGI12659J15293_10070442 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300001593|JGI12635J15846_10034831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3988 | Open in IMG/M |
3300001593|JGI12635J15846_10094082 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100598222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
3300004080|Ga0062385_10356901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 859 | Open in IMG/M |
3300005171|Ga0066677_10507837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300005332|Ga0066388_104683955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300005435|Ga0070714_100292755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1516 | Open in IMG/M |
3300005534|Ga0070735_10249799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1076 | Open in IMG/M |
3300005538|Ga0070731_10137727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1618 | Open in IMG/M |
3300005541|Ga0070733_10292674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
3300005544|Ga0070686_100767814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
3300005554|Ga0066661_10456014 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300005555|Ga0066692_10224295 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300005555|Ga0066692_10817782 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005556|Ga0066707_10121376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1629 | Open in IMG/M |
3300005557|Ga0066704_10964537 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005563|Ga0068855_101599747 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005574|Ga0066694_10004015 | All Organisms → cellular organisms → Bacteria | 5902 | Open in IMG/M |
3300005591|Ga0070761_10451830 | Not Available | 788 | Open in IMG/M |
3300005591|Ga0070761_10624964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 671 | Open in IMG/M |
3300005602|Ga0070762_10797858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300005610|Ga0070763_10437007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
3300005616|Ga0068852_100151046 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
3300005764|Ga0066903_104762981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix → Geothrix fermentans | 722 | Open in IMG/M |
3300005921|Ga0070766_10203182 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300006057|Ga0075026_100944505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300006176|Ga0070765_101871678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300006854|Ga0075425_100138505 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
3300006881|Ga0068865_100693355 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300007982|Ga0102924_1283688 | Not Available | 666 | Open in IMG/M |
3300009088|Ga0099830_11088509 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300009089|Ga0099828_10057490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3253 | Open in IMG/M |
3300009162|Ga0075423_13218985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300009176|Ga0105242_10901262 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300009177|Ga0105248_10335081 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
3300009522|Ga0116218_1069101 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
3300009623|Ga0116133_1019948 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
3300009624|Ga0116105_1212434 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300009631|Ga0116115_1046284 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300009632|Ga0116102_1113902 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300009649|Ga0105855_1052043 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300009651|Ga0105859_1062004 | Not Available | 964 | Open in IMG/M |
3300009662|Ga0105856_1065172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
3300009700|Ga0116217_10595614 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300010048|Ga0126373_12425748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300010322|Ga0134084_10136838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
3300010323|Ga0134086_10401310 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300010339|Ga0074046_10808351 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300010343|Ga0074044_10564200 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300010358|Ga0126370_11564886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
3300010361|Ga0126378_10039465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4314 | Open in IMG/M |
3300010362|Ga0126377_11140851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
3300010376|Ga0126381_103340634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300010376|Ga0126381_104605701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300011269|Ga0137392_10275774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1387 | Open in IMG/M |
3300011271|Ga0137393_10095115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 2423 | Open in IMG/M |
3300012096|Ga0137389_10056206 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
3300012096|Ga0137389_10798525 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300012189|Ga0137388_10917486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
3300012189|Ga0137388_11563178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300012198|Ga0137364_11093007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300012199|Ga0137383_11159680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300012202|Ga0137363_10470396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
3300012202|Ga0137363_10494300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
3300012208|Ga0137376_10715021 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300012208|Ga0137376_11733374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300012361|Ga0137360_10663335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
