Metagenome Family F013902

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F013902
Family Type	Metagenome
Number of Sequences	267
Average Sequence Length	41 residues
Representative Sequence	TFSNLPDGSTITVGSNTFQANYEGGDGNDLTLTVVP
Number of Associated Samples	180
Number of Associated Scaffolds	267

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	3.83 %
% of genes near scaffold ends (potentially truncated)	92.13 %
% of genes from short scaffolds (< 2000 bps)	91.76 %
Associated GOLD sequencing projects	160
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (94.757 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.858 % of family members)
Environment Ontology (ENVO)	Unclassified (51.685 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (67.041 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 29.69% Coil/Unstructured: 70.31%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.59
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 267 Family Scaffolds
PF12951	PATR	4.49
PF09900	DUF2127	2.25
PF13884	Peptidase_S74	2.25
PF13418	Kelch_4	1.87
PF13545	HTH_Crp_2	1.12
PF00106	adh_short	0.75
PF01112	Asparaginase_2	0.75
PF12680	SnoaL_2	0.75
PF08818	DUF1801	0.75
PF13415	Kelch_3	0.75
PF13517	FG-GAP_3	0.75
PF13964	Kelch_6	0.75
PF03808	Glyco_tran_WecG	0.75
PF12697	Abhydrolase_6	0.75
PF00501	AMP-binding	0.37
PF00196	GerE	0.37
PF01436	NHL	0.37
PF13561	adh_short_C2	0.37
PF02852	Pyr_redox_dim	0.37
PF01869	BcrAD_BadFG	0.37
PF03710	GlnE	0.37
PF00127	Copper-bind	0.37
PF16250	DUF4907	0.37
PF02754	CCG	0.37
PF12127	FloA	0.37
PF09721	Exosortase_EpsH	0.37
PF03104	DNA_pol_B_exo1	0.37
PF07992	Pyr_redox_2	0.37
PF02646	RmuC	0.37
PF13302	Acetyltransf_3	0.37
PF15780	ASH	0.37
PF02954	HTH_8	0.37
PF00211	Guanylate_cyc	0.37
PF08308	PEGA	0.37
PF12146	Hydrolase_4	0.37
PF01471	PG_binding_1	0.37
PF08031	BBE	0.37
PF03446	NAD_binding_2	0.37
PF03372	Exo_endo_phos	0.37
PF10825	DUF2752	0.37
PF07332	Phage_holin_3_6	0.37
PF13810	DUF4185	0.37
PF02223	Thymidylate_kin	0.37
PF00076	RRM_1	0.37
PF00285	Citrate_synt	0.37
PF01012	ETF	0.37
PF04679	DNA_ligase_A_C	0.37
PF01255	Prenyltransf	0.37
PF01176	eIF-1a	0.37
PF00413	Peptidase_M10	0.37
PF01344	Kelch_1	0.37
PF02687	FtsX	0.37
PF00487	FA_desaturase	0.37
PF14026	DUF4242	0.37
PF03647	Tmemb_14	0.37
PF00085	Thioredoxin	0.37
PF00466	Ribosomal_L10	0.37
PF01791	DeoC	0.37

COG ID	Name	Functional Category	% Frequency in 267 Family Scaffolds
COG1391	Glutamine synthetase adenylyltransferase	Posttranslational modification, protein turnover, chaperones [O]	0.75
COG1446	Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily	Amino acid transport and metabolism [E]	0.75
COG1922	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family	Cell wall/membrane/envelope biogenesis [M]	0.75
COG4430	Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family	Function unknown [S]	0.75
COG5646	Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)	Posttranslational modification, protein turnover, chaperones [O]	0.75
COG5649	Uncharacterized conserved protein, DUF1801 domain	Function unknown [S]	0.75
COG0020	Undecaprenyl pyrophosphate synthase	Lipid transport and metabolism [I]	0.37
COG0125	Thymidylate kinase	Nucleotide transport and metabolism [F]	0.37
COG0244	Ribosomal protein L10	Translation, ribosomal structure and biogenesis [J]	0.37
COG0247	Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF	Energy production and conversion [C]	0.37
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.37
COG0361	Translation initiation factor IF-1	Translation, ribosomal structure and biogenesis [J]	0.37
COG0372	Citrate synthase	Energy production and conversion [C]	0.37
COG0417	DNA polymerase B elongation subunit	Replication, recombination and repair [L]	0.37
COG1322	DNA anti-recombination protein (rearrangement mutator) RmuC	Replication, recombination and repair [L]	0.37
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	0.37
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.37
COG2025	Electron transfer flavoprotein, alpha subunit FixB	Energy production and conversion [C]	0.37
COG2048	Heterodisulfide reductase, subunit B	Energy production and conversion [C]	0.37
COG2086	Electron transfer flavoprotein, alpha and beta subunits	Energy production and conversion [C]	0.37
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.37
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	0.37
COG5548	Uncharacterized membrane protein, UPF0136 family	Function unknown [S]	0.37
COG5549	Predicted Zn-dependent protease	Posttranslational modification, protein turnover, chaperones [O]	0.37

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	94.76 %
Unclassified	root	N/A	5.24 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	94.76 %
Unclassified	root	N/A	5.24 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	94.76 %
Unclassified	root	N/A	5.24 %

Name	Rank	Taxonomy	Distribution
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	29.59 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	6.37 %
Unclassified	root	N/A	5.24 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.50 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.75 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.75 %

Name	Rank	Taxonomy	Distribution
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	25.47 %
Unclassified	root	N/A	5.24 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	3.37 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.25 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.37 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.37 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.37 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.75 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.75 %

Name	Rank	Taxonomy	Distribution
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	11.61 %
Spartobacteria	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria	6.74 %
Unclassified	root	N/A	5.24 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	2.62 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.50 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.37 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.37 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.37 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.37 %
Ktedonobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.75 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.75 %

Name	Rank	Taxonomy	Distribution
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	11.61 %
Chthoniobacterales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales	6.74 %
Unclassified	root	N/A	5.24 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	1.12 %
Isosphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales	0.37 %
Gemmatales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales	0.37 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.37 %
Kaistiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae	0.37 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	0.37 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.37 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.37 %
Ktedonobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales	0.37 %
Burkholderiales genera incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis	0.37 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.75 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.75 %

Name	Rank	Taxonomy	Distribution
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	11.61 %
Unclassified	root	N/A	5.24 %
unclassified Chthoniobacterales	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales	5.99 %
Pirellulaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae	1.12 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	0.37 %
Gemmataceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae	0.37 %
Bauldia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia	0.37 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.37 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.37 %
Ktedonobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae	0.37 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	0.37 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.37 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.37 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.37 %
Chthoniobacteraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae	0.75 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.75 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.75 %

Name	Rank	Taxonomy	Distribution
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	11.61 %
