NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F013797

Metagenome Family F013797

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013797
Family Type Metagenome
Number of Sequences 268
Average Sequence Length 43 residues
Representative Sequence MNPAEPERKFFPSGAIFFFALLLVFYAALWLVIYWLMIARS
Number of Associated Samples 183
Number of Associated Scaffolds 268

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 52.61 %
% of genes near scaffold ends (potentially truncated) 22.01 %
% of genes from short scaffolds (< 2000 bps) 82.84 %
Associated GOLD sequencing projects 155
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.299 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(9.702 % of family members)
Environment Ontology (ENVO) Unclassified
(36.940 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.537 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 40.58%    β-sheet: 0.00%    Coil/Unstructured: 59.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 268 Family Scaffolds
PF00116COX2 38.06
PF09699Paired_CXXCH_1 7.09
PF00115COX1 6.34
PF13787HXXEE 1.87
PF14537Cytochrom_c3_2 1.87
PF13435Cytochrome_C554 1.49
PF13442Cytochrome_CBB3 1.49
PF00355Rieske 1.12
PF00033Cytochrome_B 0.75
PF13620CarboxypepD_reg 0.75
PF04107GCS2 0.75
PF09626DHC 0.75
PF17131LolA_like 0.75
PF00581Rhodanese 0.37
PF00034Cytochrom_C 0.37
PF06968BATS 0.37
PF01569PAP2 0.37
PF00027cNMP_binding 0.37
PF01494FAD_binding_3 0.37
PF01578Cytochrom_C_asm 0.37
PF00032Cytochrom_B_C 0.37
PF12697Abhydrolase_6 0.37
PF12833HTH_18 0.37
PF03734YkuD 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 268 Family Scaffolds
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 38.06
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 38.06
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 1.12
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.75
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.37
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.37
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.37
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.37
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.30 %
UnclassifiedrootN/A9.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16940443All Organisms → cellular organisms → Bacteria9337Open in IMG/M
2088090014|GPIPI_17357049All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1251Open in IMG/M
2140918007|ConsensusfromContig12706All Organisms → cellular organisms → Bacteria1452Open in IMG/M
2199352024|deeps__Contig_121496Not Available536Open in IMG/M
2228664022|INPgaii200_c0945406All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium704Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100463726Not Available678Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100668113All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1863Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100675695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis1112Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100678109All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium628Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100678163All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium666Open in IMG/M
3300000443|F12B_10411365All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium956Open in IMG/M
3300000559|F14TC_103757361All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300000787|JGI11643J11755_11744357Not Available530Open in IMG/M
3300000789|JGI1027J11758_12636586All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium514Open in IMG/M
3300000881|JGI10215J12807_1435813All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis506Open in IMG/M
3300000955|JGI1027J12803_100135787All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300000955|JGI1027J12803_100176541All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis635Open in IMG/M
3300000955|JGI1027J12803_100368089All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae866Open in IMG/M
3300000955|JGI1027J12803_100469892All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis784Open in IMG/M
3300000955|JGI1027J12803_102479567All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300000955|JGI1027J12803_102791496All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300000955|JGI1027J12803_103788023All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300000955|JGI1027J12803_104472896All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis837Open in IMG/M
3300000955|JGI1027J12803_106505966All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300000955|JGI1027J12803_106574340All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300000956|JGI10216J12902_101041200All Organisms → cellular organisms → Bacteria2079Open in IMG/M
3300001686|C688J18823_10249206All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1181Open in IMG/M
3300002128|JGI24036J26619_10068776All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium703Open in IMG/M
3300002568|C688J35102_119104136All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300002899|JGIcombinedJ43975_10068327All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae618Open in IMG/M
3300003319|soilL2_10317705All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis → Thermocrinis ruber1863Open in IMG/M
3300004114|Ga0062593_100029694All Organisms → cellular organisms → Bacteria3086Open in IMG/M
3300004114|Ga0062593_100088434All Organisms → cellular organisms → Bacteria2131Open in IMG/M
3300004114|Ga0062593_101929145All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae653Open in IMG/M
3300004114|Ga0062593_102617837All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae573Open in IMG/M
3300004153|Ga0063455_101085677All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae589Open in IMG/M
3300004156|Ga0062589_100229069All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1372Open in IMG/M
3300004156|Ga0062589_101026871All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae773Open in IMG/M
3300004643|Ga0062591_100585601All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300004808|Ga0062381_10104652All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300005093|Ga0062594_100391272All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1117Open in IMG/M
3300005164|Ga0066815_10018713All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae947Open in IMG/M
3300005186|Ga0066676_10166804All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1395Open in IMG/M
3300005290|Ga0065712_10137743All Organisms → cellular organisms → Bacteria1480Open in IMG/M