3300012362|Ga0137361_11219831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300012582|Ga0137358_10776904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300012683|Ga0137398_10506110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
3300012683|Ga0137398_11114996 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300012918|Ga0137396_10731280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
3300012923|Ga0137359_10078767 | All Organisms → cellular organisms → Bacteria | 2890 | Open in IMG/M |
3300012923|Ga0137359_10384654 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300012927|Ga0137416_10566594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
3300012927|Ga0137416_11993398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300012941|Ga0162652_100040845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300012971|Ga0126369_12586993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300013306|Ga0163162_10330146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1658 | Open in IMG/M |
3300013306|Ga0163162_11995117 | Not Available | 665 | Open in IMG/M |
3300014200|Ga0181526_10055071 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
3300014200|Ga0181526_10444352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
3300014501|Ga0182024_10219039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2582 | Open in IMG/M |
3300015264|Ga0137403_11089816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300016270|Ga0182036_10429564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
3300016341|Ga0182035_11726376 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300016357|Ga0182032_10224805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1444 | Open in IMG/M |
3300016371|Ga0182034_10304395 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300016371|Ga0182034_11898787 | Not Available | 525 | Open in IMG/M |
3300016422|Ga0182039_10272549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1389 | Open in IMG/M |
3300017792|Ga0163161_10025651 | All Organisms → cellular organisms → Bacteria | 4172 | Open in IMG/M |
3300017955|Ga0187817_10173640 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300017955|Ga0187817_10608491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300018016|Ga0187880_1262421 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300018022|Ga0187864_10268736 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300018030|Ga0187869_10631623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300018040|Ga0187862_10876380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300018043|Ga0187887_10759538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300018043|Ga0187887_10942835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300018060|Ga0187765_11374011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300018071|Ga0184618_10240655 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300018433|Ga0066667_11961859 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300020000|Ga0193692_1095246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
3300020022|Ga0193733_1011899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2456 | Open in IMG/M |
3300020061|Ga0193716_1132481 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300020140|Ga0179590_1003982 | All Organisms → cellular organisms → Bacteria | 2750 | Open in IMG/M |
3300020199|Ga0179592_10400348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300020579|Ga0210407_10183134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1624 | Open in IMG/M |
3300020579|Ga0210407_10527391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
3300020579|Ga0210407_11107868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300020579|Ga0210407_11262618 | Not Available | 553 | Open in IMG/M |
3300020580|Ga0210403_10749870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300020580|Ga0210403_11126559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300020581|Ga0210399_11248974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300020582|Ga0210395_10000095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 70962 | Open in IMG/M |
3300020582|Ga0210395_10487421 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300020583|Ga0210401_10074434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3197 | Open in IMG/M |
3300021168|Ga0210406_10054024 | All Organisms → cellular organisms → Bacteria | 3504 | Open in IMG/M |
3300021168|Ga0210406_11368071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300021170|Ga0210400_10393494 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300021170|Ga0210400_10443341 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300021170|Ga0210400_10447358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
3300021171|Ga0210405_11162571 | Not Available | 574 | Open in IMG/M |
3300021178|Ga0210408_10718297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300021181|Ga0210388_10094782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2550 | Open in IMG/M |
3300021401|Ga0210393_10757653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
3300021401|Ga0210393_11470850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300021402|Ga0210385_10000404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 32843 | Open in IMG/M |
3300021402|Ga0210385_11065561 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300021404|Ga0210389_11141073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300021405|Ga0210387_10047567 | All Organisms → cellular organisms → Bacteria | 3442 | Open in IMG/M |
3300021405|Ga0210387_11554913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300021432|Ga0210384_10026345 | All Organisms → cellular organisms → Bacteria | 5486 | Open in IMG/M |
3300021474|Ga0210390_11276541 | Not Available | 590 | Open in IMG/M |