Unclassified	root	N/A	5.24 %
Chthoniobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	5.99 %
Rhodopirellula	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula	1.12 %
unclassified Rhizobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter	0.37 %
Gemmata	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata	0.37 %
Bauldia litoralis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis	0.37 %
Singulisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera	0.37 %
Ktedonobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter	0.37 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.37 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.37 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.37 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.37 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.37 %
Candidatus Udaeobacter	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter	0.75 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.75 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.75 %

Name	Rank	Taxonomy	Distribution
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	11.61 %
Unclassified	root	N/A	5.24 %
Chthoniobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	5.99 %
Rhizobacter sp. OV335	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. OV335	0.37 %
Ktedonobacter robiniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter robiniae	0.37 %
unclassified Candidatus Udaeobacter	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter	0.37 %
unclassified Rhodopirellula	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula	0.37 %
Gemmata obscuriglobus	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata obscuriglobus	0.37 %
Candidatus Udaeobacter copiosus	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus	0.37 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	0.37 %
Bauldia litoralis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis	0.37 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.37 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.37 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.37 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.37 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.37 %
Rhodopirellula sallentina	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula sallentina	0.75 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.75 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.75 %

Name	Rank	Taxonomy	Distribution
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	11.61 %
Unclassified	root	N/A	5.24 %
Chthoniobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	5.99 %
Candidatus Udaeobacter sp.	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	0.37 %
Rhodopirellula sp. SWK7	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. SWK7	0.37 %
Rhizobacter sp. OV335	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. OV335	0.37 %
Ktedonobacter robiniae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter robiniae	0.37 %
Gemmata obscuriglobus	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata obscuriglobus	0.37 %
Candidatus Udaeobacter copiosus	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus	0.37 %
Singulisphaera acidiphila	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	0.37 %
Bauldia litoralis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis	0.37 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.37 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.37 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.37 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.37 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.37 %
Rhodopirellula sallentina	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula sallentina	0.75 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.75 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.75 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459002\|F0B48LX02FYKB6	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
2170459019\|G14TP7Y01CNN4S	All Organisms → cellular organisms → Bacteria	663	Open in IMG/M
2189573001\|GZR05M101A4O2F	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	524	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c2269825	All Organisms → cellular organisms → Bacteria	1214	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101686538	All Organisms → cellular organisms → Bacteria	1310	Open in IMG/M
3300000953\|JGI11615J12901_11853821	All Organisms → cellular organisms → Bacteria	534	Open in IMG/M
3300000956\|JGI10216J12902_115498124	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300002077\|JGI24744J21845_10102403	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300004157\|Ga0062590_102482233	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	549	Open in IMG/M
3300004463\|Ga0063356_100637674	All Organisms → cellular organisms → Bacteria	1450	Open in IMG/M
3300004479\|Ga0062595_100468904	All Organisms → cellular organisms → Bacteria → Proteobacteria	932	Open in IMG/M
3300004479\|Ga0062595_102650700	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300004643\|Ga0062591_102333218	All Organisms → cellular organisms → Bacteria	559	Open in IMG/M
3300005093\|Ga0062594_100198380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1395	Open in IMG/M
3300005178\|Ga0066688_10118362	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1635	Open in IMG/M
3300005179\|Ga0066684_10724936	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.	664	Open in IMG/M
3300005180\|Ga0066685_10188632	All Organisms → cellular organisms → Bacteria	1412	Open in IMG/M
3300005186\|Ga0066676_10768001	All Organisms → cellular organisms → Bacteria	655	Open in IMG/M
3300005187\|Ga0066675_11271825	All Organisms → cellular organisms → Bacteria → Proteobacteria	544	Open in IMG/M
3300005290\|Ga0065712_10317505	All Organisms → cellular organisms → Bacteria	834	Open in IMG/M
3300005293\|Ga0065715_11058090	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300005329\|Ga0070683_101974706	All Organisms → cellular organisms → Bacteria	561	Open in IMG/M
3300005330\|Ga0070690_100146691	All Organisms → cellular organisms → Bacteria	1606	Open in IMG/M
3300005331\|Ga0070670_101995376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	534	Open in IMG/M
3300005332\|Ga0066388_106220622	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. SWK7	602	Open in IMG/M
3300005332\|Ga0066388_107908676	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila	532	Open in IMG/M
3300005343\|Ga0070687_101456627	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300005344\|Ga0070661_100840341	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300005345\|Ga0070692_10770323	All Organisms → cellular organisms → Bacteria	654	Open in IMG/M
3300005347\|Ga0070668_101168142	All Organisms → cellular organisms → Bacteria → Proteobacteria	696	Open in IMG/M
3300005347\|Ga0070668_101733522	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300005354\|Ga0070675_100036023	All Organisms → cellular organisms → Bacteria	4025	Open in IMG/M
3300005354\|Ga0070675_101398161	All Organisms → cellular organisms → Bacteria → Proteobacteria	645	Open in IMG/M
3300005355\|Ga0070671_101146189	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	683	Open in IMG/M
3300005355\|Ga0070671_101296187	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300005355\|Ga0070671_101818371	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300005356\|Ga0070674_101700938	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	570	Open in IMG/M
3300005365\|Ga0070688_100128265	All Organisms → cellular organisms → Bacteria	1708	Open in IMG/M
3300005367\|Ga0070667_100104718	All Organisms → cellular organisms → Bacteria	2448	Open in IMG/M
3300005367\|Ga0070667_100106936	All Organisms → cellular organisms → Bacteria	2422	Open in IMG/M
3300005367\|Ga0070667_100310023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1422	Open in IMG/M
3300005367\|Ga0070667_100337654	All Organisms → cellular organisms → Bacteria	1362	Open in IMG/M
3300005436\|Ga0070713_101647603	All Organisms → cellular organisms → Bacteria → Proteobacteria	623	Open in IMG/M
3300005450\|Ga0066682_10777724	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	580	Open in IMG/M
3300005451\|Ga0066681_10815011	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300005456\|Ga0070678_100101448	All Organisms → cellular organisms → Bacteria → Proteobacteria	2231	Open in IMG/M
3300005459\|Ga0068867_100178797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1685	Open in IMG/M