3300005290|Ga0065712_10284359All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae889Open in IMG/M
3300005293|Ga0065715_10482118All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae796Open in IMG/M
3300005330|Ga0070690_100139015All Organisms → cellular organisms → Bacteria1647Open in IMG/M
3300005332|Ga0066388_100012686All Organisms → cellular organisms → Bacteria6763Open in IMG/M
3300005332|Ga0066388_101140844All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1325Open in IMG/M
3300005332|Ga0066388_101482311All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1185Open in IMG/M
3300005332|Ga0066388_102624271All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300005332|Ga0066388_103256232All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dadabacteria → Candidatus Dadabacteria bacterium830Open in IMG/M
3300005338|Ga0068868_100850419All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae826Open in IMG/M
3300005340|Ga0070689_100694024All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae888Open in IMG/M
3300005354|Ga0070675_101071374All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae741Open in IMG/M
3300005355|Ga0070671_101596844Not Available578Open in IMG/M
3300005364|Ga0070673_101347864All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae671Open in IMG/M
3300005436|Ga0070713_101524028All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae649Open in IMG/M
3300005455|Ga0070663_100390129All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1136Open in IMG/M
3300005455|Ga0070663_101272421All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis648Open in IMG/M
3300005456|Ga0070678_100374570All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1230Open in IMG/M
3300005467|Ga0070706_100103056All Organisms → cellular organisms → Bacteria2653Open in IMG/M
3300005529|Ga0070741_10000001All Organisms → cellular organisms → Bacteria1605437Open in IMG/M
3300005529|Ga0070741_10017957All Organisms → cellular organisms → Bacteria → Acidobacteria11537Open in IMG/M
3300005529|Ga0070741_10078445All Organisms → cellular organisms → Bacteria3653Open in IMG/M
3300005542|Ga0070732_10002570All Organisms → cellular organisms → Bacteria9775Open in IMG/M
3300005543|Ga0070672_100282501All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300005543|Ga0070672_100825648All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae816Open in IMG/M
3300005544|Ga0070686_100928914All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae709Open in IMG/M
3300005575|Ga0066702_10082215All Organisms → cellular organisms → Bacteria1805Open in IMG/M
3300005718|Ga0068866_10640302All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium722Open in IMG/M
3300005718|Ga0068866_11288823Not Available530Open in IMG/M
3300005764|Ga0066903_100216966All Organisms → cellular organisms → Bacteria2893Open in IMG/M
3300005764|Ga0066903_100312456All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae2500Open in IMG/M
3300005764|Ga0066903_101288854All Organisms → cellular organisms → Bacteria1364Open in IMG/M
3300005764|Ga0066903_101658953All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1215Open in IMG/M
3300005764|Ga0066903_101756355All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300005764|Ga0066903_102621473All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae977Open in IMG/M
3300005764|Ga0066903_105450226All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae671Open in IMG/M
3300005764|Ga0066903_108464016All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae525Open in IMG/M
3300005937|Ga0081455_10106962All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae2231Open in IMG/M
3300005993|Ga0080027_10212939All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium756Open in IMG/M
3300005993|Ga0080027_10260291All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300006046|Ga0066652_100164671All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis1874Open in IMG/M
3300006046|Ga0066652_100909509All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae839Open in IMG/M
3300006059|Ga0075017_100243607All Organisms → cellular organisms → Bacteria1313Open in IMG/M
3300006173|Ga0070716_101384128All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis571Open in IMG/M
3300006173|Ga0070716_101747428All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300006175|Ga0070712_100789504All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis814Open in IMG/M
3300006175|Ga0070712_101351894All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis621Open in IMG/M
3300006237|Ga0097621_100374192All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1271Open in IMG/M
3300006237|Ga0097621_102348307Not Available510Open in IMG/M
3300006642|Ga0075521_10158966All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1062Open in IMG/M
3300006854|Ga0075425_102183450Not Available617Open in IMG/M
3300006881|Ga0068865_100314202All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300006881|Ga0068865_102134815Not Available509Open in IMG/M
3300009094|Ga0111539_10389509All Organisms → cellular organisms → Bacteria1623Open in IMG/M
3300009098|Ga0105245_12217567All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300009148|Ga0105243_11298347All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300009176|Ga0105242_10008266All Organisms → cellular organisms → Bacteria7995Open in IMG/M
3300009176|Ga0105242_11220358All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300009545|Ga0105237_11134284All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300009651|Ga0105859_1211926Not Available574Open in IMG/M
3300010040|Ga0126308_10107018All Organisms → cellular organisms → Bacteria1721Open in IMG/M
3300010044|Ga0126310_10013847All Organisms → cellular organisms → Bacteria3853Open in IMG/M
3300010322|Ga0134084_10175477All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300010323|Ga0134086_10368080Not Available572Open in IMG/M
3300010358|Ga0126370_11074182All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300010361|Ga0126378_13172790Not Available523Open in IMG/M
3300010375|Ga0105239_12699175All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300010399|Ga0134127_12048010All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300010937|Ga0137776_1243836All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300011003|Ga0138514_100115778All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300011444|Ga0137463_1312991Not Available572Open in IMG/M
3300012198|Ga0137364_10664577All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300012204|Ga0137374_10031521All Organisms → cellular organisms → Bacteria5789Open in IMG/M