3300021475|Ga0210392_10803560 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300021477|Ga0210398_10716696 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300021478|Ga0210402_11223190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300021479|Ga0210410_10287235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1476 | Open in IMG/M |
3300024055|Ga0247794_10152648 | Not Available | 722 | Open in IMG/M |
3300024178|Ga0247694_1002878 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
3300024283|Ga0247670_1064818 | Not Available | 663 | Open in IMG/M |
3300025320|Ga0209171_10541342 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300025463|Ga0208193_1018825 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
3300025500|Ga0208686_1046021 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300025506|Ga0208937_1035583 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300025928|Ga0207700_10456822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
3300025960|Ga0207651_12119165 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300026214|Ga0209838_1039162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300026277|Ga0209350_1032745 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
3300026294|Ga0209839_10268819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300026307|Ga0209469_1090138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
3300026325|Ga0209152_10375392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300026327|Ga0209266_1059905 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
3300026334|Ga0209377_1102648 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300026343|Ga0209159_1046873 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
3300026496|Ga0257157_1014837 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300026548|Ga0209161_10429828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300026550|Ga0209474_10723134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300026551|Ga0209648_10735919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300026557|Ga0179587_10451771 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300026824|Ga0207723_116964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300026865|Ga0207746_1013571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300027521|Ga0209524_1051094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
3300027545|Ga0209008_1039353 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300027575|Ga0209525_1114164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
3300027591|Ga0209733_1120098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
3300027652|Ga0209007_1022620 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
3300027660|Ga0209736_1009639 | All Organisms → cellular organisms → Bacteria | 3109 | Open in IMG/M |
3300027795|Ga0209139_10169973 | Not Available | 772 | Open in IMG/M |
3300027824|Ga0209040_10000346 | All Organisms → cellular organisms → Bacteria | 34757 | Open in IMG/M |
3300027846|Ga0209180_10556579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300027867|Ga0209167_10193407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
3300027869|Ga0209579_10129785 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300027895|Ga0209624_10534047 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300027895|Ga0209624_10657194 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300027898|Ga0209067_10362410 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300027905|Ga0209415_10295120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
3300028037|Ga0265349_1011016 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300028759|Ga0302224_10378284 | Not Available | 574 | Open in IMG/M |
3300028776|Ga0302303_10222733 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300028800|Ga0265338_10587874 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300028906|Ga0308309_10156951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1837 | Open in IMG/M |
3300028906|Ga0308309_10225139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1557 | Open in IMG/M |
3300029636|Ga0222749_10285951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
3300029882|Ga0311368_10805883 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300029943|Ga0311340_11232511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300030053|Ga0302177_10371375 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300030054|Ga0302182_10162487 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300030057|Ga0302176_10400222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 554 | Open in IMG/M |
3300030617|Ga0311356_11668256 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300030746|Ga0302312_10062619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1607 | Open in IMG/M |
3300030746|Ga0302312_10063639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1590 | Open in IMG/M |
3300030855|Ga0075374_11378050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300030991|Ga0073994_12206229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300031057|Ga0170834_103626454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1630 | Open in IMG/M |
3300031122|Ga0170822_11960347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 936 | Open in IMG/M |
3300031232|Ga0302323_101868596 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300031236|Ga0302324_101065957 | Not Available | 1091 | Open in IMG/M |
3300031708|Ga0310686_103991185 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300031715|Ga0307476_10410994 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300031715|Ga0307476_11048734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300031718|Ga0307474_10836227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300031718|Ga0307474_10887035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