3300005459\|Ga0068867_101737646	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300005467\|Ga0070706_101403602	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300005518\|Ga0070699_100406343	All Organisms → cellular organisms → Bacteria	1232	Open in IMG/M
3300005536\|Ga0070697_101354608	All Organisms → cellular organisms → Bacteria	635	Open in IMG/M
3300005543\|Ga0070672_100333102	All Organisms → cellular organisms → Bacteria	1291	Open in IMG/M
3300005543\|Ga0070672_100611739	All Organisms → cellular organisms → Bacteria	950	Open in IMG/M
3300005543\|Ga0070672_101184898	All Organisms → cellular organisms → Bacteria	680	Open in IMG/M
3300005544\|Ga0070686_100941163	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula sallentina	705	Open in IMG/M
3300005545\|Ga0070695_100767415	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300005545\|Ga0070695_101213358	All Organisms → cellular organisms → Bacteria → Proteobacteria	621	Open in IMG/M
3300005548\|Ga0070665_100068991	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis	3543	Open in IMG/M
3300005548\|Ga0070665_101555490	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	669	Open in IMG/M
3300005552\|Ga0066701_10894253	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300005560\|Ga0066670_10872055	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300005566\|Ga0066693_10138589	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300005718\|Ga0068866_11029784	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300005764\|Ga0066903_103419517	All Organisms → cellular organisms → Bacteria	856	Open in IMG/M
3300005764\|Ga0066903_106366078	All Organisms → cellular organisms → Bacteria	616	Open in IMG/M
3300005841\|Ga0068863_101597961	All Organisms → cellular organisms → Bacteria	661	Open in IMG/M
3300005841\|Ga0068863_102380435	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	539	Open in IMG/M
3300005843\|Ga0068860_100244415	All Organisms → cellular organisms → Bacteria	1746	Open in IMG/M
3300005843\|Ga0068860_100359090	All Organisms → cellular organisms → Bacteria	1435	Open in IMG/M
3300005843\|Ga0068860_100853338	All Organisms → cellular organisms → Bacteria	925	Open in IMG/M
3300005843\|Ga0068860_101225352	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300005993\|Ga0080027_10146598	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300005993\|Ga0080027_10420295	All Organisms → cellular organisms → Bacteria → Proteobacteria	540	Open in IMG/M
3300006237\|Ga0097621_100097203	All Organisms → cellular organisms → Bacteria	2472	Open in IMG/M
3300006237\|Ga0097621_102211779	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300006755\|Ga0079222_12602492	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	509	Open in IMG/M
3300006794\|Ga0066658_10865589	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	516	Open in IMG/M
3300006796\|Ga0066665_10134516	All Organisms → cellular organisms → Bacteria	1859	Open in IMG/M
3300006797\|Ga0066659_11054298	All Organisms → cellular organisms → Bacteria	679	Open in IMG/M
3300006797\|Ga0066659_11734106	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300006804\|Ga0079221_10870467	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300006806\|Ga0079220_10265722	All Organisms → cellular organisms → Bacteria	1037	Open in IMG/M
3300006806\|Ga0079220_11360788	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300006846\|Ga0075430_101812838	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300006854\|Ga0075425_101056225	All Organisms → cellular organisms → Bacteria	926	Open in IMG/M
3300006854\|Ga0075425_102186642	All Organisms → cellular organisms → Bacteria	616	Open in IMG/M
3300006871\|Ga0075434_100344789	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1511	Open in IMG/M
3300006871\|Ga0075434_102308522	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300006881\|Ga0068865_100008111	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	6481	Open in IMG/M
3300006954\|Ga0079219_10536141	All Organisms → cellular organisms → Bacteria	833	Open in IMG/M
3300006954\|Ga0079219_11396395	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300007255\|Ga0099791_10244614	All Organisms → cellular organisms → Bacteria	850	Open in IMG/M
3300009038\|Ga0099829_10498910	All Organisms → cellular organisms → Bacteria	1010	Open in IMG/M
3300009038\|Ga0099829_10530518	All Organisms → cellular organisms → Bacteria	978	Open in IMG/M
3300009088\|Ga0099830_10323603	All Organisms → cellular organisms → Bacteria	1235	Open in IMG/M
3300009089\|Ga0099828_10351373	All Organisms → cellular organisms → Bacteria	1328	Open in IMG/M
3300009089\|Ga0099828_10903837	All Organisms → cellular organisms → Bacteria	789	Open in IMG/M
3300009090\|Ga0099827_11970465	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	508	Open in IMG/M
3300009137\|Ga0066709_100284342	All Organisms → cellular organisms → Bacteria	2236	Open in IMG/M
3300009137\|Ga0066709_101338695	All Organisms → cellular organisms → Bacteria	1047	Open in IMG/M
3300009137\|Ga0066709_103757436	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	551	Open in IMG/M
3300009137\|Ga0066709_103804920	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300009174\|Ga0105241_12580828	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	510	Open in IMG/M
3300009177\|Ga0105248_11965284	All Organisms → cellular organisms → Bacteria	664	Open in IMG/M
3300009551\|Ga0105238_11639691	All Organisms → cellular organisms → Bacteria	674	Open in IMG/M
3300010038\|Ga0126315_11027981	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300010043\|Ga0126380_10694486	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	817	Open in IMG/M
3300010046\|Ga0126384_10317188	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	1287	Open in IMG/M
3300010047\|Ga0126382_11039564	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300010159\|Ga0099796_10248666	Not Available	738	Open in IMG/M
3300010303\|Ga0134082_10288362	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300010320\|Ga0134109_10412538	Not Available	542	Open in IMG/M
3300010326\|Ga0134065_10268341	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	643	Open in IMG/M
3300010366\|Ga0126379_12137998	All Organisms → cellular organisms → Bacteria	661	Open in IMG/M
3300010371\|Ga0134125_12495239	All Organisms → cellular organisms → Bacteria → Proteobacteria	562	Open in IMG/M
3300010373\|Ga0134128_10947930	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	952	Open in IMG/M
3300010373\|Ga0134128_12759042	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	541	Open in IMG/M
3300010375\|Ga0105239_12745622	Not Available	575	Open in IMG/M
3300010401\|Ga0134121_12727046	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300012189\|Ga0137388_10667358	All Organisms → cellular organisms → Bacteria	966	Open in IMG/M
3300012198\|Ga0137364_10449716	All Organisms → cellular organisms → Bacteria	966	Open in IMG/M
3300012199\|Ga0137383_10781150	All Organisms → cellular organisms → Bacteria	697	Open in IMG/M
3300012201\|Ga0137365_10032233	All Organisms → cellular organisms → Bacteria	4021	Open in IMG/M
3300012202\|Ga0137363_11288550	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	619	Open in IMG/M
3300012206\|Ga0137380_10816595	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	804	Open in IMG/M
3300012211\|Ga0137377_10582667	All Organisms → cellular organisms → Bacteria	1056	Open in IMG/M
3300012285\|Ga0137370_10735298	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	613	Open in IMG/M
3300012285\|Ga0137370_10982541	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	520	Open in IMG/M
3300012350\|Ga0137372_10567073	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	836	Open in IMG/M
3300012354\|Ga0137366_10378944	Not Available	1032	Open in IMG/M
3300012356\|Ga0137371_10401560	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1063	Open in IMG/M
3300012357\|Ga0137384_11465139	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter robiniae	531	Open in IMG/M
3300012363\|Ga0137390_10892304	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	844	Open in IMG/M
3300012683\|Ga0137398_10057741	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	2324	Open in IMG/M
3300012683\|Ga0137398_10158369	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1473	Open in IMG/M
3300012683\|Ga0137398_10264579	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1149	Open in IMG/M
3300012683\|Ga0137398_10339434	Not Available	1015	Open in IMG/M