3300012204|Ga0137374_10049664All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium4337Open in IMG/M
3300012204|Ga0137374_10229204All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300012204|Ga0137374_11136187All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300012206|Ga0137380_10408469All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300012206|Ga0137380_10981994All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis723Open in IMG/M
3300012209|Ga0137379_10425487All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis1237Open in IMG/M
3300012210|Ga0137378_11478099All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300012350|Ga0137372_10600786All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia807Open in IMG/M
3300012354|Ga0137366_10102244All Organisms → cellular organisms → Bacteria2171Open in IMG/M
3300012354|Ga0137366_10371124All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1045Open in IMG/M
3300012356|Ga0137371_10148002All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300012358|Ga0137368_10027054All Organisms → cellular organisms → Bacteria5281Open in IMG/M
3300012358|Ga0137368_10779573Not Available594Open in IMG/M
3300012891|Ga0157305_10188582All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis583Open in IMG/M
3300012916|Ga0157310_10404416All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300012951|Ga0164300_10544753All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium673Open in IMG/M
3300012961|Ga0164302_10298565All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1050Open in IMG/M
3300012971|Ga0126369_11854706All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300012971|Ga0126369_13328478All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300012984|Ga0164309_10853605All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dadabacteria → Candidatus Dadabacteria bacterium738Open in IMG/M
3300013296|Ga0157374_10569504All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300013296|Ga0157374_11839603Not Available631Open in IMG/M
3300013296|Ga0157374_12657465All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300013297|Ga0157378_11940057All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dadabacteria → Candidatus Dadabacteria bacterium638Open in IMG/M
3300013297|Ga0157378_12952377Not Available527Open in IMG/M
3300013308|Ga0157375_12007507All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis687Open in IMG/M
3300014487|Ga0182000_10039571All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300014968|Ga0157379_11616106All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300015075|Ga0167636_1008829All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300015085|Ga0167632_1000018All Organisms → cellular organisms → Bacteria80353Open in IMG/M
3300015090|Ga0167634_1013757All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis1149Open in IMG/M
3300015090|Ga0167634_1053327Not Available555Open in IMG/M
3300015197|Ga0167638_1000119All Organisms → cellular organisms → Bacteria18775Open in IMG/M
3300015201|Ga0173478_10095920All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300015371|Ga0132258_10019412All Organisms → cellular organisms → Bacteria14758Open in IMG/M
3300015371|Ga0132258_10234801All Organisms → cellular organisms → Bacteria4471Open in IMG/M
3300015371|Ga0132258_10810910All Organisms → cellular organisms → Bacteria2360Open in IMG/M
3300015371|Ga0132258_12976067All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1175Open in IMG/M
3300015372|Ga0132256_100241742All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1870Open in IMG/M
3300015372|Ga0132256_101649982All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium751Open in IMG/M
3300015372|Ga0132256_103616553All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300015372|Ga0132256_103731203All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300015373|Ga0132257_100392256All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300015374|Ga0132255_101857051All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium916Open in IMG/M
3300015374|Ga0132255_103776330All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis644Open in IMG/M
3300015374|Ga0132255_104245142All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300016270|Ga0182036_11339794Not Available598Open in IMG/M
3300016294|Ga0182041_10448944All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300016319|Ga0182033_11843362All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300016341|Ga0182035_11098687All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300016371|Ga0182034_11602860Not Available571Open in IMG/M
3300016371|Ga0182034_11918631All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300016387|Ga0182040_11086325Not Available670Open in IMG/M
3300016404|Ga0182037_10828390All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300016445|Ga0182038_12176551Not Available503Open in IMG/M
3300017927|Ga0187824_10065594All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dadabacteria → Candidatus Dadabacteria bacterium1134Open in IMG/M
3300017930|Ga0187825_10013518All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2732Open in IMG/M
3300017930|Ga0187825_10143170All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium843Open in IMG/M
3300017936|Ga0187821_10111504All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis1014Open in IMG/M
3300017947|Ga0187785_10022167All Organisms → cellular organisms → Bacteria2255Open in IMG/M
3300017947|Ga0187785_10238305All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300017959|Ga0187779_10051798All Organisms → cellular organisms → Bacteria2395Open in IMG/M
3300017959|Ga0187779_10678471All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300017966|Ga0187776_10839569All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300018032|Ga0187788_10266648All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300018058|Ga0187766_10098507All Organisms → cellular organisms → Bacteria1770Open in IMG/M
3300018067|Ga0184611_1019313All Organisms → cellular organisms → Bacteria2081Open in IMG/M
3300018072|Ga0184635_10099811All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300018072|Ga0184635_10147923All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis938Open in IMG/M
3300018073|Ga0184624_10222191All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium845Open in IMG/M
3300018476|Ga0190274_11123766All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300019361|Ga0173482_10399475All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300019362|Ga0173479_10213171All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300019874|Ga0193744_1046813All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis826Open in IMG/M