3300031719|Ga0306917_10509606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
3300031720|Ga0307469_10817654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300031744|Ga0306918_10483113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
3300031754|Ga0307475_10808875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300031754|Ga0307475_10850458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
3300031793|Ga0318548_10255521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300031820|Ga0307473_11041694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300031823|Ga0307478_10015739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5272 | Open in IMG/M |
3300031823|Ga0307478_10758957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
3300031879|Ga0306919_10495699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
3300031910|Ga0306923_10303820 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
3300031954|Ga0306926_11756302 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300031962|Ga0307479_12040193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300032059|Ga0318533_11099957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300032076|Ga0306924_12193562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300032174|Ga0307470_10022655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2859 | Open in IMG/M |
3300032180|Ga0307471_100212965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1947 | Open in IMG/M |
3300032180|Ga0307471_101136005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
3300032205|Ga0307472_100040425 | All Organisms → cellular organisms → Bacteria | 2811 | Open in IMG/M |
3300032205|Ga0307472_100297018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
3300033289|Ga0310914_11417231 | Not Available | 598 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.34% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.44% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.38% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.17% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.06% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.32% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.32% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.95% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.58% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.21% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.48% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.11% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.11% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.11% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.11% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.11% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.11% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.11% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.74% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.74% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.74% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.74% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.74% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.74% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.37% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.37% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.37% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.37% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.37% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.37% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.37% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.37% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.37% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.37% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.37% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001100 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 | Environmental | Open in IMG/M |
3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023012 | Spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU4 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
3300026865 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12703J13194_1069191 | 3300001100 | Forest Soil | RTEVLPGYRLALEILAVGIVALTGHLGGFLSGVNGQG* |
JGI12649J13570_10131982 | 3300001175 | Forest Soil | ERSLPNYRLPIEALAVLIVGLTGHLGGFLSGVNGPG* |
JGI12659J15293_100704421 | 3300001546 | Forest Soil | RRAKVLPNYRLALELLGVALIALTGHLGGFLSGVNVPG* |
JGI12635J15846_100348311 | 3300001593 | Forest Soil | RQKTLVLPRYRLALEVLAVGVIALTGHLGGFLSGVNMPG* |
JGI12635J15846_100940823 | 3300001593 | Forest Soil | IHQRVRRFPERSLPNYRLPIEALAVLIVGLTGHLGGFLSGVNGPG* |
JGIcombinedJ26739_1002763531 | 3300002245 | Forest Soil | REEVLPTYRIAFEVIGVALVALTAHLGGFLSGVNGPG* |
JGIcombinedJ26739_1005982222 | 3300002245 | Forest Soil | RVRRFPERSLPNYRLPIEALAVLIVGLTGHLGGFLSGVNGPG* |
Ga0062385_103569011 | 3300004080 | Bog Forest Soil | RRRKVVSPRYRLALEILVVGIVALTGHLGGFLSGVNGPG* |
Ga0066677_105078371 | 3300005171 | Soil | RHPKDSLPKYRLPIEGVAVLLVVLTGHLGGFLSGVNGPG* |
Ga0066388_1046839552 | 3300005332 | Tropical Forest Soil | RRKPDAVLPGYRLPLEAVAVVIVALTGHLGGFLSGVNGPG* |
Ga0070714_1002927551 | 3300005435 | Agricultural Soil | RRQKAPLPIYRLAIELVAVGVIALTGHLGGFLSGVNGPG* |
Ga0070735_102497991 | 3300005534 | Surface Soil | RTVYLPSYRLAVELAAVGLVALTGHLGGFLSGVNLPG* |
Ga0070731_101377271 | 3300005538 | Surface Soil | RRAAKALPNYRLPIEFLGVLMVALTGHLGGFLSGVNGPG* |
Ga0070733_102926743 | 3300005541 | Surface Soil | QEDILPGYRLPIETVAVVIVAMTGHLGGFLSGVNGPG* |
Ga0070733_109436521 | 3300005541 | Surface Soil | KASPLPGYRWAVQLLALLLVGMTAHLGGFLSGVNG* |
Ga0070686_1007678141 | 3300005544 | Switchgrass Rhizosphere | RRRPERSLPAYRLPIEAIAVLLVGLTGHLGGFLSGVSAPG* |
Ga0066661_104560141 | 3300005554 | Soil | RRAEALPSYRLAIEFLAVGIVALTGHLGGFLSGVNGPG* |