3300012893\|Ga0157284_10277871	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300012917\|Ga0137395_11054019	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	579	Open in IMG/M
3300012925\|Ga0137419_11012078	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300012927\|Ga0137416_11805655	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	559	Open in IMG/M
3300012929\|Ga0137404_10238162	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1557	Open in IMG/M
3300012930\|Ga0137407_11270320	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	699	Open in IMG/M
3300012930\|Ga0137407_12217431	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300012958\|Ga0164299_10788861	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300012960\|Ga0164301_11282549	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	593	Open in IMG/M
3300012984\|Ga0164309_10401209	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1023	Open in IMG/M
3300012985\|Ga0164308_10317204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. OV335	1245	Open in IMG/M
3300012985\|Ga0164308_10558530	All Organisms → cellular organisms → Bacteria	967	Open in IMG/M
3300013296\|Ga0157374_10044650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4096	Open in IMG/M
3300013296\|Ga0157374_10088926	All Organisms → cellular organisms → Bacteria	2942	Open in IMG/M
3300013296\|Ga0157374_10223220	All Organisms → cellular organisms → Bacteria	1849	Open in IMG/M
3300013296\|Ga0157374_10367179	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	1432	Open in IMG/M
3300013296\|Ga0157374_10706892	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	1021	Open in IMG/M
3300013296\|Ga0157374_10769964	All Organisms → cellular organisms → Bacteria	978	Open in IMG/M
3300013296\|Ga0157374_11637612	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata obscuriglobus	668	Open in IMG/M
3300013297\|Ga0157378_10116662	All Organisms → cellular organisms → Bacteria	2455	Open in IMG/M
3300013297\|Ga0157378_10178005	All Organisms → cellular organisms → Bacteria	1999	Open in IMG/M
3300013297\|Ga0157378_10283679	All Organisms → cellular organisms → Bacteria	1597	Open in IMG/M
3300013297\|Ga0157378_10299869	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	1555	Open in IMG/M
3300013306\|Ga0163162_10771824	All Organisms → cellular organisms → Bacteria	1080	Open in IMG/M
3300013306\|Ga0163162_12067536	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	653	Open in IMG/M
3300013308\|Ga0157375_10452976	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1449	Open in IMG/M
3300013308\|Ga0157375_10759194	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	1121	Open in IMG/M
3300013308\|Ga0157375_11598373	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	771	Open in IMG/M
3300013308\|Ga0157375_12936373	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300014166\|Ga0134079_10626261	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	539	Open in IMG/M
3300014325\|Ga0163163_10542816	All Organisms → cellular organisms → Bacteria	1225	Open in IMG/M
3300014325\|Ga0163163_12299688	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300014325\|Ga0163163_12340622	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300014326\|Ga0157380_10940422	All Organisms → cellular organisms → Bacteria	893	Open in IMG/M
3300014969\|Ga0157376_10261282	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	1622	Open in IMG/M
3300014969\|Ga0157376_10321176	All Organisms → cellular organisms → Bacteria	1472	Open in IMG/M
3300014969\|Ga0157376_10639394	All Organisms → cellular organisms → Bacteria	1063	Open in IMG/M
3300014969\|Ga0157376_12097812	All Organisms → cellular organisms → Bacteria	604	Open in IMG/M
3300014969\|Ga0157376_12296757	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	579	Open in IMG/M
3300015053\|Ga0137405_1132975	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1540	Open in IMG/M
3300015241\|Ga0137418_10543122	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	922	Open in IMG/M
3300015264\|Ga0137403_10928372	All Organisms → cellular organisms → Bacteria	719	Open in IMG/M
3300015357\|Ga0134072_10041166	All Organisms → cellular organisms → Bacteria	1250	Open in IMG/M
3300015371\|Ga0132258_11114428	All Organisms → cellular organisms → Bacteria	1995	Open in IMG/M
3300015372\|Ga0132256_100893945	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus	1004	Open in IMG/M
3300015373\|Ga0132257_102096899	All Organisms → cellular organisms → Bacteria	730	Open in IMG/M
3300015373\|Ga0132257_102214310	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300015373\|Ga0132257_102284024	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300015373\|Ga0132257_103244255	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300015374\|Ga0132255_102064617	All Organisms → cellular organisms → Bacteria	868	Open in IMG/M
3300015374\|Ga0132255_103604939	All Organisms → cellular organisms → Bacteria	658	Open in IMG/M
3300015374\|Ga0132255_104679177	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300016357\|Ga0182032_10356821	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	1171	Open in IMG/M
3300017959\|Ga0187779_11243343	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300018071\|Ga0184618_10291315	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	694	Open in IMG/M
3300018431\|Ga0066655_10493469	All Organisms → cellular organisms → Bacteria	811	Open in IMG/M
3300018433\|Ga0066667_10139034	All Organisms → cellular organisms → Bacteria	1693	Open in IMG/M
3300018433\|Ga0066667_11079311	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	694	Open in IMG/M
3300018433\|Ga0066667_12002422	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300021475\|Ga0210392_10992377	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300025315\|Ga0207697_10054608	All Organisms → cellular organisms → Bacteria	1655	Open in IMG/M
3300025899\|Ga0207642_10777019	All Organisms → cellular organisms → Bacteria	608	Open in IMG/M
3300025899\|Ga0207642_10996321	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300025903\|Ga0207680_10889325	All Organisms → cellular organisms → Bacteria	638	Open in IMG/M
3300025907\|Ga0207645_10324675	All Organisms → cellular organisms → Bacteria	1027	Open in IMG/M
3300025920\|Ga0207649_11374078	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	559	Open in IMG/M
3300025922\|Ga0207646_11515476	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	580	Open in IMG/M
3300025923\|Ga0207681_11559193	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	553	Open in IMG/M
3300025925\|Ga0207650_10298635	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	1315	Open in IMG/M
3300025925\|Ga0207650_11073365	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	685	Open in IMG/M
3300025926\|Ga0207659_10449550	All Organisms → cellular organisms → Bacteria	1085	Open in IMG/M
3300025926\|Ga0207659_10573972	Not Available	960	Open in IMG/M
3300025926\|Ga0207659_10683595	All Organisms → cellular organisms → Bacteria	878	Open in IMG/M
3300025926\|Ga0207659_11579669	Not Available	560	Open in IMG/M
3300025927\|Ga0207687_10933131	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	743	Open in IMG/M
3300025928\|Ga0207700_11809654	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300025930\|Ga0207701_10362555	All Organisms → cellular organisms → Bacteria	1252	Open in IMG/M
3300025930\|Ga0207701_10684497	All Organisms → cellular organisms → Bacteria	869	Open in IMG/M
3300025930\|Ga0207701_10688982	All Organisms → cellular organisms → Bacteria	866	Open in IMG/M
3300025930\|Ga0207701_11672003	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	510	Open in IMG/M
3300025931\|Ga0207644_10551686	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	954	Open in IMG/M
3300025936\|Ga0207670_10202952	All Organisms → cellular organisms → Bacteria	1507	Open in IMG/M
3300025936\|Ga0207670_11101939	All Organisms → cellular organisms → Bacteria → PVC group	670	Open in IMG/M
3300025936\|Ga0207670_11340177	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	607	Open in IMG/M
3300025937\|Ga0207669_10209222	All Organisms → cellular organisms → Bacteria	1422	Open in IMG/M
3300025940\|Ga0207691_10022078	All Organisms → cellular organisms → Bacteria	6004	Open in IMG/M
3300025942\|Ga0207689_11641782	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	534	Open in IMG/M
3300025944\|Ga0207661_10925612	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	803	Open in IMG/M
3300025960\|Ga0207651_10283655	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1370	Open in IMG/M