3300020021|Ga0193726_1005525All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus7475Open in IMG/M
3300021168|Ga0210406_10009877All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia9461Open in IMG/M
3300021413|Ga0193750_1093403All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium528Open in IMG/M
3300021445|Ga0182009_10050286All Organisms → cellular organisms → Bacteria1759Open in IMG/M
3300021445|Ga0182009_10313825All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis793Open in IMG/M
3300021445|Ga0182009_10840054All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis504Open in IMG/M
3300021953|Ga0213880_10040244All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1115Open in IMG/M
3300021953|Ga0213880_10202577All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300022756|Ga0222622_10447936All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300024186|Ga0247688_1044512Not Available704Open in IMG/M
3300025315|Ga0207697_10112664All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300025315|Ga0207697_10341768All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300025544|Ga0208078_1000734All Organisms → cellular organisms → Bacteria8604Open in IMG/M
3300025552|Ga0210142_1000911All Organisms → cellular organisms → Bacteria6210Open in IMG/M
3300025878|Ga0209584_10095361All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300025907|Ga0207645_10116050All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300025907|Ga0207645_11012193All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium562Open in IMG/M
3300025910|Ga0207684_10760069All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300025915|Ga0207693_10439205All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300025923|Ga0207681_10175752All Organisms → cellular organisms → Bacteria1627Open in IMG/M
3300025926|Ga0207659_10328222All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1264Open in IMG/M
3300025930|Ga0207701_10183762All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300025931|Ga0207644_10571828All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300025934|Ga0207686_10005639All Organisms → cellular organisms → Bacteria6708Open in IMG/M
3300025936|Ga0207670_10812177All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300025938|Ga0207704_10447870All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1030Open in IMG/M
3300025938|Ga0207704_10708533All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium834Open in IMG/M
3300025938|Ga0207704_11978645All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300025940|Ga0207691_10107710All Organisms → cellular organisms → Bacteria2481Open in IMG/M
3300025940|Ga0207691_10755278All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300025941|Ga0207711_11620889All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300025960|Ga0207651_10611752All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300026088|Ga0207641_11278829All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300026121|Ga0207683_10686475All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium949Open in IMG/M
3300027537|Ga0209419_1018902All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae1245Open in IMG/M
3300027778|Ga0209464_10119528All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300027842|Ga0209580_10015361All Organisms → cellular organisms → Bacteria3348Open in IMG/M
3300027902|Ga0209048_10008714All Organisms → cellular organisms → Bacteria9236Open in IMG/M
3300031231|Ga0170824_106699450All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300031231|Ga0170824_126053295Not Available667Open in IMG/M
3300031446|Ga0170820_11761626All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300031446|Ga0170820_12173671Not Available586Open in IMG/M
3300031446|Ga0170820_12401084All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300031446|Ga0170820_16958528All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031474|Ga0170818_115017330All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium900Open in IMG/M
3300031538|Ga0310888_10400470All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300031545|Ga0318541_10017524All Organisms → cellular organisms → Bacteria3368Open in IMG/M
3300031573|Ga0310915_10777890All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300031716|Ga0310813_11878217Not Available563Open in IMG/M
3300031720|Ga0307469_10060527All Organisms → cellular organisms → Bacteria2444Open in IMG/M
3300031740|Ga0307468_100438098All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300031744|Ga0306918_10007408All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6003Open in IMG/M
3300031744|Ga0306918_10474513All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300031747|Ga0318502_10854011All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300031890|Ga0306925_11812685All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031910|Ga0306923_12397761All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031912|Ga0306921_10137046All Organisms → cellular organisms → Bacteria2859Open in IMG/M
3300031942|Ga0310916_10437723All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300031947|Ga0310909_11408512Not Available558Open in IMG/M
3300031996|Ga0308176_11822188All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300032001|Ga0306922_10543240All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300032001|Ga0306922_11108506All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300032001|Ga0306922_11412775All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300032174|Ga0307470_10000006All Organisms → cellular organisms → Bacteria157752Open in IMG/M
3300032180|Ga0307471_101217721All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300032180|Ga0307471_101589644All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300032205|Ga0307472_100012959All Organisms → cellular organisms → Bacteria4265Open in IMG/M
3300032205|Ga0307472_101372555All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium684Open in IMG/M
3300032261|Ga0306920_100067579All Organisms → cellular organisms → Bacteria5231Open in IMG/M
3300032261|Ga0306920_101608331All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300032828|Ga0335080_11191858Not Available766Open in IMG/M
3300032955|Ga0335076_10045059All Organisms → cellular organisms → Bacteria4391Open in IMG/M
3300033412|Ga0310810_10027042All Organisms → cellular organisms → Bacteria → Acidobacteria6972Open in IMG/M