Ga0066692_102242954 | 3300005555 | Soil | ARNKSLPPPNYRLWIELVAVAVIALTGHFGGFLSGVNGPG* |
Ga0066692_108177821 | 3300005555 | Soil | RRAEALPSYRLAIEFLAVGAVVLTGHLGGFLSGVNGPG* |
Ga0066707_101213763 | 3300005556 | Soil | RQRAEALSVYRLGIEIFGVCIIALTGHLGGFLSGVNGPG* |
Ga0066704_109645371 | 3300005557 | Soil | RRAEALPSYRLAIEFLAVGMVMLTGHLGGFLSGVNGPA* |
Ga0068855_1015997471 | 3300005563 | Corn Rhizosphere | PTGTLPTYRLPLEAVGVLVVALTGHLGGILSGVNATG* |
Ga0066694_100040151 | 3300005574 | Soil | HRKTQLKEGEVLPGYRLPIEAVAVVIVSLTGHLGGFLSGVNGPG* |
Ga0070761_104518301 | 3300005591 | Soil | MRNTVFRQGLETAAVAILGLTGHLGGFLGGVSGPS* |
Ga0070761_106249641 | 3300005591 | Soil | PERRESLPNYLLALELLGVGLIALTGHLGGFLSGVNVPG* |
Ga0070762_107978581 | 3300005602 | Soil | RRDGKLLPGFRLPLELLGVAVIALTGHLGGFLSGVNGVN* |
Ga0070763_104370071 | 3300005610 | Soil | TRRNQEEALPKYRLPIEAVAVVMVALTGHLGGFLSGVNGPG* |
Ga0068852_1001510464 | 3300005616 | Corn Rhizosphere | AEALSVYRLGIEIVGVCIIAFTGYMGGFLSGVNGPG* |
Ga0066903_1047629811 | 3300005764 | Tropical Forest Soil | DEALPGHRVVIELLGVAIVALTGHVGGFLSGVNGPG* |
Ga0070766_102031822 | 3300005921 | Soil | QLTDGLPVFRLGLETLAVAIVGLTGHLGGFLSGVNGPN* |
Ga0075026_1009445053 | 3300006057 | Watersheds | EEPLPNYRLSIEAVAVLLVGLTGHLGGFLSGVNGAG* |
Ga0070765_1018700511 | 3300006176 | Soil | EALPSYRLALEFLGVGLVALTAHLGGFLSGVNGPG* |
Ga0070765_1018716781 | 3300006176 | Soil | RGEESLPNYRLPIEGLAVLIVGLTGHLGGFLSGVNGPG* |
Ga0066659_101110121 | 3300006797 | Soil | ALPSYRLAIEFLAVGMVMLTGYLGGFLSGVNGPG* |
Ga0079220_115393442 | 3300006806 | Agricultural Soil | EQVLPNYRLPLEVFGVVLIALTAHLGGFLSGVNGPG* |
Ga0075421_1004220242 | 3300006845 | Populus Rhizosphere | MAAPLPTYRLQIEAVAVLLVGLTAHLGGFLSGVNGPG* |
Ga0075425_1001385054 | 3300006854 | Populus Rhizosphere | IHLRVRRHPEESLPNYRLPLEAIAVLLVGLTGHLGGFLSGVNGPG* |
Ga0068865_1006933552 | 3300006881 | Miscanthus Rhizosphere | RPVVRLPNYRLPVEAFGVLLVALTGHLGGFLSGVNAP* |
Ga0102924_12836881 | 3300007982 | Iron-Sulfur Acid Spring | AEALPSYRLVLEFMGVALVALTGHLGAFLSGVNGPG* |
Ga0066710_1017411981 | 3300009012 | Grasslands Soil | AESVSLPRYRIPVELLGVAIIALTAHLGGFLSGVNT |
Ga0099830_110885091 | 3300009088 | Vadose Zone Soil | FRARRRAEELPRYRLPIEVLAVAIVALTGHLGGFLSGVNGPG* |
Ga0099828_100574904 | 3300009089 | Vadose Zone Soil | GVLPNYRLPLEAVGVALVTLTGHLGGFLSGVNLSN* |
Ga0075423_132189851 | 3300009162 | Populus Rhizosphere | EALPSYRLAIEFLAVGMVVLTGHLGGFLSGVNGPG* |
Ga0105242_109012622 | 3300009176 | Miscanthus Rhizosphere | RARRPPGAKLPNYRLAIEAIGALLVALTGHLGGFLSGVNVA* |
Ga0105248_103350811 | 3300009177 | Switchgrass Rhizosphere | ADLPSYRLSLEFLTVGLVALTGHLGGLLSGVNTPG* |
Ga0116218_10691011 | 3300009522 | Peatlands Soil | IHSRARRHPEQSLPNYRLPIEALAVLIMVLTGHLGGFLSGVNAPG* |
Ga0116133_10199483 | 3300009623 | Peatland | ARRRADALPSYRLAVEFLGVGLVALTGHLGGFLSGVNGPG* |
Ga0116105_12124341 | 3300009624 | Peatland | NPLPAYRLPVEGFAVLLVVLTGHLGGFLSGVNAPG* |
Ga0116125_11714471 | 3300009628 | Peatland | RRTVFLPGYRFAVELLAVGMVAMTAHLGGFLSGVNGPG* |
Ga0116115_10462841 | 3300009631 | Peatland | SLPNYRLPIEALAVLIVGLTGHLGGFLTGVNGPG* |
Ga0116102_11139021 | 3300009632 | Peatland | RRFPERSLPKYRLPIEALAVLIVGLTGHLGGFLSGVNGPG* |
Ga0116106_12623711 | 3300009645 | Peatland | LLPAYCLSLELVTVIVVALTGHLGGFLSGVNVPG* |
Ga0105855_10520432 | 3300009649 | Permafrost Soil | RPLPQFSLVIETIAVLVVGLTGHLGGFLSGVNGPR* |
Ga0105859_10620042 | 3300009651 | Permafrost Soil | VRRTPERPLPQFSLVIETIAVLVVGLTGHLGGFLSGVNEPG* |
Ga0105856_10651723 | 3300009662 | Permafrost Soil | HLRTRRHAEKPLPKYRLPIEALAVLLVGLTGHLGGFLSGVNGSN* |
Ga0116217_105956141 | 3300009700 | Peatlands Soil | RKLGGVLPGYRLSLEALGVALVTLTGHLGGFLSGVNGPG* |
Ga0126373_124257482 | 3300010048 | Tropical Forest Soil | RHVEESLPKYRLPIEAVAVLLVGLTGHLGGFLSGVNGPPG* |
Ga0134084_101368381 | 3300010322 | Grasslands Soil | HRKTQLKEGEVLPGYRLPIEAVAVVMVSLTGHLGGFLSGVNGPG* |
Ga0134086_104013101 | 3300010323 | Grasslands Soil | EALPSYRLAIEFLAVGMVMLTGHLGGFLSGVNGPG* |
Ga0074046_108083511 | 3300010339 | Bog Forest Soil | TEPLPGYRLAVEFHGVALVALTGHLGGFLSGVNGPG* |
Ga0074044_105642002 | 3300010343 | Bog Forest Soil | ERSLPKYRLPIEALAVLIVGLTGHLGGFLSGVNGPG* |
Ga0126370_115648862 | 3300010358 | Tropical Forest Soil | ARRHGDESLPKYRLPIEAIAVLLVGLTGHLGGFLSGVNAPS* |
Ga0126372_108473811 | 3300010360 | Tropical Forest Soil | SEPPVLPCYRIPLEVLGVISIALTAHLGGFLSGINS* |
Ga0126378_100394656 | 3300010361 | Tropical Forest Soil | RRHQESLPKYRLALEAFAILIVVLTGHLGGFLSGVNGPG* |
Ga0126377_111408511 | 3300010362 | Tropical Forest Soil | LRARRHPEGSLPKYCLPLEVVAVLLVGLTGHLGGFLSGVNGPG* |
Ga0126381_1033406342 | 3300010376 | Tropical Forest Soil | WIHLRVQRHPEESLPKYRLPIEAVAVFVVGLTGHLGGFLSGVNGPG* |
Ga0126381_1046057011 | 3300010376 | Tropical Forest Soil | ILPGYRLPIEAVGVVIVALTGHLGGFLSGVNGPG* |
Ga0137392_102757743 | 3300011269 | Vadose Zone Soil | VLPNYRLPIEAVGVVIVTLTGHLGGFLSGVNLSN* |
Ga0137393_100951151 | 3300011271 | Vadose Zone Soil | RAQGQDGGILPAYCLPIEAVAVAIVTVTGHLGGFLSGVNGPG* |
Ga0137389_100562064 | 3300012096 | Vadose Zone Soil | RRHAGASLPKYRLPIEAVTMVLVALTGHLGGFLSGVNGLG* |
Ga0137389_107985252 | 3300012096 | Vadose Zone Soil | VLPSYRLAVELLGVGLIGLTGYLGGFLSGVNGPS* |
Ga0137388_109174861 | 3300012189 | Vadose Zone Soil | RQEEVLPGYRLPLEAVAVVVVALTGHLGGFLSGVNGPG* |
Ga0137388_115631781 | 3300012189 | Vadose Zone Soil | RKNGGVLPGYRLPIEAVGVVLVTLTGHLGGFLSGVNGPG* |
Ga0137364_110930072 | 3300012198 | Vadose Zone Soil | KQQEVLPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG* |
Ga0137383_111596801 | 3300012199 | Vadose Zone Soil | QRKYGGVLPTYRLPMEAIGVALMTITGHLGGFLSGVNGPG* |
Ga0137363_104703961 | 3300012202 | Vadose Zone Soil | EEILPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG* |
Ga0137363_104943001 | 3300012202 | Vadose Zone Soil | RTRRKQEEILPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG* |
Ga0137363_116910991 | 3300012202 | Vadose Zone Soil | TVYLPSYRLPVELLTVGVVAVTGHLGGFLSGINGPG* |