3300025960\|Ga0207651_10400716	All Organisms → cellular organisms → Bacteria	1167	Open in IMG/M
3300025986\|Ga0207658_10018706	All Organisms → cellular organisms → Bacteria	4789	Open in IMG/M
3300025986\|Ga0207658_10287361	All Organisms → cellular organisms → Bacteria	1412	Open in IMG/M
3300025986\|Ga0207658_10317076	All Organisms → cellular organisms → Bacteria	1348	Open in IMG/M
3300025986\|Ga0207658_10966890	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	776	Open in IMG/M
3300026023\|Ga0207677_11262525	All Organisms → cellular organisms → Bacteria	677	Open in IMG/M
3300026067\|Ga0207678_10657886	All Organisms → cellular organisms → Bacteria	921	Open in IMG/M
3300026089\|Ga0207648_10221896	All Organisms → cellular organisms → Bacteria	1680	Open in IMG/M
3300026089\|Ga0207648_10226346	All Organisms → cellular organisms → Bacteria	1663	Open in IMG/M
3300026089\|Ga0207648_10433744	All Organisms → cellular organisms → Bacteria	1195	Open in IMG/M
3300026089\|Ga0207648_10971356	All Organisms → cellular organisms → Bacteria	795	Open in IMG/M
3300026095\|Ga0207676_10637901	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	1027	Open in IMG/M
3300026121\|Ga0207683_10873130	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	835	Open in IMG/M
3300026142\|Ga0207698_12509233	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300026221\|Ga0209848_1065083	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	650	Open in IMG/M
3300026281\|Ga0209863_10164967	All Organisms → cellular organisms → Bacteria → Acidobacteria	646	Open in IMG/M
3300026316\|Ga0209155_1131718	Not Available	857	Open in IMG/M
3300026335\|Ga0209804_1113889	All Organisms → cellular organisms → Bacteria → PVC group	1232	Open in IMG/M
3300026342\|Ga0209057_1025875	All Organisms → cellular organisms → Bacteria	3191	Open in IMG/M
3300026537\|Ga0209157_1287133	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	610	Open in IMG/M
3300026550\|Ga0209474_10738886	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300027364\|Ga0209967_1064488	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300027431\|Ga0207437_101453	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	639	Open in IMG/M
3300027846\|Ga0209180_10169743	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1258	Open in IMG/M
3300028379\|Ga0268266_10719704	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	962	Open in IMG/M
3300028381\|Ga0268264_11730882	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	635	Open in IMG/M
3300028885\|Ga0307304_10578193	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300031057\|Ga0170834_103846104	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	562	Open in IMG/M
3300031231\|Ga0170824_100777468	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula sallentina	507	Open in IMG/M
3300031473\|Ga0272434_1312187	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	658	Open in IMG/M
3300031562\|Ga0310886_10380105	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	828	Open in IMG/M
3300031938\|Ga0308175_100396289	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1441	Open in IMG/M
3300031947\|Ga0310909_10691055	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	848	Open in IMG/M
3300031996\|Ga0308176_10750975	All Organisms → cellular organisms → Bacteria	1016	Open in IMG/M
3300032076\|Ga0306924_10546223	All Organisms → cellular organisms → Bacteria	1316	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	54.68%
Host-Associated	Host-Associated	44.94%
Engineered	Engineered	0.37%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	54.31%
Plants	Host-Associated → Plants	44.94%
Aquatic	Environmental → Aquatic	0.37%
Solid Waste	Engineered → Solid Waste	0.37%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	53.93%
Rhizosphere	Host-Associated → Plants → Rhizosphere	28.09%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.98%
Roots	Host-Associated → Plants → Roots	1.87%
Sediment	Environmental → Aquatic → Sediment	0.37%
Rock-Dwelling (Endoliths)	Environmental → Terrestrial → Rock-Dwelling (Endoliths)	0.37%
Grass	Engineered → Solid Waste → Grass	0.37%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	43.45%
Soil	Host-Associated → Plants → Rhizosphere → Soil	16.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.61%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.49%
Loam	Environmental → Terrestrial → Soil → Loam	8.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.75%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.87%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.87%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.75%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.37%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified	0.37%
Composting	Engineered → Solid Waste → Grass → Composting	0.37%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.10%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	16.48%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	13.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.49%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.74%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.75%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.25%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.87%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.50%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.50%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.12%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.75%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.37%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.37%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.37%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified	0.37%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.37%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	9.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	7.49%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	5.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.87%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.37%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.00%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.62%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.62%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.25%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.87%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.87%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.50%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	1.50%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.12%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	1.12%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	1.12%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.12%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.12%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.75%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.75%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.75%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.75%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.75%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.75%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.37%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.37%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.37%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.37%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.37%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.37%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.37%
Rock	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock	0.37%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.37%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.37%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.37%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459002	Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm	Environmental	Open in IMG/M
2170459019	Litter degradation MG4	Engineered	Open in IMG/M
2189573001	Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)	Environmental	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Host-Associated	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005993	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015053	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015357	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026221	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes)	Environmental	Open in IMG/M