3300033412|Ga0310810_10435690All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300033475|Ga0310811_10925153All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium781Open in IMG/M
3300033805|Ga0314864_0113164All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300034123|Ga0370479_0060309All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300034125|Ga0370484_0000753All Organisms → cellular organisms → Bacteria5526Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.24%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.49%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.49%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.49%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.49%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.49%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.49%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.12%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.75%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.75%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.75%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.75%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.75%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.75%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.37%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.37%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.37%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.37%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.37%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.37%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.37%
Glacier Forefield SoilsEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils0.37%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.37%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.37%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.37%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.37%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.37%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.37%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009651Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015075Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river)EnvironmentalOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015090Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)EnvironmentalOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019874Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025544Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M
3300034123Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_021872702088090014SoilMNTESEKKFFPSGAIFFFALLLIFYAALWLVIYWLMIARS
GPIPI_004857402088090014SoilFELMEPSEPENGRRFFPVGAIFFFALLILFYAALWLVVYWIMIARG
A_all_C_023869202140918007SoilVNGPDETDAKFFPSGAIFFFVLLLVFYAALWLVIYGLMIARS
deeps_021918602199352024SoilMESGETDDKFFPSGAIAFFVVLLVFYAFLWLVIYGFVVARS
INPgaii200_094540622228664022SoilMEPSEPEAEKKFFPSGAIFFFALLLVFYAALWFVIY
INPhiseqgaiiFebDRAFT_10046372623300000364SoilMDPGKPDNKFFPSGAIFFFALLLLFYAALWFVIYWIMIARS*
INPhiseqgaiiFebDRAFT_10066811333300000364SoilMNIEPEKKFFPSGAIFFFALLLIFYAALWLVIYWLMIARS*
INPhiseqgaiiFebDRAFT_10067569513300000364SoilMQPAGPDNDKRFFPSGAVFFFVLLLVFYAALWFVIYWIMIARS*
INPhiseqgaiiFebDRAFT_10067810913300000364SoilMEPSEPEAEKKFFPSGAIFFFVLLLIFYAALWFVIYWIMI
INPhiseqgaiiFebDRAFT_10067816323300000364SoilMDRSGPDNEKKFFPSGAVFFFALLLVFYAALWFVIYWIMIARS*
F12B_1041136533300000443SoilMEPSEPENGKRFFPSGAIFFFALLILFYAALWLVVYWIMIARA*
F14TC_10375736133300000559SoilMLTTADVDVMAPSEPEKKFFPSGAIFFFALLIVFYAALWLVVYWLMIMRA*
JGI11643J11755_1174435723300000787SoilMDPGELENGRRFFPSGAIFFFALLIVFYAALWLVLYWIMVARA*
JGI1027J11758_1263658623300000789SoilMDRSGPDNEKKFFPSGAVFFFALLLVFYAALWFVIYWIMI
JGI10215J12807_143581323300000881SoilFEPMEPGEPENGRRFFPSGAIFFFALLIAFYAALWLVIYWIMVARA*
JGI1027J12803_10013578723300000955SoilMDRSGPDNEKKFFPSGAVFFFALLLVFYAALWFVIYWIMIAR
JGI1027J12803_10017654123300000955SoilMKPSEPENGRRFFPTGAIFFFALLILFYAALWLVVYWLMIARA*
JGI1027J12803_10036808923300000955SoilMEPSEPENGRRFFPVGAIFFFALLILFYAALWLVVYWIMIARG*
JGI1027J12803_10046989223300000955SoilKKFFPSGAIFFFALLLIFYAALWLVIYWLMIARS*
JGI1027J12803_10247956713300000955SoilMEPSEPEAEKKFFPSGAIFFFVLLLIFYAALWFVIYWIMIAR
JGI1027J12803_10279149613300000955SoilDSDLGMMRPGEPDNSKRFFPSGAIFFFAVLILFYAALWLVVYWIMIARA*
JGI1027J12803_10378802313300000955SoilMESGETDNGRRFFPSGAILFFALLILFYAALWLVVYWIMIA
JGI1027J12803_10447289623300000955SoilMMEPNEPENGKRFFPSGAIFFFVILLLFYAALWLIIYWIMIARA*
JGI1027J12803_10650596613300000955SoilMPQVMEPNESKSEKQFFPSGAIFFFALLLFFYAGLWLVIYWIMIARS
JGI1027J12803_10657434023300000955SoilMDPDGPENENRFFPSGAIFFFALLLVFYAALWFVIYWIMIARS*
JGI10216J12902_10104120033300000956SoilMEPGGPENGKRFFPSGAVFFFALLILFYAALWLVVYWIMIARA*
C688J18823_1024920623300001686SoilVNNPPGTAEKFFPSGAIFFFGALVVFYALLWLVIYGLMIARS*
JGI24036J26619_1006877623300002128Corn, Switchgrass And Miscanthus RhizosphereMEPGEPENGRRFFPSGAIFFFALLIVFYAALWLVIYWI
C688J35102_11910413613300002568SoilMSEGNEPNESSDKFFPSGAIFFFAVLLVFYALLWLVIYGLMIARS*
JGIcombinedJ43975_1006832723300002899SoilMNGSSESEEKFFPIGAIFFFVALLVFYALLWLVIYGVMVARA*
soilL2_1031770523300003319Sugarcane Root And Bulk SoilMKSEPTQEGFFPRGAIFFFGLLVAFYALLWGVIYFLMIARS*
Ga0062593_10002969423300004114SoilMKDRESEQRFFPSGAIFFFVLLLLFYAALWFVIYWIMIARS*
Ga0062593_10008843423300004114SoilMNEPNQNNEESRPFFPSGAIFFFALLLVFYALLWLVIYALMITRS*
Ga0062593_10192914513300004114SoilMEHNESQPKFFPSGAILFFVLLLIFYSALWFVLYWVMIARS*
Ga0062593_10261783723300004114SoilMEEQEPAAERFFPSGAIAFFVVLLVFYAALWFVIYGVMVARS*
Ga0063455_10108567713300004153SoilVNNPPGTAEKFFPSGAIFFFGALVVFYALLWLVIYGLMIARR*
Ga0062589_10022906923300004156SoilMNEPNQNNEESGPFFPSGAIFFFALLLVFYALLWLVIYALMITRS*
Ga0062589_10102687123300004156SoilMEEQDPASEKFFPSGAIAFFIVLLVFYAALWFVIYGVMVARS*
Ga0062591_10058560113300004643SoilMESNGTDEKFFPGGAIAFFVVLVVFYALLWLVIYGLMIARS*
Ga0062381_1010465223300004808Wetland SedimentMKESETETNFFPSGAIFFFVLLLLFYALLWLVIYGLMIARS*
Ga0062594_10039127223300005093SoilMNELNQNNEESRPFFPSGAIFFFALLLVFYALLWLVIYALMITRS*
Ga0066815_1001871323300005164SoilMEPGEPESGKRFFPTGAIFFFALLILFYAVLWLVIYWLMVARA*
Ga0066676_1016680433300005186SoilMEPGEPENARRFFPSGAIFFFALLIVFYAALWLVVYWIMVARA*
Ga0065712_1013774323300005290Miscanthus RhizosphereMINVESETEKKFFPSGAIFFFGVLLVFYAALWLVIYWLMIARS*
Ga0065712_1028435923300005290Miscanthus RhizosphereMKDSESEQRFFPSGAIFFFVLLLLFYAALWFVIYWIMIARS*
Ga0065715_1048211823300005293Miscanthus RhizosphereMEPGEPENGRRFFPTGAIFFFALLIVFYAALWLIIYWIMVARA*
Ga0070690_10013901523300005330Switchgrass RhizosphereMNGPPEGEDKFHPRGAIAFFVGLVIFYALLWLVIYGLMVARA*
Ga0066388_10001268633300005332Tropical Forest SoilMENDARDNEKSFFPRGAIFFFALLLVFYAALWLTIYWLMIARS*