Ga0137376_107150211 | 3300012208 | Vadose Zone Soil | EALSVYRLGIEIFGVCIIALTGHLGSFLSGVNGPG* |
Ga0137376_117333741 | 3300012208 | Vadose Zone Soil | RARRRAEALPSYRLAIEFLAIGVMVLTGHLGGFLSGVNGPA* |
Ga0137360_106633353 | 3300012361 | Vadose Zone Soil | GILPAYCLPIEAVAVAIVTVTGHLGGFLSGVNGPG* |
Ga0137361_112198312 | 3300012362 | Vadose Zone Soil | SLPGYRLPLEFAGVILVALTGHLGGFLSGINGPG* |
Ga0137358_107769042 | 3300012582 | Vadose Zone Soil | EPLPNYRLAIEFLAFGIVTLTAHLGGFLSGVNGPG* |
Ga0137358_110868762 | 3300012582 | Vadose Zone Soil | PENSLPTYRLSLEAMAVLLVGVTAHLGGFLSGVNGPG* |
Ga0137398_105061101 | 3300012683 | Vadose Zone Soil | DVLPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG* |
Ga0137398_111149961 | 3300012683 | Vadose Zone Soil | RRRTKALPIYRLAVEFLGVGIIALTGHLGGFLSGVNTPG* |
Ga0137396_107312802 | 3300012918 | Vadose Zone Soil | VRRRAEALPNYCLALEVLGVGLIALTGHLGGFLSGVNVPG* |
Ga0137359_100787671 | 3300012923 | Vadose Zone Soil | QQALFNYYVAVELLAVALVSLTAHLGGFLSGVNAPG* |
Ga0137359_103846541 | 3300012923 | Vadose Zone Soil | AEVVPSYLLAVEIVGLGIVALTGHLGGFLSGVNGLG* |
Ga0137416_105665941 | 3300012927 | Vadose Zone Soil | SRRRTAPLPRYRLAIEFLAFAMVTLTAHLGGFLSGVNGPG* |
Ga0137416_119933981 | 3300012927 | Vadose Zone Soil | GVLPTYRLPIEAIGVVLVTVTGHLGGFLSGVNVPS* |
Ga0162652_1000408451 | 3300012941 | Soil | VWRRPAATLPAYRLPIEAVGVLLVGLTGHLGGFLSGVNGSG* |
Ga0126369_125869932 | 3300012971 | Tropical Forest Soil | DQMQSAVVVRLRLAMEAMGVVLVTLTGHLGGFLSGVNIPG* |
Ga0163162_103301461 | 3300013306 | Switchgrass Rhizosphere | RRRPVVQLPNYRLPVEAFGVLLVALTGHLGGFLSGVNAP* |
Ga0163162_119951172 | 3300013306 | Switchgrass Rhizosphere | RRHPVASLPGYRLPIEAVAVLLVGVTGHLGGFLTGVNSAG* |
Ga0181532_105015001 | 3300014164 | Bog | HRNPEGKLPLYRLPIEIMAAAVVSLTAHLGGFLSGVNGPG* |
Ga0181526_100550714 | 3300014200 | Bog | GKSLPNYRLPMEALVVLIVGLTGHLGGFLSGVNGSG* |
Ga0181526_104443521 | 3300014200 | Bog | HALPNYRLPIEALAVVIVALTGHLGGFLSGVNGPG* |
Ga0182024_102190394 | 3300014501 | Permafrost | FRARRTGNELPRLRMPLELLGVAIIALTGHLGGFLSGVNGGT* |
Ga0182030_103618521 | 3300014838 | Bog | SPERALPKYRLAIEGLAVLIVGLTAHLGGFLSGVNGPG* |
Ga0137403_110898162 | 3300015264 | Vadose Zone Soil | SQMPPTYRLWIELAAVAIIALTGHLGGFLSGVNGPG* |
Ga0182036_104295641 | 3300016270 | Soil | EESLPKYRLPIEAVAVLLVGLTGHLGGFLSGVNGPG |
Ga0182041_112633252 | 3300016294 | Soil | RRSEVLPNFRLAIELLGVAVIAATAHLGGFLSGVNGAG |
Ga0182035_117263761 | 3300016341 | Soil | LLLPTYRLPIEFLGLVAVALTGHLGGFLSGVNVFG |
Ga0182032_102248054 | 3300016357 | Soil | IHLRAWRHVEESLPKYRLPIEAIAVLLVGLTGHLGGFLSGVNGPG |
Ga0182034_103043953 | 3300016371 | Soil | RRRHQESLPKYRLALEAFAILIVVLTGHLGGFLSGVNGPG |
Ga0182034_118987871 | 3300016371 | Soil | SERRGNALPRYRMPVEAAALALVTMTGHLGGFLTGVNGPG |
Ga0182040_110470461 | 3300016387 | Soil | RKLPLYRLPIELAATTVVALTAHLGGFLSGVNGPG |
Ga0182039_102725494 | 3300016422 | Soil | AWRHVEESLPKYRLPIEAIAVLLVGLTGHLGGFLSGVNGPG |
Ga0163161_100256511 | 3300017792 | Switchgrass Rhizosphere | VVQLPNYRLPVEAFGVLLVALTGHLGGFLSGVNAP |
Ga0187817_101736401 | 3300017955 | Freshwater Sediment | GARRRPPETLPTFRLTIEAVAVLLVALTGHLGGFLSGLNGPS |
Ga0187817_106084911 | 3300017955 | Freshwater Sediment | ELALPAYRFPIEFLSIPLVALTGHLGGFLSGVNTPG |
Ga0187778_101326531 | 3300017961 | Tropical Peatland | HRSEGVSRCRLAIEFIAVLIVGLTAHLGGFLSGVNSPG |
Ga0187880_12624212 | 3300018016 | Peatland | RRFPERSLPKYRLPIEALAVLIVGLTGHLGGFLSGVNGPG |
Ga0187864_102687362 | 3300018022 | Peatland | RVRRFPERSLPKYRLPIEALAVLIVGLTGHLGGFLSGVNGPG |
Ga0187869_106316232 | 3300018030 | Peatland | DALPSYRLAVEFLGVGLVALTGHLGGFLSGVNGPG |
Ga0187862_108763802 | 3300018040 | Peatland | RRADALPSYRLAVEFLGVGLVALTGHLGGFLSGVNGPG |
Ga0187871_104610381 | 3300018042 | Peatland | EPLPTYRLTIELVGVCLIALTAHLGGFLSGINGPN |
Ga0187887_107595381 | 3300018043 | Peatland | RRRAAALPNYRLAVEVLGVGVIALTGHLGGFLSGVNGPS |
Ga0187887_109428351 | 3300018043 | Peatland | RAVGLPSYRLAIEFLAVGLVALTGHLGGFLSGVNLPG |
Ga0187765_113740112 | 3300018060 | Tropical Peatland | GEGLLPKYRLPIEAVGVLVVMLTGHLGGFLSGVNGPG |
Ga0184618_102406552 | 3300018071 | Groundwater Sediment | RRRSQALPSYRLSLGFVGVVVVTLTGHLGSFLSGVNGPG |
Ga0066655_106265721 | 3300018431 | Grasslands Soil | RALPMYRLPLEIVAAAVVALTAHLGGFLSGVNAPV |
Ga0066667_119618591 | 3300018433 | Grasslands Soil | RQRAEALSVYRLGIEIFGVCIIALTGHLGGFLSGVNGPG |
Ga0193728_10133281 | 3300019890 | Soil | HPEKSLPMYRLSLEAIAVLLVGVTAHLGGFLSGVNGPG |
Ga0193692_10952462 | 3300020000 | Soil | WRVRRHPPALLPGYRLPIEAFAVVLVVVTGHLGGFLSGVNGAG |
Ga0193733_10118991 | 3300020022 | Soil | EALSVYRLGIEIFGVCIIALTGHLGGFLSGVNGPG |
Ga0193716_11324811 | 3300020061 | Soil | GYRLAVEILGVGMVALTGHLGGILSGVNGPGSMPG |
Ga0179590_10039821 | 3300020140 | Vadose Zone Soil | EVLPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG |
Ga0179592_104003481 | 3300020199 | Vadose Zone Soil | RDQESLPRYRLVIEAIAVVIVVLTGHLGGFLSGVNGPG |
Ga0210407_101831344 | 3300020579 | Soil | NQEELLPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG |
Ga0210407_105273911 | 3300020579 | Soil | GQNHQEALPGYRLPIEAVAVVIVALTGHLGGFLSGVSGPG |
Ga0210407_111078681 | 3300020579 | Soil | HRRTRRNQEEILPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG |
Ga0210407_112626181 | 3300020579 | Soil | RQLSEGLPVFRLGLEAAAVAVIALAGHLGGFLSGVNGPS |
Ga0210403_102383052 | 3300020580 | Soil | RAGVLPSYRLAFEFLGVGLVALTAHLGGFLSGVNGPG |
Ga0210403_107498703 | 3300020580 | Soil | RRSRWKKEEGLPGYRLPIETVAVVIVALTGHLGGFLSGVNGPG |
Ga0210403_111265591 | 3300020580 | Soil | EEVLPGYRLPIEAVAVVIVGLTGHLGGFLSGVNGPG |
Ga0210399_100394411 | 3300020581 | Soil | RRDQESLPKYRLVIEALAILIVVLTAHLGGFLSGVNGAG |
Ga0210399_112489742 | 3300020581 | Soil | RVRRHPEESLQKYRLPIEAVAVFVVGLTGHLGGFLSGVNGPG |
Ga0210395_1000009548 | 3300020582 | Soil | MRNTVFRQGLETAAVAILGLTGHLGGFLGGVSGPS |
Ga0210395_104874212 | 3300020582 | Soil | AHRSPERSLPKYRLPIEALGVLLVGLTGHLGGFLSGVNGPGNRQPNKSVE |
Ga0210401_100744346 | 3300020583 | Soil | EALPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG |
Ga0210406_100540241 | 3300021168 | Soil | VYLPNYRLAVELLAVGLVALTGHLGGFLSGVNLPG |
Ga0210406_113680711 | 3300021168 | Soil | RRYSGKSLPTYRLPIEAIAVLLVGLTAHLGGFLSGVNV |
Ga0210400_103934942 | 3300021170 | Soil | ASGDMLPGFRLLVEALTVGLVALTGHLGGFLSGINV |
Ga0210400_104433412 | 3300021170 | Soil | QERVLPGYRLPIEAVAVVIVVLTGHLGGFLSGVNGP |
Ga0210400_104473583 | 3300021170 | Soil | GKRGAVLPGYRLPIEAVAVAILTVTGHLGGFLSGVNGPG |
Ga0210405_111625712 | 3300021171 | Soil | EQSLPGYRLLLEFVGVILVALTGHLGSFLSGVNGSG |
Ga0210408_107182972 | 3300021178 | Soil | PETLPAYRLPIEALVAAVVMLTGHLGGFLSGVNGPG |
Ga0210388_100947821 | 3300021181 | Soil | VRRDGNEPPTFRIPLELLGLAVIVLTGHLGGFLSGVNGPG |
Ga0210388_101375191 | 3300021181 | Soil | GVLPSYRLAFEFLGVGLMALTAHLGGFLSGVNGPG |
Ga0210393_107576531 | 3300021401 | Soil | KRPQMPPAYRLWIELAAVAIIALAGHLGGFLSGVNGPG |
Ga0210393_114708501 | 3300021401 | Soil | EGVLPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG |
Ga0210385_1000040425 | 3300021402 | Soil | VPLPNYRLVLELVAVAVVAVTGHLGGFLSGVNGPG |
Ga0210385_110655612 | 3300021402 | Soil | MDQNQQEMLLAYRLPLELVAVEVVVLTGHLGSFLSGVNGPG |
Ga0210389_111410732 | 3300021404 | Soil | VRRRGGELPNYRLAIEVVAATFVALTGHLGGFLSGVNGAG |
Ga0210387_100475675 | 3300021405 | Soil | LVHFRVRRHPEESSQKYRLPIEAVAVFVVGLTGHLGGFLSGVNGPG |
Ga0210387_115549131 | 3300021405 | Soil | RKRSQMPPTYRLWIELAAVAIIALTGHLGGFLSGVNGPG |
Ga0210394_101748681 | 3300021420 | Soil | RRAGVLPGYRLAFEFLGVGLVALTAHLGGFLSGVNGPG |
Ga0210384_100263451 | 3300021432 | Soil | ESLPKYRLPLEAIALLLMGLPGHLDGFLSGVNGPG |
Ga0210384_111187062 | 3300021432 | Soil | RRREATLPSYRLAFEFLGVGLVALTAHLGGFLSGVNGPG |
Ga0210390_112765412 | 3300021474 | Soil | TPEQALPKYVLAIEGIAALIVGMTGHLGGFLSGVNGSV |
Ga0210392_108035602 | 3300021475 | Soil | ARRKTVHLPSYRLAIELLAVAVVAVTGHLGGFLSGVNLPG |
Ga0210392_113604202 | 3300021475 | Soil | FRARRQKTPLQKYRLMFEFLTVAMVALTAHLGGFLSGVNGPG |
Ga0210398_107166961 | 3300021477 | Soil | ARKRTVYLPSYRLAVELLAVGLVALTGHLGGFLSGVNLPG |
Ga0210402_112231902 | 3300021478 | Soil | KRTRRKHEEALPGYRLPIEAVAVVIVGLTGHLGGFLSGVNGPG |
Ga0210410_102872352 | 3300021479 | Soil | RARRMARALPNYRLPIEVLGILAVALTGHLVGFLTGVNGPG |
Ga0212123_107523682 | 3300022557 | Iron-Sulfur Acid Spring | APLPRYRLALEFMAVGSVVLTAHLGGFLSGVNGPG |
Ga0228597_1116912 | 3300023012 | Plant Litter | GGVNLPNNRLVLEFVGVVLLAFTGHLGGFLSGVNM |
Ga0247794_101526482 | 3300024055 | Soil | WIHWRVRRHPVASLPGYRLPIEAVAVLLVGVTGHLGGFLTGVNSAG |
Ga0247694_10028781 | 3300024178 | Soil | QRTLPIFRLALETVAVFIVGLTGHLGGFLSGVNGPS |
Ga0247670_10648181 | 3300024283 | Soil | GLQRTLPIFRLALETVAVFIVGLTGHLGGFLSGVNGPS |
Ga0209171_105413421 | 3300025320 | Iron-Sulfur Acid Spring | SPGNPLPAYRLPVEGFAVLLVVLTGHLGGFLSGVNAPG |
Ga0208193_10188253 | 3300025463 | Peatland | RRTASLPSYRLAVEVLAIAVVAVTGHLGGFLSGVNLPG |
Ga0208686_10460212 | 3300025500 | Peatland | VFLPICRLALEVLVVGIVALTGHLGGFLSGVNGPG |
Ga0208937_10355831 | 3300025506 | Peatland | VRRFPERSLPKYRLPIEALAVLIVGLTGHLGGFLSGVNGPG |
Ga0207700_104568221 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IHWRARRRDQESLPKYRLVIEAIAVLIIVLTGHLGGFLSGVNGPG |
Ga0207670_110959932 | 3300025936 | Switchgrass Rhizosphere | HSGESLPNYRLPVEAIAVLLVGLTAHLGGFLSGVNGLG |
Ga0207669_107298073 | 3300025937 | Miscanthus Rhizosphere | GKSLPNYRLPVEAIAVLLVGLTAHLGGFLSGVNGLG |
Ga0207651_121191651 | 3300025960 | Switchgrass Rhizosphere | SPTGTLPTYRLPLEAVGVLVVALTGHLGGLLSGVNATG |
Ga0207674_104831852 | 3300026116 | Corn Rhizosphere | EQVLPNYRLPLEVFGVVLIALTAHLGGFLSGVNGPG |
Ga0209838_10391621 | 3300026214 | Soil | RHAEQPLPKYRLPIEALAVLLVGLTGHLGGFLSGVNGSN |
Ga0209350_10327453 | 3300026277 | Grasslands Soil | QARRRAEALPSYRLAIEFLAVGAVVLTGHLGGFLSGVNGPG |
Ga0209839_102688191 | 3300026294 | Soil | RAEVLPRYRWAIEFLGVGIVALTGHLGGFLSGVNGPR |
Ga0209469_10901381 | 3300026307 | Soil | ARRRAEALPSYRLAIEFLAVGAVVLTGHLGGFLSGVNGPG |
Ga0209152_103753921 | 3300026325 | Soil | RHPKDSLPKYRLPIEGVAVLLVVLTGHLGGFLSGVNGPG |
Ga0209266_10599051 | 3300026327 | Soil | QRAEALSVYRLGIEIFGVCIIALTGHLGGFLSGVNGPG |
Ga0209377_11026484 | 3300026334 | Soil | ARNKSLPPPNYRLWIELVAVAVIALTGHFGGFLSGVNGPG |
Ga0209159_10468731 | 3300026343 | Soil | RAEALSVYRLGIEIFGVCIIALTGHLGGSLSGVNGPG |
Ga0257157_10148372 | 3300026496 | Soil | ARRRAQALPNYRLALEFLGVGVIALTGHLGGFLSGVNGPS |
Ga0209161_104298281 | 3300026548 | Soil | RAEVLPNRLALEILGVGIVALTGHLGGFLSGVNGPG |
Ga0209474_107231341 | 3300026550 | Soil | HFRTRQRAEALSVYRLGIEIFGVCIIALTGHLGGFLSGVNGPG |
Ga0209648_107359192 | 3300026551 | Grasslands Soil | WAQALPNYRLALEFLGVGVIALTGHLGGFLSGVNTPG |
Ga0179587_104517711 | 3300026557 | Vadose Zone Soil | FRARRRSEELPRYRLVIELLVVGLVALTGHLGGFLSGVNAPS |
Ga0207723_1169641 | 3300026824 | Tropical Forest Soil | RRHAEESLPKYRLPIEAVAVLLVGLTGHLGGFLSGVNGPG |
Ga0207746_10135711 | 3300026865 | Tropical Forest Soil | LRARRHAEESLPKYRLPIEAVAVLLVGLTGHLGGFLSGVNGPG |
Ga0209524_10510941 | 3300027521 | Forest Soil | RAPAPAPPAYRWPVEAVAVALVTLTGHLGGFLSGVNAPG |
Ga0209008_10393531 | 3300027545 | Forest Soil | NQGKVLPGYRLPIEAVAIVIVALTGHLGGFLSGVNGPG |
Ga0209115_10774911 | 3300027567 | Forest Soil | AGKPLPSYRFALEFAAVAVVAATGHLGGFLSGVNGTS |
Ga0209525_11141642 | 3300027575 | Forest Soil | HQRVRRFPERSLPNYRLPIEALAVLIVGLTGHLGGFLSGVNGPG |
Ga0209733_11200982 | 3300027591 | Forest Soil | TEVLPGYRLALEILAVGIVALTGHLGGFLSGVNGQG |
Ga0209329_10664322 | 3300027605 | Forest Soil | RRQKTPLPKSRLMFEFLTVGLVALTAHLGGFLSGVNGPG |
Ga0209007_10226201 | 3300027652 | Forest Soil | FPERSLPNYRLPIEALAVLIVGLTGHLGGFLSGVNGPG |
Ga0209736_10096391 | 3300027660 | Forest Soil | RRSVLLPNYRLALEILGVVLVALTGHLGGFLSGVNGPG |
Ga0209139_101699731 | 3300027795 | Bog Forest Soil | ERLPLMRLGLETVAVAIIALTGHLGGFLSGVNGPS |
Ga0209656_102928122 | 3300027812 | Bog Forest Soil | AHRNPGSKLPLYRLPIELTAAAVVSLTAHLGGFLSGVNGAG |
Ga0209040_100003461 | 3300027824 | Bog Forest Soil | IHWQARRDRENYLPAYRLPIEALAVLLVGLTGHLGGFLSGVNGAG |
Ga0209039_101697713 | 3300027825 | Bog Forest Soil | HRNPGSKLPLYRLPIELAAAAVVALTAHLGGFLSGVNGPG |
Ga0209580_100688831 | 3300027842 | Surface Soil | APALLPRYRVPVELLGVATIALTAHLGGFLSGVNS |
Ga0209180_105565792 | 3300027846 | Vadose Zone Soil | GGVLPGYRLPIELLAVAMVAVTGHLGGFLSGVNGPG |
Ga0209167_101934073 | 3300027867 | Surface Soil | RNQEDILPGYRLPIETVAVVIVAMTGHLGGFLSGVNGPG |
Ga0209579_101297853 | 3300027869 | Surface Soil | RARRAAKALPNYRLPIEFLGVLMVALTGHLGGFLSGVNGPG |
Ga0209624_105340472 | 3300027895 | Forest Soil | ARRRADVLPNYRLALELLAVVLIALTGHLGGFLSGVNVPG |
Ga0209624_106571941 | 3300027895 | Forest Soil | ARRRAEGLPNYRLALEVLGVVLIALTGHLGGFLSGVNLPG |
Ga0209067_103624102 | 3300027898 | Watersheds | QTLRALPSYRWVIELFCVAVVALTGHLGGFLSGVNGPG |
Ga0209415_102951201 | 3300027905 | Peatlands Soil | ARLPEGSLPPYRLPIEAVAVLIVGLTGHLGGFLSGVNGPS |
Ga0265349_10110161 | 3300028037 | Soil | TVSLPTYRLALEVLGVGVVALTGHLGGFLSGVNLPG |
Ga0302224_103782841 | 3300028759 | Palsa | VRRHPEQAMPNLRLPVEAIAVLLVGLTGHLGGFLSGVNGPG |
Ga0302303_102227331 | 3300028776 | Palsa | PKVLPNYRIALEFLGVGIIALTGHLGGFLSGVNGPS |
Ga0265338_105878741 | 3300028800 | Rhizosphere | HRRARKLPEGTLPGYRLPVEAIAALIVGLTGHLGGFLSGVNGPG |
Ga0308309_101569514 | 3300028906 | Soil | RNGTALPAFRIPLELLGVAVIALTGHLGGFLSGVNGPG |
Ga0308309_102251393 | 3300028906 | Soil | RGRRNGTVLPSFRIPLELLGVAVIALTGHLGGFLSGVNSPG |
Ga0222749_102859512 | 3300029636 | Soil | RRRDQESLPKYRLVIEALAILIVMLTAHLGGFLSGVNGAG |
Ga0311368_108058831 | 3300029882 | Palsa | KRPLPGVRLAMELLGVGLIALTGHLGGFVSGVNGPG |
Ga0311362_101539641 | 3300029913 | Bog | ARRRNEYLPSYRLAIEVLGVAVIALTAHLGGFLSGVNGPG |
Ga0311340_112325112 | 3300029943 | Palsa | RMVFLPSYRLMIELVAVAVVAVTGHLGGFLSGVNGPG |
Ga0302281_104120961 | 3300030044 | Fen | RNEYLPSYRLAIEVLGVAVIALTAHLGGFLSGVNGPG |
Ga0302177_103713753 | 3300030053 | Palsa | FSARRAKRPLPGVRLAMELLGVGLIALTGHLGGFVSGVNGPG |
Ga0302182_101624871 | 3300030054 | Palsa | TVYLPNYRLALEVLAVGVVALTGHLGGFLSGVNLPG |
Ga0302176_104002221 | 3300030057 | Palsa | AKRPLPGVRLAMELLGVGLIALTGHLGGFVSGVNGPG |
Ga0311356_116682562 | 3300030617 | Palsa | RARRKAEVLPIYRFALELLAVAIIVLTGHLGGFLSGINSPG |
Ga0302312_100626193 | 3300030746 | Palsa | RRDGKLLPGFRFPLGLLGVAVIALTGHLGGFLSGVNGVN |
Ga0302312_100636391 | 3300030746 | Palsa | LRARRHPGNSLPTYRLSLEAVAVLLVGVTAHLGGFLSGVNGPG |
Ga0075374_113780502 | 3300030855 | Soil | RTRRKQEEVLPGYRLPIEAVAVLIVALTGHLGGFLSGVNGPG |
Ga0073994_122062292 | 3300030991 | Soil | SRRNQEEVLPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG |
Ga0170834_1036264541 | 3300031057 | Forest Soil | FSSPQRLELPSTWRLWIELAAVALIALTGHLGGFLSGVNGPG |
Ga0170822_119603471 | 3300031122 | Forest Soil | EILPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG |
Ga0302323_1018685961 | 3300031232 | Fen | RARRGAEVLPSYCMPIEFLGVIIVALTGHLGGFLSGVNGPG |
Ga0302324_1010659571 | 3300031236 | Palsa | RRRAEALPSYRLAIEFLGVAMVALTGHLGGFLSGVNGPG |
Ga0318541_105897581 | 3300031545 | Soil | ARRRDGSLPAYRLVIEMVGALMVALTAHLGGFLSGVNVPR |
Ga0310686_1039911851 | 3300031708 | Soil | RARRRTEVLPNYRLAFEFLGVALVGLTGHLGGFLSGVNGPG |
Ga0307476_104109941 | 3300031715 | Hardwood Forest Soil | IHWRARRHPEKSLPMYRLPVEALAIVLVGLTGHLGGFLSGVNGPG |
Ga0307476_110487341 | 3300031715 | Hardwood Forest Soil | NQDSLPTYRLVIEAFAVVVIVLTGHLGGFLSGVNGAG |
Ga0307476_113112231 | 3300031715 | Hardwood Forest Soil | ARRRAGVLPSYRLAFEFLGVGLVALTAHLGGFLSGVNGPG |
Ga0307474_108362271 | 3300031718 | Hardwood Forest Soil | RRNQEDLPGYRLPIEAAAVVIVALTGHLGGFLSGVNG |
Ga0307474_108870352 | 3300031718 | Hardwood Forest Soil | EVLPGYRLPIEAVAIVIVALTGHLGGFLSGVNGPG |
Ga0306917_105096063 | 3300031719 | Soil | RRHVEESLPKYRLPIEAIAVLLVGLTGHLGGFLSGVNGPG |
Ga0307469_108176542 | 3300031720 | Hardwood Forest Soil | EEILPGYRLPIEAVAVAIVALTGHLGGFLSGVNGPG |
Ga0306918_104831131 | 3300031744 | Soil | HLRARRHVEESLPKYRLPIEAVAVLLVGLTGHLGGFLSGVNGPG |
Ga0307475_100442151 | 3300031754 | Hardwood Forest Soil | GQSIPFLRLGFEVLAVGVIMLTAHLGGFLSGVNGPG |
Ga0307475_108088752 | 3300031754 | Hardwood Forest Soil | LKERELLPGYRLPIEAVAVVIVSLTGHLGGFLSGVNGPG |
Ga0307475_108504582 | 3300031754 | Hardwood Forest Soil | EGLPGYRLPIETVAVVIVALTGHLGGFLSGVNGAG |
Ga0318548_102555212 | 3300031793 | Soil | VEESLPKYRLPIEAIAVLLVGLTGHLGGFLSGVNRPG |
Ga0307473_110416942 | 3300031820 | Hardwood Forest Soil | HMRTWRKQEEVLPGYRLPLEAVAVVVVALTGHLGGFLSGVNGPG |
Ga0307478_100157396 | 3300031823 | Hardwood Forest Soil | EELPRYRLAIELLGVGLVALTGHLGGFLSGVNGPT |
Ga0307478_104315302 | 3300031823 | Hardwood Forest Soil | AGVLPSYRLAFEFLGVGLVALTAHLGGFLSGVNGPG |
Ga0307478_107589571 | 3300031823 | Hardwood Forest Soil | DFLPSYRFAVEFLAVGMVALTGHLGGFLSGVNLPG |
Ga0306919_104956991 | 3300031879 | Soil | AEESLPKYRLPIEAVAVLLVGLTGHLGGFLSGVNGPG |
Ga0306923_103038201 | 3300031910 | Soil | LRARRHVEESLPKYRLPIEAIAVLLVGLTGHLGGFLSGVNGPG |
Ga0306926_117563022 | 3300031954 | Soil | TSKSLPGYRLPIELLGIMVVALTGHLGGFLSGVNGPG |
Ga0307479_120401932 | 3300031962 | Hardwood Forest Soil | RPNQEETLPGYRLPIEAVAVFIVALTGHLGGFLSGVNGPG |
Ga0318533_110999572 | 3300032059 | Soil | RHAEESLPKYRLPIEAVAVLLVGLTGHLGGFLSGVNGPG |
Ga0306924_121935621 | 3300032076 | Soil | LRAWRHVEESLPKYRLPIEAIAVLLVGLTGHLGGFLSGVNAPG |
Ga0307470_100226551 | 3300032174 | Hardwood Forest Soil | IHRRTRRNQEEVLPGYRLPIEAVAVVIVALTGHLGGFLSGVNGPG |
Ga0307471_1002129651 | 3300032180 | Hardwood Forest Soil | ETLPGYRLPIEAVAVFIVALTGHLGGFLSGVNGPG |
Ga0307471_1011360051 | 3300032180 | Hardwood Forest Soil | HWRARRLPEESLPKYRLPIEAVAVLLVGLTGHLGGFLSGVNGPG |
Ga0307471_1037243242 | 3300032180 | Hardwood Forest Soil | RRTAPLPRYRLAIEFLAFGLVTLTAHLGGFLSGVNGPG |
Ga0307472_1000404251 | 3300032205 | Hardwood Forest Soil | QRTSKALPSYRLPIELLGIVIVALTGHLGGFLSGVNGPG |
Ga0307472_1002970182 | 3300032205 | Hardwood Forest Soil | AGQKPELALPSYRLLLEAVGVLLITVTGHLGGFLSGVNGPG |
Ga0310914_114172311 | 3300033289 | Soil | MRTQREREQVLPGYRLPIEAMAIVFVAVTGHRGGFLGGVNGTG |
Ga0334827_238536_416_532 | 3300034065 | Soil | RPEGNLPLYRLPIELVAVGTIALTAHLGGFLSGVNGPG |
⦗Top⦘ |