3300026281	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)	Environmental	Open in IMG/M
3300026316	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)	Environmental	Open in IMG/M
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental	Open in IMG/M
3300026342	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)	Environmental	Open in IMG/M
3300026537	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)	Host-Associated	Open in IMG/M
3300027431	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A1a-11 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031473	Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nord	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E1_08527890	2170459002	Grass Soil	SDSPIVGNFANLADGSTITIGSNTFQANYEGGDGNDLTLTVISN
4MG_02778470	2170459019	Switchgrass, Maize And Mischanthus Litter	VIISNTSVNPIVGTFDNLSDGAIITVNGNNLQASYEGRDGNDLTLTVVP
FD2_00871250	2189573001	Grass Soil	IAGTFANLADRSIFTASSNTYQVNYKCSDRNDLTLTVVS
ICChiseqgaiiDRAFT_22698252	3300000033	Soil	MAGTFSNLPDXGTFTSNDNTYQVSYERGDGNNLTLIVLP*
INPhiseqgaiiFebDRAFT_1016865382	3300000364	Soil	ANLPDGSTFTSGRNTYQVNYQGGDGNDLTLTVVP*
JGI11615J12901_118538211	3300000953	Soil	SNLPDGSTITLAGNTFQVNYEGGDGNDLTLTVIP*
JGI10216J12902_1154981241	3300000956	Soil	ATFSNLPDGSTFTVNGNTYQANYEGRDGNDLTLMVVP*
JGI24744J21845_101024031	3300002077	Corn, Switchgrass And Miscanthus Rhizosphere	FANLPDGGTVTIGLNDFQANYEGGDGNDLTLAVVP*
Ga0062590_1024822332	3300004157	Soil	PIAGTFINLSDGSTLSVGSNTFRANYRGGDGNDLTLTVVP*
Ga0063356_1006376743	3300004463	Arabidopsis Thaliana Rhizosphere	NTAATPIGGRFSNLPDGTIIVVGSNTFQADCEGGDGNDLTLTVVP*
Ga0062595_1004689042	3300004479	Soil	SMATSGTFNNLAEGAIVTVNGNNLQATYKGGSGNNDLLLTVVP*
Ga0062595_1026507002	3300004479	Soil	PIAGTFANLADGATFTIGSNTFQANYEGGDGNDLTLTVVQ*
Ga0062591_1023332182	3300004643	Soil	TSGTFANLPAAGTVTVGSNSFQANYEGGDGNDLTLTVVGN*
Ga0062594_1001983801	3300005093	Soil	TVQIGGRFGNLADGATIQIGNNTFQANYEGGDGNDLTLTVVP*
Ga0066688_101183624	3300005178	Soil	NPISGTFSNLPDGGIVTINGNNLQANCEGGDGNDLTLTVVP*
Ga0066684_107249362	3300005179	Soil	SNSLISGTFLNLRDGQTFTKFGNTYAVSYEGGDGNDLTLIVQ*
Ga0066685_101886321	3300005180	Soil	ANRIAGTFANLADRSTFTAGSNTFQANYKGGDHNDLTLTVVP*
Ga0066676_107680011	3300005186	Soil	TSGAFSNLPEGGTITIGINTFQADYGGGDGNDLTLTVIP*
Ga0066675_112718251	3300005187	Soil	IAGTFANLADGSTFTFGSNTFQASYEGGDGNDLTLTVVP*
Ga0065712_103175052	3300005290	Miscanthus Rhizosphere	IAGTFANLPDGSTVVFGSNSYLVSYEGGDGNDLTLTVVP*
Ga0065715_110580901	3300005293	Miscanthus Rhizosphere	TNNGLGAIAGRFTNLADGGTITIGSNTFQANYEGGDGNDLTLTVVQ*
Ga0070683_1019747061	3300005329	Corn Rhizosphere	TAILGTFANLPDGGTITVGSNTFQANYEGGDGNDLTLTVIP*
Ga0070690_1001466913	3300005330	Switchgrass Rhizosphere	ISGIFRNLPDGGTITIGGNTYQANYEGGDGNDLTLTVVS*
Ga0070670_1019953761	3300005331	Switchgrass Rhizosphere	VFDNRAATPIAGTFSNIADGGTVTVGSNTFQANYEGGDGNDLTLTVVSN*
Ga0066388_1062206221	3300005332	Tropical Forest Soil	VLTLISNTSSDPITGNFADLPDDSIVTINGNNFQASYSGGDGNDLTLSVVP*
Ga0066388_1079086761	3300005332	Tropical Forest Soil	FTVIANTSSKPVSGVFANLPDGGTIVVGVNTFQANYEGGDGNDLTLTVVP*
Ga0070687_1014566271	3300005343	Switchgrass Rhizosphere	VGTVLTVISMPSANPIRGAFGNLPDGAIVTVNGNNLQAIYSGGDGNDLTLTVVA*
Ga0070661_1008403412	3300005344	Corn Rhizosphere	NTAVAPIVGTFHNLANGKIIAVNGNSLQASYSGGDGNDLTLTVVP*
Ga0070692_107703231	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	TVINNTAATPISGVFNNLADGATVTVRSNIFKSNYEGGDGNDLTLTVVQ*
Ga0070668_1011681422	3300005347	Switchgrass Rhizosphere	NTSRSPINGTFDNLTDGGTITIGNNTFQANYEGGDGNDLTLTVIGN*
Ga0070668_1017335222	3300005347	Switchgrass Rhizosphere	VLTVINNTAATPIAGTFANLSDGSKLVIGNNSYQADYEGNDGNDLTLTVVP*
Ga0070675_1000360231	3300005354	Miscanthus Rhizosphere	LACPGIHNLANGKIIAVNGNNLQASYKGGDGNDLTLTVVP*
Ga0070675_1013981612	3300005354	Miscanthus Rhizosphere	LVIANTSATPISGAFSNLPDGGILNVGGNNLQASYEGGDGDLTLT
Ga0070671_1011461891	3300005355	Switchgrass Rhizosphere	NTAETPIAGQFDNLMDGSTYTIGTNTFQANYEGGDGNDLTLTVVP*
Ga0070671_1012961871	3300005355	Switchgrass Rhizosphere	GTILTVIRNTSANPINGTFSKLANGAIVNVNGNNLQASCTGREGNDLTLTVVP*
Ga0070671_1018183711	3300005355	Switchgrass Rhizosphere	ISGSFANLVDGSTVTVGVNELQVSYSSGDGNDLTLTVVP*
Ga0070674_1013771552	3300005356	Miscanthus Rhizosphere	TGTVLTVLNNTAATPISGVFANLADGGILTVGSNTFQANYEGGDGNDLTLTVIP*
Ga0070674_1017009381	3300005356	Miscanthus Rhizosphere	TAATPIAGTFTNLADGSTLIVGSNTYKANYEGGSGNDLTLTVQ*
Ga0070688_1001282652	3300005365	Switchgrass Rhizosphere	ATPISGVFNNLPDGATVTVRSNIFKSNYKGGDGNDLTLTVVQ*
Ga0070667_1001047184	3300005367	Switchgrass Rhizosphere	AVAPIVGTFHNLANGKIIAVNGNSLQASYSGGDGNDLTLTVVP*
Ga0070667_1001069364	3300005367	Switchgrass Rhizosphere	ISDTASTPIAGTFANLADGITLAIGSNHLKVSYEGGDGNDLTFTVVP*
Ga0070667_1003100231	3300005367	Switchgrass Rhizosphere	ISGVFANLADGATVIVGSNIFQANYEGGDGNDLTLTVVP*
Ga0070667_1003376541	3300005367	Switchgrass Rhizosphere	AIAGTFGNLPDGSTLTVGSNTFKANYGGGDGNDLTLTVVP*
Ga0070713_1016476032	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	ANPIAGSFSNLQDGGIIKAGGNRLQASYEGGDGNDLTLTVVP*
Ga0066682_107777242	3300005450	Soil	TGSSPIVGTFMNLPDGGTITADNNTFQADYEGGDGNDLTLTAIN*
Ga0066681_108150112	3300005451	Soil	NKSGVPIAGTFANLADGSSFRVNGNTFQASYEGGDGNDLTLTVQ*
Ga0070678_1001014482	3300005456	Miscanthus Rhizosphere	VTPISGTFSNLSDGGTILVGNNNTLQANYEGGDGNDLTLTVVP*
Ga0068867_1001787972	3300005459	Miscanthus Rhizosphere	AGTFSNIADGGTVTVGSNTFQANYEGGDGNDLTLTVVSN*
Ga0068867_1017376462	3300005459	Miscanthus Rhizosphere	ATPISGTFGNLPDGATITAGRNTFQANYEGGDGNDFTLTVVP*
Ga0070706_1014036021	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	AATPISGTFAKLPDGSTVTVGSNTFQANYEGCDGNDLTLTVVP*
Ga0070699_1004063431	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	IAGTFANLADGATFTIDNITFQADYQGGDGNDLTLTVVP*
Ga0070697_1013546081	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	AIPIAGTFANLADGSTFTAGSNVFQANYEGGDGNDLTLTVVE*
Ga0070672_1003331022	3300005543	Miscanthus Rhizosphere	AGTFANLTDGATVVVGNNTFQANYEGGDGNDLTLTVQ*
Ga0070672_1006117392	3300005543	Miscanthus Rhizosphere	VINNTSGTPINGSFSNLSDGGTVTIGNTTFQANYEGGDGNDLTLTVVNN*
Ga0070672_1011848981	3300005543	Miscanthus Rhizosphere	SSQPIVGAFSNLPDGGTIAAGENTLLANYTGGDGNDLTLTVIP*
Ga0070686_1009411631	3300005544	Switchgrass Rhizosphere	GPISGTFDNLPDGGTIKIGNNTFQANYEGGDGNDLTLTVVP*
Ga0070695_1007674151	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	LETHHSSGSFTNLPDGGTITVGRNTFQANYEGGDGNDLTVTVVP*
Ga0070695_1012133583	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	TSSAPIVGAFSNLSDGSVFTSKGNNFQASYEGGDGNDLMLTVVP*
Ga0070665_1000689911	3300005548	Switchgrass Rhizosphere	PINGTFDNLTDGGTITIGNNTFQANYEGGDGNDLTLTVIGN*
Ga0070665_1015554902	3300005548	Switchgrass Rhizosphere	FSNLPDGSTITVGNNTFQANYEGGDGNDLTLTVVP*
Ga0066701_108942532	3300005552	Soil	HNLAEGAIVTVNGSNLQASYTGGDGNDLTLTVVP*
Ga0066670_108720552	3300005560	Soil	FANLPDNSTFTIGRNNYQASYEGCDGNDLTFTVVP*
Ga0066693_101385892	3300005566	Soil	NTSANPISGSFSNLPDGAIVTINGNNLQASYEGGDGNDLTTTVVP*
Ga0068866_110297842	3300005718	Miscanthus Rhizosphere	SPINGTFANLPDGGTVTIGLNDFQANYEGGDGNDLTLAVVP*
Ga0066903_1034195172	3300005764	Tropical Forest Soil	IAGTFANLADRSTFTAGSNTFQVNYKGGNGNDLTLTVVR*
Ga0066903_1063660781	3300005764	Tropical Forest Soil	GTFANLHDGSIITIFGNRLRASYEGGDGNDLTLTVVP*
Ga0068863_1015979612	3300005841	Switchgrass Rhizosphere	TVINNTAVAPIVGTFHNLANGKIIAVNGNSLQASYSGGDGNDLTLTVVP*
Ga0068863_1023804352	3300005841	Switchgrass Rhizosphere	TMFSNTAATPINGEFEEMPDGGTVTIGSNTFQANYEGGDGNDLTLTVVP*
Ga0068860_1002444152	3300005843	Switchgrass Rhizosphere	SNLADGAVVNVNGNNFQASYTGGDGNDLTLTVVP*
Ga0068860_1003590903	3300005843	Switchgrass Rhizosphere	ATPISGAFSNLPDGGILNVGGNNLQASYEGGDGNDLTLTVVP*
Ga0068860_1008533381	3300005843	Switchgrass Rhizosphere	IAGTFHNLRDGQVITVNRSNLQATYTGGDGNDLTLTVVP*
Ga0068860_1012253523	3300005843	Switchgrass Rhizosphere	ANLSDGSTFATDGNTFQASYSGGGGNDLTLTMVP*
Ga0080027_101465981	3300005993	Prmafrost Soil	PISGTFANLADGSIITAGPNTLQVSYEGGDGNDLTLTVVP*
Ga0080027_104202951	3300005993	Prmafrost Soil	SSTPISGTFTNLADGATLKSGNNKFQASYEGGDGNDLTLTVVP*
Ga0097621_1000972033	3300006237	Miscanthus Rhizosphere	SNLSDGGTILVGNNNTLQANYEGGDGNDLTLTVVP*
Ga0097621_1022117791	3300006237	Miscanthus Rhizosphere	PILGTFGNLADGSIVTVRNNKFQVNYEGGDGNDLVLVSVR*
Ga0079222_126024921	3300006755	Agricultural Soil	GVFANLFDGGTITAGSNTFRANYEGGDGNDLTLTVVQ*
Ga0066658_108655891	3300006794	Soil	GTFANLADGSTFTIGNNTFQASYEGGDGNDLTLTVVP*
Ga0066665_101345164	3300006796	Soil	GTFSNLPDGAIVTVGRNQLKVSYEGGDGNDLTLTVQ*
Ga0066659_110542982	3300006797	Soil	VIISNTSVNPIAGTFDNLSDGAIITVNGNNLQASYEGGDGNDLTLTVVP*
Ga0066659_117341061	3300006797	Soil	FANLPDDGTTTIGSNTFRANYEGGDGNDLTLTVVP*
Ga0079221_108704672	3300006804	Agricultural Soil	LENTAPSKIKGTFGNLPDGATVVIGVNKFVVRYEGGDGNDLTLTVVP*