Ga0066388_10114084423300005332Tropical Forest SoilMNPVKPGKEKSFFPSGAIFFFTLLLVFYAALWLVIYGLMIARS*
Ga0066388_10148231113300005332Tropical Forest SoilQNRVMNPAEPEREKSFFPSGAIFFFALLLVFYAALWLVIYWLMIARS*
Ga0066388_10262427113300005332Tropical Forest SoilMEPGEQEGGKRFFPSGAIFFFALLILFYAALWLVIYSIMIARA*
Ga0066388_10325623223300005332Tropical Forest SoilMEPSESENGGRFFPRGAIFFFALLILFYAALWLVVYWLMIARA*
Ga0068868_10085041923300005338Miscanthus RhizosphereMEYDKSKDKFFPSGAIFFFVLLLVFYSALWFVLYWIMIARS*
Ga0070689_10069402423300005340Switchgrass RhizosphereMEEQEPASEKFFPSGAIAFFVVLLVFYAALWFVIYGVMVARS*
Ga0070675_10107137423300005354Miscanthus RhizosphereFEPMEPGEPENGRRFFPSGAIFFFALLIVFYAALWLVIYWIMVARA*
Ga0070671_10159684413300005355Switchgrass RhizosphereVNHSPESEEKFFPSGAIFFFVALLVFYALLWLVIYGLMVARA*
Ga0070673_10134786423300005364Switchgrass RhizosphereVIEPDAKENKFFPSGAIFFFVLLLLFYALLWLVIYGLMIARS*
Ga0070713_10152402823300005436Corn, Switchgrass And Miscanthus RhizosphereMNGGDEPEQKFFPSGAISFFVVLLIFYALLWLVIYGVMIARS*
Ga0070663_10039012913300005455Corn RhizosphereSVSLITMEYDKPKDKFFPAGAIFFFVLLLLFYSALWFVLYWIMIARS*
Ga0070663_10127242123300005455Corn RhizosphereMEHDKSQDKFFPSGAVFFFVLLLIFYSALWFVLYWLMIARS*
Ga0070678_10037457023300005456Miscanthus RhizosphereMESDETEPKFFPSGAIFFFVALLVFYAALWLVIYALMVGRS*
Ga0070706_10010305633300005467Corn, Switchgrass And Miscanthus RhizosphereMESGQPGNEKPFFPSGAIFFFTLLLVFYAALWLVIYWVMVARS*
Ga0070741_1000000113883300005529Surface SoilVNEPNETGGKSFFPSGAIFFFVLLLIFYALLWLLIYWIMIARS*
Ga0070741_1001795783300005529Surface SoilMMGRGEPEGGKRFFPSGAIFFFALLILFYAALWLVIYWLMIARA*
Ga0070741_1007844543300005529Surface SoilMELPSADEEKKFVPSGAIFFFSMLLVFYAALWLVIYWLMVARS*
Ga0070732_1000257083300005542Surface SoilMEPAESEPDKGFFPSGAIFFFALLLLFYAALWLVIYWLMIARS*
Ga0070672_10028250133300005543Miscanthus RhizosphereMKDRESEQRFFPSGAIFFFVLLLLFYAALWFVIYWIMIAQS*
Ga0070672_10082564823300005543Miscanthus RhizosphereMNGSPESDEKFYPRGAIAFFVGLVIFYALLWLVIYGLMVARA*
Ga0070686_10092891423300005544Switchgrass RhizosphereMEHNESQPKFFPSGAILFFVLLLIFYRALWFVLYWVMIARS*
Ga0066702_1008221513300005575SoilGSKSKLGMDNEEKFFPTGAIFFFVALLVFYAGLWLVIYGLMIARS*
Ga0068866_1064030223300005718Miscanthus RhizosphereMEHDKSQDKFFPSGAVFFFVLLLIFYSALWFVLYWLM
Ga0068866_1128882313300005718Miscanthus RhizosphereMNGSPENEEKFFPSGAIFFFVALLIFYALLWLVIYGLMVARA*
Ga0066903_10021696633300005764Tropical Forest SoilMNTENEKKFFPSGAIFFFALLLVFYVALWLVVYWIMIARS*
Ga0066903_10031245623300005764Tropical Forest SoilMEPGERENERRFFPSGAIFFFALLIVFYAALWLVVYWIMIMRA*
Ga0066903_10128885413300005764Tropical Forest SoilMNPAEPEKEKSFFPSGAIFFFALLLVFYTALWLVIYWLMIARS*
Ga0066903_10165895323300005764Tropical Forest SoilMKESDERDQPEAFFPSGAIFFFAFLLVFYALLWFVVYGLMIMRS*
Ga0066903_10175635523300005764Tropical Forest SoilMNPAEPEKKFFPSGAIFFFALLLIFYAALWLVIYWLMIARS*
Ga0066903_10262147323300005764Tropical Forest SoilQAPSARKTAMNADPQKEEKFFPQGAIFFFAILLVFYAVVWLVIYWLMIARS*
Ga0066903_10545022623300005764Tropical Forest SoilMLTTGDVDVMAPSEPEKKFFPSGAIFFFALLIVFYAALWLVVYLLMIARA*
Ga0066903_10846401623300005764Tropical Forest SoilMPQPTEPQETKAFFPSGAIFFFALLILFYAALWLVVYWIMVSRA*
Ga0081455_1010696213300005937Tabebuia Heterophylla RhizosphereNFELMEPGGPENGKGFFPSGAIFFFALLIVFYAALWLVVYWIMVARA*
Ga0080027_1021293923300005993Prmafrost SoilVTVPNETKDKFFPSGAIFFFVLLLVFYALLWLVIYGLMIARS*
Ga0080027_1026029123300005993Prmafrost SoilLSEQNDTDTGKTFFPSGAIFFFAALLLFYSVLWLVIYWIMIARS*
Ga0066652_10016467133300006046SoilMNDPSNGDKFFPSGAILFFAALVVFYALLWLVIYWLMIARS*
Ga0066652_10090950923300006046SoilVNDSLEPEERFFPRGAIVFFAALLIFYAVLWLVIYGLMVARA*
Ga0075017_10024360723300006059WatershedsVQEPNDPNNGKPFFPSGAIFFFALLLLFYAALWFVIYWIMISRS*
Ga0070716_10138412823300006173Corn, Switchgrass And Miscanthus RhizosphereMNPAEPERKFFPSGAIFFFALLLVFYAALWLVIYWLMIARS*
Ga0070716_10174742813300006173Corn, Switchgrass And Miscanthus RhizosphereMEEPLPSASQPSESDQRFFPRGAIFFFGLLVVLYAAVWFIIYWLMIARA*
Ga0070712_10078950423300006175Corn, Switchgrass And Miscanthus RhizosphereMMDTGEPENGKRFFPSGAIFFFALLILFYAALWLVIYWIMIARA*
Ga0070712_10135189423300006175Corn, Switchgrass And Miscanthus RhizosphereMEDKESERQFFPSGAIFFFVLLLLFYAALWFVLYWIMIARS*
Ga0097621_10037419233300006237Miscanthus RhizosphereMESNGTDEKFFPRGAIAFFIGLLVFYAFLWLVIYGLMVARS*
Ga0097621_10234830723300006237Miscanthus RhizosphereMTEPNDNNNGKPFFPSGAIFFFATLLVFYALLWLVIYWIMITRS*
Ga0075521_1015896613300006642Arctic Peat SoilGMMESDETPKFFPSGAIFFFVLLLLFYAVLWLVIYGLMIARS*
Ga0075425_10218345023300006854Populus RhizosphereMEPGEPENGRRFFPSGAIFFFALLIAFYAALWLVIYWIMVARA*
Ga0068865_10031420223300006881Miscanthus RhizosphereMNGPPESDEKFYPRGAIAFFVGLVIFYALLWLVIYGLMVARA*
Ga0068865_10213481523300006881Miscanthus RhizosphereMEPGQTNDKFFPSGAIFFFVSLLVFYALLWLVIYGLMIARS*
Ga0111539_1038950923300009094Populus RhizosphereMEPGEPENGRRFFPSGAIFFFALLIAFYAVLWLVVYWIMVARA*
Ga0105245_1221756713300009098Miscanthus RhizosphereSADEEKKFVPSGAIFFFSMLLVFYAALWLVIYWLMVARS*
Ga0105243_1129834723300009148Miscanthus RhizosphereVLIEFESMEPGEPENGKRFFPSGAIFFFALLIVFYAALWLVIYWIMVARA*
Ga0105242_1000826643300009176Miscanthus RhizosphereMSGPPETEQKFFPSGAIFFFAALIVFYALLWLVIYWVMIARS*
Ga0105242_1122035813300009176Miscanthus RhizosphereMNEPNDNNNGKPFFPSGAIFFFSTLLVFYALLWLVIYWIMITRS*
Ga0105237_1113428423300009545Corn RhizosphereMNPAEPGNEKPFFPSGAVFFFALLLLFYAALWLVIYWLMIVRS*
Ga0105859_121192623300009651Permafrost SoilVTEPNETEEKFFPRGAIYFFALLLVFYALLWLVIYWLMIARS*
Ga0126308_1010701833300010040Serpentine SoilMETGEPENGRRFFPSGAIFFFALLIAFYAALWLVIYWIMVARA*
Ga0126310_1001384733300010044Serpentine SoilVTEPNDASAKSFFPSGAIFFFVLLLVFYALLWLVIYWIMIARS*
Ga0134084_1017547713300010322Grasslands SoilVNGNGENEEKFFAGGAIFFFVALLIFYALLWLVIYGLMIARS*
Ga0134086_1036808023300010323Grasslands SoilMNGSPDSEGKFFPSGSIVFFAALLIFYALLWLVIYGLMVSRA*
Ga0126370_1107418223300010358Tropical Forest SoilINLPDRRRDGCNSNVITPSEPEKKFFPSGAIFFFALLILFYAALWLVVYWIMIARA*
Ga0126378_1317279023300010361Tropical Forest SoilMNPAEPEREKSFFPSGAIFFFALLLVFYTALWLVIYWLMIARS*
Ga0105239_1269917523300010375Corn RhizosphereMQKTPGQSEGNFFPRGAIFFFVLLLVFYGALWLVIYWLMIARS*
Ga0134127_1204801023300010399Terrestrial SoilLTEFEPMEPGEPENGRRFFPSGAIFFFALLIVFYAALWLVIYWIMVARA*
Ga0137776_124383613300010937SedimentGAILNGTFRAMEPGETESTKRFFPSGAIFFFALLIVFYAALWLVVYLLMVARS*
Ga0138514_10011577823300011003SoilMTEPDETEKNFFPSGAIFFFALLLLSYAAIWFVIYWIMVARS*
Ga0137463_131299113300011444SoilMEPSEPENGKRFFPSGAIFFFGVLILFYAALWLVIYWIMIARA*
Ga0137364_1066457723300012198Vadose Zone SoilMDTGEPENGKRFVPSGAIFFFALLILFYAALWLVIYWIMIARA*
Ga0137374_1003152153300012204Vadose Zone SoilMEPSESENGRRFFPRGAIFFFALLIVFYAALWLVVYWLMIARA*
Ga0137374_1004966443300012204Vadose Zone SoilMEASEPENRKRFFPIGAIFFFALLILFYAALWLVVYWLMISRA*
Ga0137374_1022920433300012204Vadose Zone SoilMMEPGEPEGGKRFFPSGAIFFFALLILFYAALWLVIYWIMIARA*
Ga0137374_1113618723300012204Vadose Zone SoilMMEPGEPEGGKRFFPSGAIFFFALLILFYAALWLIIYWIMIARA*
Ga0137380_1040846923300012206Vadose Zone SoilMDPSEPGNEKKFFPSGAILFFALLLVFYAALWFVIYWIMIARS*
Ga0137380_1098199413300012206Vadose Zone SoilMPKVMEPNESKREKPFFPSGAIFFFALLLLFYAGLWLAIYWIMIARS*
Ga0137379_1042548723300012209Vadose Zone SoilMEPNESKREKPFFPSGAIFFFALLLLFYAGLWLAIYWIMIARS*
Ga0137378_1147809923300012210Vadose Zone SoilMPKVMEPNESKSEKPFFPSGAIFFFALLLLFYAGLWLVIYWIMIARS*
Ga0137372_1060078613300012350Vadose Zone SoilMMEQGEPENGKRFVPSGAIFFFALLILFYAALWLVIYWIMIARA*
Ga0137366_1010224423300012354Vadose Zone SoilMMEQGEPENGKRFVPSGAIFFFALLILFYAALWLVIYWLMIARA*
Ga0137366_1037112423300012354Vadose Zone SoilMEPNEPENGKRFFPSGAIFFFALLILFYAALWLVVYWIMIARA*
Ga0137371_1014800233300012356Vadose Zone SoilMMKPSEPENRKRFFPSDAIFFFSLLILFYAALWLVIYWIMIARA*
Ga0137368_1002705443300012358Vadose Zone SoilMEASEPENRKRFFPIGAIFFFALLILFYAVLWLVVYWLMIARA*
Ga0137368_1077957313300012358Vadose Zone SoilMEPSEPENAKGFFPSGAIFFFAVLILFYAALWLVVYWI
Ga0157305_1018858223300012891SoilMNEPDEREHKFFPSGAIFFFVLLLAFYALLWLVLYGLMIARS*
Ga0157310_1040441623300012916SoilEPENGRRFFPSGAIFFFALLIAFYAALWLVIYWVMVARA*
Ga0164300_1054475323300012951SoilMEEQDPASEKFFPSGAIAFFVVLLVFYAALWFVIYGVMVARS*
Ga0164302_1029856523300012961SoilMEEQDPAPEKFFPSGAIAFFVEHLVFYAALWFVIYGVMVARS*
Ga0126369_1185470613300012971Tropical Forest SoilNSMPQPTEPQETKTFFPAGAIFFFALLILFYAALWLVVYWIMVSRA*
Ga0126369_1332847813300012971Tropical Forest SoilMNPAEPEKEKSFFPGGGIFFFALLLVFYTGLWLVIYWLMIARS*
Ga0164309_1085360523300012984SoilMESNRPDEKFFPGGAIAVFVALLVFYAVLWLVIYGLMIARR*
Ga0157374_1056950423300013296Miscanthus RhizosphereMNEHSNDGKFFPSGAIFFFAALVAFYALLWLVIYWLMIARS*
Ga0157374_1183960323300013296Miscanthus RhizosphereVNAPDQQQGEKPFFPKGSIFFFALLLFSYALLWLLIYWIMIARS*
Ga0157374_1265746513300013296Miscanthus RhizosphereSTETRFVPKGAIFFFALLIVFYAALWLVIYWLMIARS*
Ga0157378_1194005713300013297Miscanthus RhizosphereMEYDKSKDKFFPSGAIFFFVLLLVFYSALWFVLYWIMIAR
Ga0157378_1295237723300013297Miscanthus RhizosphereVRESDATENKFFPSGAIFFFALLLLFYALLWLVIYGLMISRS*
Ga0157375_1200750723300013308Miscanthus RhizosphereMETNGTDEKFFPHGAIAFFIVLLVFYAFLWLVIYGLMVARS*
Ga0182000_1003957133300014487SoilMNGSPENQEKFFPSGAIFFFVMLLVFYGLLWLVIYGLMVARS*
Ga0157379_1161610623300014968Switchgrass RhizosphereIEFESMEPGEPENGKRFFPSGAIFFFALLIVFYAALWLVIYWIMVARA*
Ga0167636_100882923300015075Glacier Forefield SoilsMEPGETEPKFFPSGAIFFFVALLVFYAVLWLVIYGVMIARS*
Ga0167632_100001843300015085Glacier Forefield SoilVNGNNENEKPFFPGGAIAFFVVLLVFYALLWLLIYGLMIARS*
Ga0167634_101375723300015090Glacier Forefield SoilMESDGTPRFFPSGAIFFFVLLLLFYALLWLVIYGLMIARS*
Ga0167634_105332723300015090Glacier Forefield SoilVTEPGETERGFFPSGAIFFFALLLLFYAALWLVIYGLMIARS*
Ga0167638_100011983300015197Glacier Forefield SoilMESDETPKFFPSGAIFFFVLLLLFYALLWLVIYGLMIARS*
Ga0173478_1009592023300015201SoilVNEPPETEDKFFPSGAICFFVLLLAFYALLWLVLYGLMIARS*
Ga0132258_1001941293300015371Arabidopsis RhizosphereMDPSGPQKTFFPSGAIFFFALLILFYAALWLVIYWIMIARA*
Ga0132258_1023480123300015371Arabidopsis RhizosphereMPQPTEPGETKTFFPSGAIFFFALLVLFYAALWLVVYWIMVSRA*
Ga0132258_1081091023300015371Arabidopsis RhizosphereMDPGEPENGRRFFPSGAIFFFALLIVFYAALWLVLYWIMVARA*
Ga0132258_1297606713300015371Arabidopsis RhizosphereMQTNERQNDKSFFPSGAIFFFALLILFYAALWLVVYWIMVARA*
Ga0132256_10024174213300015372Arabidopsis RhizosphereMEPGGPQNGKRFFPSGAIFFFALLIAFYAALWLVVYWIMVAR
Ga0132256_10164998213300015372Arabidopsis RhizosphereMQTNERQNDKSFFPSGAIFFFALLILFYAALWLVVYW
Ga0132256_10361655323300015372Arabidopsis RhizosphereEPENGRRFFPSGAIFFFALLIVFYAALWLVLYWIMVARA*
Ga0132256_10373120313300015372Arabidopsis RhizosphereMEPGEPESGRHFFPTGAIFFFALLIVFYAVLWLVVYWIMVARA*
Ga0132257_10039225633300015373Arabidopsis RhizosphereQNGRRFFPSGAIFFFALLIVFYAALWLVLYWIMVARA*
Ga0132255_10185705123300015374Arabidopsis RhizosphereMTDENPENERRFFPSGAIFFFALLIAFYAALWLVVYWIMVARA*
Ga0132255_10377633023300015374Arabidopsis RhizosphereMNEPNDTVDGEKPFFPSGAIFFFVLLLVFYALLWLVIYGLMITRS*
Ga0132255_10424514223300015374Arabidopsis RhizosphereMNGSPENEEKFFPSGAIFFFVALLIFYALLGLVIYGLMVARA*
Ga0182036_1133979423300016270SoilVDVMAPSEPEKKFFPSGAIFFFALLILFYAALWLVVYWLMIARA
Ga0182041_1044894423300016294SoilMAPSEPEKKFFPRGAIFFFALLISFYAALWLVVYWLMIMRA
Ga0182033_1184336223300016319SoilGSENGKRFFPSGAVFFFALLIVFYAALWLVVYWIMVGRA
Ga0182035_1109868723300016341SoilMNPAEPEKEKSFFPSGAIFFFALLILFYAALWLVVYWLMIARA
Ga0182034_1160286023300016371SoilVDVMAPSEPEKKFFPSGAIFFFALLILFYAALWLVVYWIMIARA
Ga0182034_1191863113300016371SoilENGKRFFPSGAIFFFALLILFYAALWLVVYWLMIARR
Ga0182040_1108632523300016387SoilVDVMEPSEPEKKFFPSGAIFFFALLLVFYTALWLVIYWLMIARS
Ga0182037_1082839023300016404SoilVPDDCDSGGMTPSEPEKKFFPRGAIFFFALLIVFYAALWLVVYWLMVARA
Ga0182038_1217655123300016445SoilVDVMAPSEPEKKFFPRGAIFFFALLISFYAALWLVVYWLMIMRA
Ga0187824_1006559423300017927Freshwater SedimentMDPAENETDKAFFPSGAIFFFALLLVFYAALWLVIYWLMIARS
Ga0187825_1001351823300017930Freshwater SedimentMEPADQRNKFFPSGAIFFFALLLLFYAALWFVIYWIMIERS
Ga0187825_1014317023300017930Freshwater SedimentMDPGGPENGRRFFPSGAVFFFALLILFYAALWLVVYWIMIARA
Ga0187821_1011150423300017936Freshwater SedimentMNPNEGRFFPRGAVLFFALLLLFYAALWFVIYWIMIARA
Ga0187785_1002216733300017947Tropical PeatlandMSPDEPEKKFFPSGAIFFFALLLLFYAALWLVVYWIMIARS
Ga0187785_1023830523300017947Tropical PeatlandMPQPTEPEETKTFFPSGAIFFFALLILFYAALWLVVYWIMVSRA
Ga0187779_1005179823300017959Tropical PeatlandMNGGPENETKFVPRGAIFFFALLLVFYAALWGVIYWLMIARS
Ga0187779_1067847113300017959Tropical PeatlandMESGESEKGRRFFPSGAIFFFALLILFYAALWLVVYWIMIVRA
Ga0187776_1083956913300017966Tropical PeatlandDFEAMESADQRNKFFPSGAILFFALLLLFYAALWSVIYWIMIAPS
Ga0187788_1026664813300018032Tropical PeatlandGRRFFPSGAIFFFALLIAFYAALWLVVYWLMIARA
Ga0187766_1009850713300018058Tropical PeatlandQPTEPAETKTFFPSGAIFFFALLILFYAALWLVVYWIMVSRA
Ga0184611_101931333300018067Groundwater SedimentVNEPHETEDKFFPSGAICFFVLLLAFYALLWLVLSGLMIARS
Ga0184635_1009981123300018072Groundwater SedimentMEPGESENGRRFFPSGAIFFFALLIVFYAALWLVVYWIMVARA
Ga0184635_1014792323300018072Groundwater SedimentMEPGETEPKFFPGGAIAFFVVLLAFYAVLWLVIYGLMIARS
Ga0184624_1022219123300018073Groundwater SedimentMEPDPAPDKFFPSGAIAFFVVLLVFYAALWLVIYGVMIARS
Ga0190274_1112376623300018476SoilMNGPPETEEKFFPSGAIFFFVALTVFYAALWLVIYWLMIARS
Ga0173482_1039947513300019361SoilEQRFFPSGAIFFFVLLLLFYAALWFVIYWIMIARS
Ga0173479_1021317123300019362SoilVNEPHETEDKFFPSGAICFFVLLLAFYALLWLVLYGLMIARS
Ga0193744_104681323300019874SoilVTEPDETESGFFPSGAIFFFVLLLLFYALLWLVIYGLMIARS
Ga0193726_100552543300020021SoilVTEPDETERGFFPGGAIFFFVLLLLFYALLWLVIYGLMIARS
Ga0210406_10009877103300021168SoilMNPAEPETEKTFVPRGAIFFFALLLVFYAALWLVIYWLMIARS
Ga0193750_109340323300021413SoilLMEPGETEPKFFPSGAIFFFVLLLLFYALLWLVIYGLMIARS
Ga0182009_1005028623300021445SoilMEEPITSHPKNDEEFFPRGAIAFFVGLVIFYALLWLVIYGLMVARA
Ga0182009_1031382523300021445SoilETSFFPRGAIFFFVLLLIFYAVVWLVIYSLMIARS
Ga0182009_1084005413300021445SoilEKFYPRGAIAFFVGLVIFYALLWLVIYGLMVSRGWR
Ga0213880_1004024433300021953Exposed RockMNQSDPNQEKFFPSGAISFFVALVIFYALLWLVIYGLMIARS
Ga0213880_1020257713300021953Exposed RockMNNSDPNDEKFFPSGAISFFVALVIFYALLWLVIYGLMIARS
Ga0222622_1044793623300022756Groundwater SedimentMSSPSDPEEKFFPSGAIFFFGAMLVFFALLWLVIYWLMIARS
Ga0247688_104451223300024186SoilMEPGEPENGRRFFPSGAIFFFALLIVFYAALWLVVYWIMIVRA
Ga0207697_1011266423300025315Corn, Switchgrass And Miscanthus RhizosphereMEHNESQPKFFPSGAILFFVLLLIFYSALWFVLYWVMIARS
Ga0207697_1034176823300025315Corn, Switchgrass And Miscanthus RhizosphereMEHDKSQDKFFPSGAVFFFVLLLIFYSALWFVLYWLMIARS
Ga0208078_100073433300025544Arctic Peat SoilVNGPDETDEKFFPSGAIFFFIVLLVFYAALWLVIYGLMIARS
Ga0210142_100091143300025552Natural And Restored WetlandsLPRFSKDNFEPMNPEENESTKRFFPSGAIFFFTLLILFYAALWLVVYWIMVARA
Ga0209584_1009536123300025878Arctic Peat SoilMESDETPKFFPSGAIFFFVLLLLFYAVLWLVIYGLMIARS
Ga0207645_1011605023300025907Miscanthus RhizosphereMKDRESEQRFFPSGAIFFFVLLLLFYAALWFVIYWIMIARS
Ga0207645_1101219313300025907Miscanthus RhizosphereVIEPDAKENKFFPSGAIFFFVLLLLFYALLWLVIYGLMIARS
Ga0207684_1076006923300025910Corn, Switchgrass And Miscanthus RhizosphereMESGQPGNEKPFFPSGAIFFFTLLLVFYAALWLVIYWVMVARS
Ga0207693_1043920533300025915Corn, Switchgrass And Miscanthus RhizosphereMMDTGEPENGKRFFPSGAIFFFALLILFYAALWLVIYWIMIARA
Ga0207681_1017575223300025923Switchgrass RhizosphereMNEPNQNNEESRPFFPSGAIFFFALLLVFYALLWLVIYALMITRS
Ga0207659_1032822213300025926Miscanthus RhizosphereFESMEPGEPENGKRFFPSGAIFFFALLIVFYAALWLVIYWIMVARA
Ga0207701_1018376223300025930Corn, Switchgrass And Miscanthus RhizosphereMKEQEPASEKFFPSGAIAFFVVLLVFYAALWFVIYGVMVARS
Ga0207644_1057182823300025931Switchgrass RhizosphereVNHSPESEEKFFPSGAIFFFVALLVFYALLWLVIYGLMVARA
Ga0207686_1000563953300025934Miscanthus RhizosphereMSGPPETEQKFFPSGAIFFFAALIVFYALLWLVIYWVMIARS
Ga0207670_1081217723300025936Switchgrass RhizosphereMEEQEPASEKFFPSGAIAFFVVLLVFYAALWFVIYGVMVARS
Ga0207704_1044787023300025938Miscanthus RhizosphereMEDKKSERQFFPSGAIFFFVLLLLFYAALWFVLYWIMIARS
Ga0207704_1070853323300025938Miscanthus RhizosphereMNGPPESDEKFYPRGAIAFFVGLVIFYALLWLVIYGLMVARA
Ga0207704_1197864523300025938Miscanthus RhizosphereENGKRFFPSGAIFFFALLIVFYAALWLVIYWIMVARA
Ga0207691_1010771023300025940Miscanthus RhizosphereMKDRESEQRFFPSGAIFFFVLLLLFYAALWFVIYWIMIAQS
Ga0207691_1075527823300025940Miscanthus RhizosphereMNGSPESDEKFYPRGAIAFFVGLVIFYALLWLVIYGLMVARA
Ga0207711_1162088923300025941Switchgrass RhizosphereEPGEPENGRRFFPSGAIFFFALLIVFYAALWLVIYWIMVARA
Ga0207651_1061175213300025960Switchgrass RhizosphereMEHDKSQDKFFPSGAIFFFVLLLIFYSALWFVLYWLMIARS
Ga0207641_1127882923300026088Switchgrass RhizosphereMKDRESEQRFFPSGAIFFFVLLLLFYAALWFVIYRIMIARS
Ga0207683_1068647523300026121Miscanthus RhizosphereMESDETEPKFFPSGAIFFFVALLVFYAALWLVIYALMVGRS
Ga0209419_101890213300027537Forest SoilVPGEPEKKFFPSGAIFFFALLLLFYAALWLVIYWIMIARS
Ga0209464_1011952823300027778Wetland SedimentMKESETETNFFPSGAIFFFALLLLFYALLWLVIYGLMIARS
Ga0209580_1001536123300027842Surface SoilMEPAESEPDKGFFPSGAIFFFALLLLFYAALWLVIYWLMIARS
Ga0209048_1000871463300027902Freshwater Lake SedimentMVREPSETENGEKFFPRGAIFFFALLLLFYALLWLVIYSIMIARS
Ga0170824_10669945023300031231Forest SoilMMPGEPESEKRFFPTGAIFFFALLILFYAALWLVIYWIMIARA
Ga0170824_12605329523300031231Forest SoilMMDTGEPENGKRFVPSGAIFFFSLLILFYAALWLVIYWIMITRA
Ga0170820_1176162623300031446Forest SoilMDPSEPENARRFFPSGAIFFFALLIVFYAALWLVVYWIMVARA
Ga0170820_1217367123300031446Forest SoilMDTGEPENGNRFFPSGAIFFFALLILFYAALWLAIYWIMIARA
Ga0170820_1240108423300031446Forest SoilMDPGEPKNGRRFFPSGAIFFFALLIVFYAALWLVLYWIMVARA
Ga0170820_1695852823300031446Forest SoilMRQFFPSGALFFFALLLVFYAALWFVIYWLMIARS
Ga0170818_11501733023300031474Forest SoilMDPGEPENGRRFFPSGAIFFFALLIVFYAALWLVLYWIMVARA
Ga0310888_1040047023300031538SoilMEPSESENGRRFFPRGAIFFFALLILFYAALWLVVYWLMIARA
Ga0318541_1001752433300031545SoilVATSYVTLTPPTESKSDKAFFPRGAIFFFALLLVFYAALWLVIYWLMIARS
Ga0310915_1077789023300031573SoilMEPSERQNGKRFFPSGAMFFFALLIVFYAALWLVVYWLMIARA
Ga0310813_1187821723300031716SoilMNGEPESETKFFPRGAIFFFGLLLVFYAGLWLAIYWLMIARS
Ga0307469_1006052733300031720Hardwood Forest SoilMDPAKPGKQTFVPSGAIFFFALLVAFYAALWLVIYWLMIARS
Ga0307468_10043809823300031740Hardwood Forest SoilMDPAEPGKQTFVPSGAIFFFALLVAFYAALWLVIYWLMIARS
Ga0306918_1000740883300031744SoilLTPPTESKSDKAFFPRGAIFFFALLLVFYAALWLVIYWL
Ga0306918_1047451313300031744SoilFPGVNVATSHVTLTPPTESKSDKAFFPRGAIFFFALLLVFYAALWLVIYWLMIARS
Ga0318502_1085401113300031747SoilSYVTLTPPTESKSDKAFFPRGAIFFFALLLVFYAALWLVIYWLMIARS
Ga0306925_1181268523300031890SoilKEKSFYPSGAVFFFALLIVFYAALWLAIYWLMIARS
Ga0306923_1239776123300031910SoilMNPAEPEKEKPFVPSGAIFFFALLIAFYGALWLVIYWLMIARS
Ga0306921_1013704613300031912SoilSDARDSGVMEPSERQNGKRFFPSGAMFFFALLIVFYAALWLVVYWLMIARA
Ga0310916_1043772323300031942SoilMEPGGPENGKGFFPSGAIFFFALLIVFYAALWLVIYWIMVARA
Ga0310909_1140851223300031947SoilMEPGGPENGKPFFPSGAVFFFALLIAFYAALWLVVYWIMVARA
Ga0308176_1182218823300031996SoilPGEPENGKRFFPSGAIFFFALLIVFYAALWLVIYWIMVARA
Ga0306922_1054324023300032001SoilMNPAEPEKEKSFFPSGAVFFFALLIVFYAALWLAIYWLMIARS
Ga0306922_1110850623300032001SoilVDVMAPSEPEKKFFPRGAIFFFALLISFYAALWLVVYWLMIARA
Ga0306922_1141277523300032001SoilPAEPETKFVPRGAIFFFALLLVFYAALWGVIYWLMIARS
Ga0307470_100000061783300032174Hardwood Forest SoilMNNGDEPEEKFFPSGAISFFVVLLVFYALLWLVIYGVMIARS
Ga0307471_10121772123300032180Hardwood Forest SoilMEEPLPSASQPSESDQRFFPRGAIFFFGLLVVLYAAVWFIIYWLMIARA
Ga0307471_10158964413300032180Hardwood Forest SoilKPGKQTFVPSGAIFFFALLVAFYAALWLVIYWLMIARS
Ga0307472_10001295933300032205Hardwood Forest SoilMEQDPAPDKFFPSGAIAFFIALLVFYAALWLVIYGVMVARS
Ga0307472_10137255523300032205Hardwood Forest SoilVNGPETTNDKFFPSGAITFFVVLLVFYALLWLVIYGLMIARS
Ga0306920_10006757933300032261SoilMAPSEPEKKFFPRGAIFFFALLIVFYAALWLVVYWLMVARA
Ga0306920_10160833123300032261SoilLREPATEIGQNPVMNPAEPEKEKPFVPSGAIFFFALLIAFYGALWLVIYWLMIARS
Ga0335080_1119185823300032828SoilMSPNEPEKKFFPSGAIFFFALLLLFYAALWLVVYWIMIART
Ga0335076_1004505953300032955SoilMTPMSPNEPEKKFFPSGAIFFFALLLLFYAALWLVVYWIMIART
Ga0310810_1002704233300033412SoilMTQPGEPENGKRFFPSGAIFFFAVLILFYAALWLVVYWIMIARA
Ga0310810_1043569023300033412SoilMAPGEPEKKFFPSGAIFFFALLILFYAALWLVIYWIMIARA
Ga0310811_1092515323300033475SoilMEPGEPENGRRFFPSGAIFFFALLIAFYAALWLVIYWIMVARA
Ga0314864_0113164_48_1793300033805PeatlandMEPGEPENGRRFFPRGAIFFFALLILFYTALWLVVYWIMIVRA
Ga0370479_0060309_784_8973300034123Untreated Peat SoilMDEKPFFPSGAILFFALLLVLYGAIWFAVYWVMVSRS
Ga0370484_0000753_360_4823300034125Untreated Peat SoilMESDETPKFFPSGAIFFFVLLLLFYALLWLVIYGLMIARS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.