Ga0079220_102657223	3300006806	Agricultural Soil	SNLSDGAILTANGNNFQASYQGGDGNDLTLTVVP*
Ga0079220_113607882	3300006806	Agricultural Soil	VFANLADGATITAGSNTYQAHYSGGDGNDLTLTVVQ*
Ga0075430_1018128381	3300006846	Populus Rhizosphere	TNLPDGGTITAGANTFQANYEGGDGNDLTLTVVP*
Ga0075425_1010562252	3300006854	Populus Rhizosphere	LLQRRGSFSNLPDGGIVTINGNNLQANYEGGDGNDLTLTVVP*
Ga0075425_1021866421	3300006854	Populus Rhizosphere	NPIASTFSNLLDDAILTVNGNNFQANYEGGDGNYLTLTVVP*
Ga0075434_1003447891	3300006871	Populus Rhizosphere	GDNPISSTFSNLPDGGTITIGSSSFHANYEGRDGNDLTLTVVP*
Ga0075434_1023085221	3300006871	Populus Rhizosphere	HNLSDGQMIVVNGSNLQASYTGGDNNDLTLTVVP*
Ga0068865_1000081119	3300006881	Miscanthus Rhizosphere	FSNLADGSTVTAGNNTFQADYEGGDGNDLTLTVMP*
Ga0079219_105361411	3300006954	Agricultural Soil	SISGTFVNLPDSGAITVGTNTYQANYEGGDGNDLTLTVIP*
Ga0079219_106365052	3300006954	Agricultural Soil	PEGTVFTVIDNQSPTPISGNFANLPDGGTITYSVTTFQASYEGGDGNDLTLTVL*
Ga0079219_113963951	3300006954	Agricultural Soil	SPFTSAFANLGEGAIVVAGRNKLQASYVGGDGNDLTLTVVR*
Ga0099791_102446141	3300007255	Vadose Zone Soil	NPISGTFANLPDGGIVTINGNNLQASYSGGDGNDLTLTVVP*
Ga0099829_104989102	3300009038	Vadose Zone Soil	LTVISDTAATPIAGTFTNLPDGAMFMQGRNTYQVSYEGGDGNDLTLTVLP*
Ga0099829_105305181	3300009038	Vadose Zone Soil	GTFANLADGSTFTIGSNTLQASYEGGDGNDLTLTVLP*
Ga0099830_103236031	3300009088	Vadose Zone Soil	FSNLPDGSTFTSNGNTYQVNYEGGNGNDLTLTVVP*
Ga0099828_103513733	3300009089	Vadose Zone Soil	TFSNLADGSTFTNNGNTYKVSYEGGNGNDLTLTVQ*
Ga0099828_109038372	3300009089	Vadose Zone Soil	DNTAATAIDGAFRNLPDGSTITRGGNTFQADYEGGDGNDLTLTVVQ*
Ga0099827_119704651	3300009090	Vadose Zone Soil	VTKNTATTPISGTFNNLPDGAIVNVNGNNLQASYTGLDGNDLT
Ga0066709_1002843421	3300009137	Grasslands Soil	FSNLPDGGIVTINGNNFQASYEGGDGNDLTLTVVP*
Ga0066709_1013386952	3300009137	Grasslands Soil	FSNLPDGAIVTVNGNNLQASYEGGDGNDLTLTVVP*
Ga0066709_1037574362	3300009137	Grasslands Soil	FSNLPDGSTFSSNGNTYQVSYEGGDGNDLTLTVVP*
Ga0066709_1038049202	3300009137	Grasslands Soil	GNRNAGLAGKLADRSTFTAGSNTVQANYRGGDGDDLILTVVP*
Ga0105241_125808282	3300009174	Corn Rhizosphere	AGTFANLAGGATVIVGNNTFQANYEGGDGNDLTLTVQ*
Ga0105248_119652841	3300009177	Switchgrass Rhizosphere	NISATPILGTFGNLADGSIVTVRNNKFQVNYEGGDGNDLVLVSVR*
Ga0105238_116396912	3300009551	Corn Rhizosphere	FSNIADGGTVTVGSNTFQANYEGGDGNDLTLTVVSN*
Ga0126315_110279811	3300010038	Serpentine Soil	MGTISGTSANLLDSATITAGSNAFQVNYEGGDGNDL
Ga0126380_106944861	3300010043	Tropical Forest Soil	TAATPIARTFANLADDSIVRILGAKLHASYEGGDGNDLTLTVVR*
Ga0126384_103171881	3300010046	Tropical Forest Soil	LLSGRFNNLPDGATVTVGSNTYQANYEGGDGNDLTLTVVP*
Ga0126382_110395641	3300010047	Tropical Forest Soil	SGTFANLPDGSTFVVGPNNYQVSYEGGDGNDLTLTVVP*
Ga0099796_102486661	3300010159	Vadose Zone Soil	KPISGTFSNLPDSGIVNVNGNNLGASYEGGDGNDLTLTVVP*
Ga0134082_102883621	3300010303	Grasslands Soil	SANPISGTFSNLPYGAIVTVGRNQLKVSCEGGDGKDLTLTVQ*
Ga0134109_104125381	3300010320	Grasslands Soil	DTSAKPISGTSSNLPDSGIVNVNGNNLGASYEGGDWNDLTLTEVP*
Ga0134065_102683412	3300010326	Grasslands Soil	FSNLPDGGIVTINGNNFQASYSGGDGNDLTLTVVP*
Ga0126379_121379982	3300010366	Tropical Forest Soil	ADPISGTFANLPDGGIVTINGNNLQASYSGGDGNDLTLTVVP*
Ga0134125_124952391	3300010371	Terrestrial Soil	TFHNLPEKKILTVNGSNLQASYTGGDGNDLTLTVVP*
Ga0134128_109479302	3300010373	Terrestrial Soil	ATAINGNFANLSDGSLITAGSNTFQANYEGGDWNDLTLTVVP*
Ga0134128_127590422	3300010373	Terrestrial Soil	NPIAGTFANLPDGAILTVGANIFQASYEGGDGNDLTLTVLP*
Ga0105239_127456222	3300010375	Corn Rhizosphere	FGNLPDGATITAGRNTFQANYEGGDGNDFTLTVVP*
Ga0134121_127270461	3300010401	Terrestrial Soil	ITGTFGDLADGAIITVRGVNFQANYEGGDGNDLTLTVVL*
Ga0137388_106673582	3300012189	Vadose Zone Soil	YCDEQYRGTPTAGTFSNLADGSTFTNNGNTYKVNYEGGTGNDLTLTVQ*
Ga0137364_104497161	3300012198	Vadose Zone Soil	IVGTFHNLGDGQIIAVNGSNLQASYTGGDGNDLTLTVIP*
Ga0137383_107811502	3300012199	Vadose Zone Soil	SGTFANLLDGAVVTVNGNNFQANYQGGDGNDLTLTVVP*
Ga0137365_100322331	3300012201	Vadose Zone Soil	TFTNLPDGSTFTVGRNSYQVSYEGGDGNDLTLTVVP*
Ga0137363_112885501	3300012202	Vadose Zone Soil	FSNLPDGGIVNVNGNNLQASYSGGDGNDLTLTVVP*
Ga0137380_108165951	3300012206	Vadose Zone Soil	MNLPDGGTITVGNNTFQADYEGGDGNDLTLTVVP*
Ga0137377_105826671	3300012211	Vadose Zone Soil	SGTFGNLPDGGIVTIDGNNLQASYSGGDGNDLTLTVVP*
Ga0137377_111059621	3300012211	Vadose Zone Soil	GTFHNLADGAIISINGNNLQADYQGGDGNDLTLTVVP*
Ga0137370_107352982	3300012285	Vadose Zone Soil	VRFCAGSIFTVNGHNFQASYEGGDGNDLTLTVLP*
Ga0137370_109825411	3300012285	Vadose Zone Soil	PISGTFANLADGSTIIAGPNTLQASYEGGDGNDLTLTVVP*
Ga0137372_105670732	3300012350	Vadose Zone Soil	FTNLPDGSTFTVGRNSYQVSYEGGDGNDLTLTVVP*
Ga0137366_103789441	3300012354	Vadose Zone Soil	STKPISGTFSNLPDSGIVNVNGNNLGASYEGGDGNDLTLTVVP*
Ga0137371_104015601	3300012356	Vadose Zone Soil	TFGNLPDGGIVTIDGNNLQASYSGGDGNDLTLTVVP*
Ga0137384_114651391	3300012357	Vadose Zone Soil	SNLPDGAIVTVGTNHLQANYAGGDGNDLTLTVVP*
Ga0137390_108923041	3300012363	Vadose Zone Soil	ASTIAGTFINLADGEIITTNGGKFQADYEGGDGNDLTLTVVP*
Ga0137398_100577414	3300012683	Vadose Zone Soil	RSWKKSGTFANLPDGSIITIHGKNLQASYEGGDGNDLTLTVVP*
Ga0137398_101583691	3300012683	Vadose Zone Soil	LTVISNTAATPIAGTFINLADGITLAIGSNHLKVSYEGGDGNDLTLTVVP*
Ga0137398_102645793	3300012683	Vadose Zone Soil	GTLANLPDNSTFTVGRNNYQANYEGGDGNDLTLTVVQ*
Ga0137398_103394341	3300012683	Vadose Zone Soil	ISGTFSNLPDGGIVTINGNNLQANCEGGDGNDLTLTVVP*
Ga0157284_102778712	3300012893	Soil	SFHNLPEGEILIVNGSKLQASYEGGDGNDLTLTVVP*
Ga0137395_110540191	3300012917	Vadose Zone Soil	TFSNLADGSTFTNGANTYLASYHGGNGNDLTLTVQ*
Ga0137419_110120782	3300012925	Vadose Zone Soil	NPIMGTFANLPDGEILTSGGITVQANYHGGTGNDLTLTVQ*
Ga0137416_118056552	3300012927	Vadose Zone Soil	ANLPDGSTFTTHGNSFLANYEGGDGNDLTLTVVP*
Ga0137404_102381621	3300012929	Vadose Zone Soil	TFSNLPDGEIVTINGNNFQASYSGGDGNDLTLTVVP*
Ga0137407_112703201	3300012930	Vadose Zone Soil	TFSNLPDGAIVNINGNNLQASYSGGDGNDLTLTVVP*
Ga0137407_122174311	3300012930	Vadose Zone Soil	TFSNPPDGVIVTINGNNFQASYEGGDGNDLTLTVVP*
Ga0164299_107888613	3300012958	Soil	APIAGAFSNLPNGSAFTSKGNNFQASYEGGDGNDLTLTVVP*
Ga0164301_112825492	3300012960	Soil	TFSNLVDGSTITIGNNTFQANYEGGDGNDLTLTVVP*
Ga0164309_104012091	3300012984	Soil	TPIAGTFTNLPDGSIITTKGNKFQASYEGGDGNDLTLTVVH*
Ga0164308_103172041	3300012985	Soil	SNLPNGSAFTSKGNNFQASYEGGDGNDLTLTVVP*
Ga0164308_105585302	3300012985	Soil	NNTSGTPINGSFSNLSDGGTVTIGNTTFQANYEGGDGNDLTLTVVNN*
Ga0157374_100446505	3300013296	Miscanthus Rhizosphere	SPINGTFDNLTDGGTITIGNNTFQANYEGGDGNDLTLMVLP*
Ga0157374_100889261	3300013296	Miscanthus Rhizosphere	ATPIAGTFANLTDGATVVVGNNTFQANYEDGDGNDLTLTVVP*
Ga0157374_102232201	3300013296	Miscanthus Rhizosphere	GTFANLADGATVIVGNNTFQANYEGGDGNDLTLTVVSL*
Ga0157374_103671791	3300013296	Miscanthus Rhizosphere	TFSNLPDGSTITVGSNTFQANYEGGDGNDLTLTVVP*
Ga0157374_107068922	3300013296	Miscanthus Rhizosphere	TFGNLPDGGTIQIGNNTFQANYEGGDGNDLTLTVTQ*
Ga0157374_107699642	3300013296	Miscanthus Rhizosphere	GTFANLPDGGTIIIGQNTYQADYEGGDGNDLTLTVM*
Ga0157374_116376121	3300013296	Miscanthus Rhizosphere	IAGTFVNLADGSTFTFGNNTFQASYEGGDGNDLTLTVVP*
Ga0157378_101166621	3300013297	Miscanthus Rhizosphere	NNTAATPIAGTFGNLPDGGTLQIGNNTYQANYEGGDGNDLTLTVVE*
Ga0157378_101780051	3300013297	Miscanthus Rhizosphere	PISGAFANLPDGAMITIGSNKFQANYEGGDGNDLTLTVVSF*
Ga0157378_102836792	3300013297	Miscanthus Rhizosphere	MPSANPIRGAFGNLPDGAIVTVNGNNLQAIYSGGDGNDLTLTVVA*
Ga0157378_102998691	3300013297	Miscanthus Rhizosphere	IAGTFANLPDGGTLTVGLNDFQANYEGGDGNDLTLTVVP*
Ga0163162_107718241	3300013306	Switchgrass Rhizosphere	SPINGTFDNLTDGGTITIGNNTFQANYEGGDGNDLTLTVIGN*
Ga0163162_120675361	3300013306	Switchgrass Rhizosphere	PINGSFSNLSGGGTVTIGNNTFQASYEGGDGNDLTLTVVQ*
Ga0157375_104529761	3300013308	Miscanthus Rhizosphere	GTFANLPDGEILTSGGTTVQANYHGGTGNDLTLTVQ*
Ga0157375_107591943	3300013308	Miscanthus Rhizosphere	ATPIAGAFGNLADGAIVTVNGNNLQASYTGGDGNDLTLTVVQ*
Ga0157375_115983731	3300013308	Miscanthus Rhizosphere	TFGNLADGATLTVGSNKFQANYEGGDGNDLTLTVVQ*
Ga0157375_129363732	3300013308	Miscanthus Rhizosphere	GATPIAGTFANLADGATVVVGNNTFQANYEDGDGNDLTLTVVP*
Ga0134079_106262612	3300014166	Grasslands Soil	ANLPDGSTFTVGSNNYQVSYSGGDGNDLTLTVVL*
Ga0163163_105428161	3300014325	Switchgrass Rhizosphere	TFANLSDGGSITVGGNTFQANYEGGDGNDLTLTVVP*
Ga0163163_122996882	3300014325	Switchgrass Rhizosphere	AIVETFGNLPDGGTITVGSNTFQANYEGGDGNDLTLTVLP*
Ga0163163_123406222	3300014325	Switchgrass Rhizosphere	VINNAAATPISGIFANLADGATVRVGNNTFQANYGGGDGNDLTLTVIP*
Ga0157380_109404221	3300014326	Switchgrass Rhizosphere	FTVIDNTAAAPIAGTFVNLADGSIFTVGNNTFQASYEGGDGNDLTLMVVP*
Ga0157376_102612821	3300014969	Miscanthus Rhizosphere	TFANLQDGATIVVGNNTFQAKYEGGGGNDLTLTVTG*
Ga0157376_103211762	3300014969	Miscanthus Rhizosphere	FANLADGATVIVGSNTFQANYKGGDGNDLTLTVVP*
Ga0157376_106393941	3300014969	Miscanthus Rhizosphere	AATPIAGTFANLADGITLDFGPNHLMVSYEGGDGNDLTFTVVP*
Ga0157376_120978122	3300014969	Miscanthus Rhizosphere	PIIGSFNNLPDDGRITIGSNTFQANYEGGDGNDLTLTVVSN*
Ga0157376_122967571	3300014969	Miscanthus Rhizosphere	TFSNLPDGSTITVGNNTFQANYEGGDGNDLTLTVVP*
Ga0137405_11329753	3300015053	Vadose Zone Soil	SNLPDGEIVTINGNNFQASYSGGDGNDLTLTVVP*
Ga0137418_105431223	3300015241	Vadose Zone Soil	GTFSNLPDGGIVNVNGNNLQASYEGGDGNDLTLTVVP*
Ga0137403_109283721	3300015264	Vadose Zone Soil	GTFANLADGATFTIDNITFQADYQGGDGNDLTLTVVP*
Ga0134072_100411661	3300015357	Grasslands Soil	GTFTNLPEGTILQAGRNKLQASYTGGDGNDLTLTVVQ*
Ga0132258_111144283	3300015371	Arabidopsis Rhizosphere	LISGTFANLADGAIITVGSDNFQASYSGGDGNDLTLTVVL*
Ga0132256_1008939451	3300015372	Arabidopsis Rhizosphere	TFSNLSDGAILTANGNNFQASYHGGDGNDLTLTVMP*
Ga0132256_1035486421	3300015372	Arabidopsis Rhizosphere	TGAALTILSNTAATPTAGAFANLADGATIMIGNNTFQANYEGGDGNDLTLTVVE*
Ga0132257_1020968991	3300015373	Arabidopsis Rhizosphere	TFSNLADQSTITAGGNTFRANYEGGDGNDLTLGVVP*
Ga0132257_1022143102	3300015373	Arabidopsis Rhizosphere	ANLHDGSIVTIFGNHLQASYEGGDGNDLTLTVVR*
Ga0132257_1022840242	3300015373	Arabidopsis Rhizosphere	LVIDNPSATPISGAFSNLPDGGILNLGGNNLQASYEGGDGNDLTLTVVP*
Ga0132257_1032442551	3300015373	Arabidopsis Rhizosphere	PIAGTFLNLADDSTFTVGSNTFQANYEGGDGNDLTLTVVP*
Ga0132255_1020646172	3300015374	Arabidopsis Rhizosphere	TPIAGTFANLADGITLDFGPNHLMVSYEGGDGNDLTFTVVP*
Ga0132255_1036049391	3300015374	Arabidopsis Rhizosphere	GTFHNLRDGAIITVNGSNLQASYTGGDGNDLTLTVVP*
Ga0132255_1046791772	3300015374	Arabidopsis Rhizosphere	AATPIAGTFANLHDGSIVTVFGNHLQASYEGGDGNDLTLTVVR*
Ga0182032_103568211	3300016357	Soil	TFMNLPDGGTITVGNNTFQANYEGGDGNDLTLTVVP
Ga0187779_112433431	3300017959	Tropical Peatland	GAFANLPDNAILSVNGKTLRESYEGGDGNDLTLTVMP
Ga0184618_102913152	3300018071	Groundwater Sediment	SNTSANPIAGTFINLADGSTFTAGRNNFQASYEGGDSNDLTVTVVP
Ga0066655_104934692	3300018431	Grasslands Soil	TFSNLPDGGTITAGNNTFQASYSGGDGNDLTLTVVP
Ga0066667_101390341	3300018433	Grasslands Soil	ANRIAGTFANLADRSTFTAGSNTFQANYKGGDHNDLTLTVVP
Ga0066667_110793112	3300018433	Grasslands Soil	FANLPDGSTFTAGRNNFQVNYSGGDGNDLTLAVVP
Ga0066667_120024222	3300018433	Grasslands Soil	AATPIIGTFANLPDGSTFTVGPNTFQVNYEGGGDGNDLTLTVVP
Ga0210392_109923772	3300021475	Soil	VTTFTDDANVTAGNNTFQSNYEGGDGNDLTLTVVP
Ga0207697_100546081	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	IVETFGNLPDGGTITVGSNTFQANYEGGDGNDLTLTVLP
Ga0207642_107770191	3300025899	Miscanthus Rhizosphere	GTFANLPDGGTVTIGLNDFQANYEGGDGNDLTLAVVP
Ga0207642_109963211	3300025899	Miscanthus Rhizosphere	NRAATPIAGTFSNIADGGTVTVGSNTFQANYEGGDGNDLTLTVVSN
Ga0207680_108893252	3300025903	Switchgrass Rhizosphere	WTFSNLPDGSTITVGNNTFQANYEGGDGNDLTLTVVP
Ga0207645_103246752	3300025907	Miscanthus Rhizosphere	NLPDGATVTVGVNTYQANYEGGDGNDLTLTVVRELRRRE
Ga0207649_113740782	3300025920	Corn Rhizosphere	FSNLPDGSTITVGNNTFQANYEGGDGNDLTLTVVP
Ga0207646_115154762	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	SVNPIAGTFDNLSDGAIITVNGNNLQASYEGGDGNDLTLTVVP
Ga0207681_115591931	3300025923	Switchgrass Rhizosphere	AIVETFGNLPDGGTITVGSNTFQANYEGGDGNDLTLTVLP
Ga0207650_102986352	3300025925	Switchgrass Rhizosphere	FSNLPDGGTITVGSNTYQANYEGGDGNDLTLTVVP
Ga0207650_110733651	3300025925	Switchgrass Rhizosphere	RAIAGTFGNLPDGSTLTVGSNTFKANYGGGDGNDLTLTVVP
Ga0207659_104495502	3300025926	Miscanthus Rhizosphere	INGTFDNLTDGGSITIGNNTFQANYEGGDGNDLTLTVIGN
Ga0207659_105739721	3300025926	Miscanthus Rhizosphere	ITHRRRAIAGTFGNLPDGSTLTVGSNTFKANYGGGDGNDLTLTVVP
Ga0207659_106835951	3300025926	Miscanthus Rhizosphere	ILGTFANLPDGGTIQIGNNTYQADYEGGDGNDLTLTVIP
Ga0207659_115796691	3300025926	Miscanthus Rhizosphere	LNFPEGGKITSGRNTYQASYVGGDGNDMTLTVVTP
Ga0207687_109331311	3300025927	Miscanthus Rhizosphere	IAGIFSNLPDGGTITVGNDTFQANYEGGDGNDLTLTVIQ
Ga0207700_118096541	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	ANPIAGSFSNLQDGGIIKAGGNRLQASYEGGDGNDLTLTVVP
Ga0207701_103625552	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	AATPIAGTFVNLSDGSAVTVGNNTFQANYEGGDGNDLTLTVIP
Ga0207701_106844972	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	AATPIAGTFVNLSDGSAVTVGNNTFQANYEGGDGNDLTLTVVP
Ga0207701_106889821	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	GTPINGSFSNLSDGGTVTIGNTTFQANYEGGDGNDLTLTVVNN
Ga0207701_116720032	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	VVISNTSATPISGTFGNLADDATFKAGRNKFQADYEGGDGNDLTLTVVP
Ga0207644_105516862	3300025931	Switchgrass Rhizosphere	NLPDGITFFERGNVIQASYEGGDGNDLTLTVLKSRDRN
Ga0207670_102029521	3300025936	Switchgrass Rhizosphere	VETFSNLPDGGTITVGGNTFQANYEGGDGNDLTLTVLP
Ga0207670_111019392	3300025936	Switchgrass Rhizosphere	GNLPDGGTISIGRNTYQANYEGGDGNDLTLTVVSN
Ga0207670_113401772	3300025936	Switchgrass Rhizosphere	TAATPIAGTFGNLADGATVVVGNNTFQANYEGGDGNDLTLTVTQ
Ga0207669_102092223	3300025937	Miscanthus Rhizosphere	LGTFGNLADGSIVTVRNNKFQVNYEGGDGNDLVLVSVR
Ga0207691_100220787	3300025940	Miscanthus Rhizosphere	AGTFANLTDGATVVVGNNTFQANYEGGDGNDLTLTVQ
Ga0207689_116417821	3300025942	Miscanthus Rhizosphere	AVTPISGTFSNLSDGGTILVGNNNTLQANYEGGDGNDLTLTVVP
Ga0207661_109256122	3300025944	Corn Rhizosphere	TPISGAFANLPDGAMITIGSNKFQANYEGGDGNDLTLTVVSF
Ga0207651_102836551	3300025960	Switchgrass Rhizosphere	GTFSNLPDGGIVNVNGNNLRASYSGGDGNDLTLEVVP
Ga0207651_104007161	3300025960	Switchgrass Rhizosphere	FLACPGIHNLANGKIIAVNGNNLQASYKGGDGNDLTLTVVP
Ga0207658_100187061	3300025986	Switchgrass Rhizosphere	AVAPIVGTFHNLANGKIIAVNGNSLQASYSGGDGNDLTLTVVP
Ga0207658_102873611	3300025986	Switchgrass Rhizosphere	SATPISGTFVNLADGSTFTTGRNTFQANYESGDGNDLTLTVVTP
Ga0207658_103170761	3300025986	Switchgrass Rhizosphere	INNTAATPISGVFANLADGATVIVGSNIFQANYEGGDGNDLTLTVVP
Ga0207658_109668901	3300025986	Switchgrass Rhizosphere	AAILGTFANLPDGGTITIGSNTFQANYEGGDGNDLTLTVMP
Ga0207677_112625252	3300026023	Miscanthus Rhizosphere	FANLTDGATVVVGNNTFQANYEDGDGNDLTLTVVP
Ga0207678_106578861	3300026067	Corn Rhizosphere	GAFSNLPDGGTLTVGSNTFAADYGGGDGNDLTLTVVP
Ga0207648_102218961	3300026089	Miscanthus Rhizosphere	TPIAGTFANLTDGATVVVGNNTFQANYEGGDGNDLTLTVQ
Ga0207648_102263462	3300026089	Miscanthus Rhizosphere	PISGTFGNLADDATFKAGRNKFQADYEGGDGNDLTLTVVQ
Ga0207648_104337442	3300026089	Miscanthus Rhizosphere	AGTFANLTDGATVVVGNNTFQANYEDGDGNDLTLTVVP
Ga0207648_108732831	3300026089	Miscanthus Rhizosphere	IANLADGAVIPIWKANNYRVRYQGGDGNDLTLTVVP
Ga0207648_109713562	3300026089	Miscanthus Rhizosphere	GHFSNLADGAIVTIGGAKFQANYEGGDGNDLTLTVIP
Ga0207676_106379011	3300026095	Switchgrass Rhizosphere	TVFNAIDNTSVTTISGTFVNLADSSIFTVGSNTVQASYEGGDGNDLTLMVVP
Ga0207683_108731302	3300026121	Miscanthus Rhizosphere	NGNFALLPDGGTISIGRNTYQANYEGGDGNDLTLTVVQ
Ga0207698_125092332	3300026142	Corn Rhizosphere	MPIATAQGRTIRHASANPISGTFGNLGDGAIVNINGNNLQASYSGGDGNDLTLTVVP
Ga0209848_10650833	3300026221	Permafrost Soil	MISNTAATAIGGNFANLADGAIISVNGINFQASYEGGDGNDL
Ga0209863_101649672	3300026281	Prmafrost Soil	TATSPISGTFTNLADGATISVNGNNLQANYEGGDGNDLTLTVVQ
Ga0209155_11317181	3300026316	Soil	NPISGTFSNLPDGGIVTINGNNLQANCEGGDGNDLTLTVVP
Ga0209804_11138891	3300026335	Soil	TFANLADGAILSVGGNNLQASYEGGDGNDLTLTVVP
Ga0209057_10258754	3300026342	Soil	GAFSNLPDGSTFTSNGNAYQVSYEGGDGNDLTLMVVP
Ga0209157_12871332	3300026537	Soil	VGTFMNLPDGGTITADNNTFQADYEGGDGNDLTLTAIN
Ga0209474_107388862	3300026550	Soil	GSSPIVGTFMNLPDGGTITAGNNTFQASYSGGDGNDLTLTVVP
Ga0209967_10644882	3300027364	Arabidopsis Thaliana Rhizosphere	NIAANSIVGTFINLPGGSTFTVGSNTFQASYEGGDGNDLTLTVVP
Ga0207437_1014531	3300027431	Soil	GTFANLADGTTFSSGGNTFKANYHGGNGNDLVLTVQ
Ga0209180_101697435	3300027846	Vadose Zone Soil	LTVISDTAATPIAGTFTNLPDGAMFMQGRNTYQVSYEGGDGNDLTLTVLP
Ga0268266_106679432	3300028379	Switchgrass Rhizosphere	PIGGAFANLPDGSIVVIGSNSYEVDYEGGDGNDLTLTVLP
Ga0268266_107197041	3300028379	Switchgrass Rhizosphere	SFLNFPEGGKITSGRNTYQASYVGGDGNDMTLTVVTP
Ga0268264_117308821	3300028381	Switchgrass Rhizosphere	AGTFSNLADGSTFNAGTNTFQVSYEGGDGNDLTLTVQ
Ga0307304_105781932	3300028885	Soil	TFSNLPDGSTINVGGRNCQVSYSGGDGNDLTLTVVP
Ga0170834_1038461041	3300031057	Forest Soil	TFSNLPDGATVNVNGNHLQASYEGFNGNDLTLTVVP
Ga0170824_1007774681	3300031231	Forest Soil	TGIAGTFGNLPDGSTLMVGSNTFQANYEGGDGNDLTLTVVL
Ga0272434_13121872	3300031473	Rock	TFVNLPDGSTFTSNDNTYQVNYKGGDGNDLTLTVVR
Ga0310886_103801052	3300031562	Soil	TGTFHNLPEAAVLTVNGSKLQASYTGVDGNDLTLTVIP
Ga0308175_1003962891	3300031938	Soil	TFSNLADGSTIAIGSNTYLVSYEGGDGNDLTLTVQ
Ga0310909_106910553	3300031947	Soil	FSNLPDGSIITVGGKNCQVSYSGGDGNDLTLTVVP
Ga0308176_107509752	3300031996	Soil	VIKNTAVTPISGTFSNLPNGAIVNGNNLQASYSGGDGNDLTLTVVP
Ga0306924_105462231	3300032076	Soil	GGTFAKLPDGSIVTINGNNFQASYEGGDGNDLTLTVVP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F013902

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences