Basic Information | |
---|---|
Family ID | F017234 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 242 |
Average Sequence Length | 42 residues |
Representative Sequence | LSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Number of Associated Samples | 187 |
Number of Associated Scaffolds | 242 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.65 % |
% of genes near scaffold ends (potentially truncated) | 98.35 % |
% of genes from short scaffolds (< 2000 bps) | 88.02 % |
Associated GOLD sequencing projects | 172 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (55.372 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.074 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.926 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.587 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 242 Family Scaffolds |
---|---|---|
PF00216 | Bac_DNA_binding | 77.69 |
PF01230 | HIT | 8.68 |
PF02771 | Acyl-CoA_dh_N | 7.44 |
PF04677 | CwfJ_C_1 | 2.89 |
PF00575 | S1 | 0.83 |
PF07726 | AAA_3 | 0.41 |
PF13419 | HAD_2 | 0.41 |
COG ID | Name | Functional Category | % Frequency in 242 Family Scaffolds |
---|---|---|---|
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 77.69 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 7.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.79 % |
Unclassified | root | N/A | 44.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c1160131 | Not Available | 592 | Open in IMG/M |
3300000955|JGI1027J12803_105759190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 526 | Open in IMG/M |
3300001089|JGI12683J13190_1002048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2798 | Open in IMG/M |
3300001593|JGI12635J15846_10348660 | Not Available | 909 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101354523 | Not Available | 604 | Open in IMG/M |
3300002907|JGI25613J43889_10121405 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300002917|JGI25616J43925_10179400 | Not Available | 830 | Open in IMG/M |
3300003352|JGI26345J50200_1027533 | Not Available | 611 | Open in IMG/M |
3300003368|JGI26340J50214_10130486 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10168863 | Not Available | 885 | Open in IMG/M |
3300004616|Ga0068930_1359640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 657 | Open in IMG/M |
3300004635|Ga0062388_102888005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 507 | Open in IMG/M |
3300005439|Ga0070711_102007190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 509 | Open in IMG/M |
3300005471|Ga0070698_101808204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 564 | Open in IMG/M |
3300005518|Ga0070699_101049099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 748 | Open in IMG/M |
3300005534|Ga0070735_10059986 | All Organisms → cellular organisms → Bacteria | 2484 | Open in IMG/M |
3300005534|Ga0070735_10158075 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300005546|Ga0070696_101793255 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005554|Ga0066661_10322754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 949 | Open in IMG/M |
3300005554|Ga0066661_10647966 | Not Available | 623 | Open in IMG/M |
3300005561|Ga0066699_10712858 | Not Available | 714 | Open in IMG/M |
3300005575|Ga0066702_10059614 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
3300005598|Ga0066706_10130892 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
3300005602|Ga0070762_10387831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 897 | Open in IMG/M |
3300005610|Ga0070763_10262083 | Not Available | 940 | Open in IMG/M |
3300005610|Ga0070763_10858299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 539 | Open in IMG/M |
3300005615|Ga0070702_100402811 | Not Available | 979 | Open in IMG/M |
3300006028|Ga0070717_11285609 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300006163|Ga0070715_10228044 | Not Available | 962 | Open in IMG/M |
3300006163|Ga0070715_10777890 | Not Available | 579 | Open in IMG/M |
3300006173|Ga0070716_100201779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1322 | Open in IMG/M |
3300006176|Ga0070765_100805396 | Not Available | 888 | Open in IMG/M |
3300006176|Ga0070765_100990396 | Not Available | 795 | Open in IMG/M |
3300006358|Ga0068871_100594342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
3300006796|Ga0066665_10061005 | All Organisms → cellular organisms → Bacteria | 2639 | Open in IMG/M |
3300006796|Ga0066665_10276025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1340 | Open in IMG/M |
3300006800|Ga0066660_11083533 | Not Available | 636 | Open in IMG/M |
3300006871|Ga0075434_100458687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
3300006871|Ga0075434_101050194 | Not Available | 828 | Open in IMG/M |
3300007265|Ga0099794_10490363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 646 | Open in IMG/M |
3300009012|Ga0066710_101381782 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300009038|Ga0099829_10047246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3171 | Open in IMG/M |
3300009038|Ga0099829_11664450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300009089|Ga0099828_11719568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 551 | Open in IMG/M |
3300009090|Ga0099827_11510289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300009143|Ga0099792_10920389 | Not Available | 580 | Open in IMG/M |
3300009523|Ga0116221_1291322 | Not Available | 706 | Open in IMG/M |
3300009525|Ga0116220_10126194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
3300009553|Ga0105249_11623444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 719 | Open in IMG/M |
3300009628|Ga0116125_1070054 | Not Available | 911 | Open in IMG/M |
3300010043|Ga0126380_11278253 | Not Available | 637 | Open in IMG/M |
3300010116|Ga0127466_1065730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300010321|Ga0134067_10432286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 533 | Open in IMG/M |
3300010337|Ga0134062_10000239 | All Organisms → cellular organisms → Bacteria | 15695 | Open in IMG/M |
3300010359|Ga0126376_10226841 | Not Available | 1570 | Open in IMG/M |
3300010360|Ga0126372_10225305 | Not Available | 1585 | Open in IMG/M |
3300010360|Ga0126372_10264764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1485 | Open in IMG/M |
3300010360|Ga0126372_11490320 | Not Available | 712 | Open in IMG/M |
3300010360|Ga0126372_13166102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 511 | Open in IMG/M |
3300010362|Ga0126377_11096299 | Not Available | 865 | Open in IMG/M |
3300010376|Ga0126381_100917110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
3300010376|Ga0126381_101737449 | Not Available | 901 | Open in IMG/M |
3300010398|Ga0126383_11355444 | Not Available | 801 | Open in IMG/M |
3300010398|Ga0126383_11856779 | Not Available | 691 | Open in IMG/M |
3300010398|Ga0126383_12226847 | Not Available | 634 | Open in IMG/M |
3300010401|Ga0134121_12067179 | Not Available | 603 | Open in IMG/M |
3300010866|Ga0126344_1403089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 540 | Open in IMG/M |
3300010866|Ga0126344_1444438 | Not Available | 634 | Open in IMG/M |
3300011074|Ga0138559_1041164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 541 | Open in IMG/M |
3300011075|Ga0138555_1053930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 525 | Open in IMG/M |
3300011120|Ga0150983_10421530 | Not Available | 646 | Open in IMG/M |
3300011120|Ga0150983_13514438 | Not Available | 596 | Open in IMG/M |
3300011120|Ga0150983_13561807 | Not Available | 993 | Open in IMG/M |
3300011120|Ga0150983_15734902 | Not Available | 1049 | Open in IMG/M |
3300011269|Ga0137392_10579124 | Not Available | 932 | Open in IMG/M |
3300011269|Ga0137392_11582635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 514 | Open in IMG/M |
3300011271|Ga0137393_10196980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1698 | Open in IMG/M |
3300011271|Ga0137393_10680558 | Not Available | 881 | Open in IMG/M |
3300012096|Ga0137389_10073122 | All Organisms → cellular organisms → Bacteria | 2657 | Open in IMG/M |
3300012189|Ga0137388_10688289 | Not Available | 949 | Open in IMG/M |
3300012189|Ga0137388_11119392 | Not Available | 724 | Open in IMG/M |
3300012202|Ga0137363_10142799 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
3300012202|Ga0137363_10179499 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
3300012202|Ga0137363_10318533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
3300012205|Ga0137362_10220729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1634 | Open in IMG/M |
3300012205|Ga0137362_10609758 | Not Available | 941 | Open in IMG/M |
3300012206|Ga0137380_10473955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
3300012206|Ga0137380_10684974 | Not Available | 891 | Open in IMG/M |
3300012210|Ga0137378_10212560 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
3300012285|Ga0137370_10922337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 540 | Open in IMG/M |
3300012357|Ga0137384_11580079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 506 | Open in IMG/M |
3300012361|Ga0137360_11894044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 502 | Open in IMG/M |
3300012362|Ga0137361_10204074 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
3300012582|Ga0137358_10151137 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300012922|Ga0137394_10524318 | Not Available | 1005 | Open in IMG/M |
3300012923|Ga0137359_10312006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1400 | Open in IMG/M |
3300012925|Ga0137419_11462087 | Not Available | 578 | Open in IMG/M |
3300012927|Ga0137416_10122763 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
3300012927|Ga0137416_10338290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
3300012929|Ga0137404_11608506 | Not Available | 602 | Open in IMG/M |
3300012930|Ga0137407_10852754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300012930|Ga0137407_11097051 | Not Available | 755 | Open in IMG/M |
3300012971|Ga0126369_10009312 | All Organisms → cellular organisms → Bacteria | 7471 | Open in IMG/M |
3300012977|Ga0134087_10110559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
3300014165|Ga0181523_10134836 | Not Available | 1462 | Open in IMG/M |
3300014169|Ga0181531_10023432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3548 | Open in IMG/M |
3300014169|Ga0181531_10919577 | Not Available | 548 | Open in IMG/M |
3300014655|Ga0181516_10669779 | Not Available | 537 | Open in IMG/M |
3300015053|Ga0137405_1085055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
3300015054|Ga0137420_1077430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 574 | Open in IMG/M |
3300015054|Ga0137420_1178046 | Not Available | 792 | Open in IMG/M |
3300015054|Ga0137420_1216320 | Not Available | 958 | Open in IMG/M |
3300015264|Ga0137403_10290664 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
3300016750|Ga0181505_10763952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 515 | Open in IMG/M |
3300017927|Ga0187824_10061279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
3300017930|Ga0187825_10361610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 551 | Open in IMG/M |
3300017932|Ga0187814_10397597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 536 | Open in IMG/M |
3300017934|Ga0187803_10095811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1166 | Open in IMG/M |
3300017974|Ga0187777_11221216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 550 | Open in IMG/M |
3300017993|Ga0187823_10293472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 563 | Open in IMG/M |
3300017995|Ga0187816_10310275 | Not Available | 693 | Open in IMG/M |
3300018006|Ga0187804_10422807 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300018040|Ga0187862_10092709 | All Organisms → cellular organisms → Bacteria | 2107 | Open in IMG/M |
3300018085|Ga0187772_10182848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1401 | Open in IMG/M |
3300018088|Ga0187771_10098126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2356 | Open in IMG/M |
3300018088|Ga0187771_10909982 | Not Available | 746 | Open in IMG/M |
3300018433|Ga0066667_10137959 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
3300019872|Ga0193754_1014726 | Not Available | 829 | Open in IMG/M |
3300019887|Ga0193729_1010940 | All Organisms → cellular organisms → Bacteria | 4085 | Open in IMG/M |
3300020060|Ga0193717_1150735 | Not Available | 683 | Open in IMG/M |
3300020199|Ga0179592_10190796 | Not Available | 931 | Open in IMG/M |
3300020579|Ga0210407_10251767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1376 | Open in IMG/M |
3300020581|Ga0210399_10806333 | Not Available | 766 | Open in IMG/M |
3300020583|Ga0210401_11302217 | Not Available | 584 | Open in IMG/M |
3300021170|Ga0210400_10786660 | Not Available | 780 | Open in IMG/M |
3300021178|Ga0210408_10040546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3656 | Open in IMG/M |
3300021178|Ga0210408_10872286 | Not Available | 702 | Open in IMG/M |
3300021181|Ga0210388_10099204 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
3300021181|Ga0210388_11527328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 557 | Open in IMG/M |
3300021401|Ga0210393_10395499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1126 | Open in IMG/M |
3300021405|Ga0210387_11845088 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300021420|Ga0210394_11053497 | Not Available | 703 | Open in IMG/M |
3300021420|Ga0210394_11857088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 501 | Open in IMG/M |
3300021432|Ga0210384_10954511 | Not Available | 759 | Open in IMG/M |
3300021433|Ga0210391_11538399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 509 | Open in IMG/M |
3300021475|Ga0210392_10931104 | Not Available | 650 | Open in IMG/M |
3300021476|Ga0187846_10223874 | Not Available | 785 | Open in IMG/M |
3300021476|Ga0187846_10383273 | Not Available | 578 | Open in IMG/M |
3300021478|Ga0210402_10018546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5967 | Open in IMG/M |
3300021478|Ga0210402_10532892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1090 | Open in IMG/M |
3300021478|Ga0210402_11237705 | Not Available | 674 | Open in IMG/M |
3300021559|Ga0210409_10160999 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
3300022531|Ga0242660_1145623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 616 | Open in IMG/M |
3300022557|Ga0212123_10085449 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
3300022711|Ga0242674_1031067 | Not Available | 671 | Open in IMG/M |
3300022718|Ga0242675_1053467 | Not Available | 683 | Open in IMG/M |
3300024219|Ga0247665_1058789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 544 | Open in IMG/M |
3300024227|Ga0228598_1120868 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300024330|Ga0137417_1011571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
3300024330|Ga0137417_1097549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
3300024330|Ga0137417_1414506 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
3300025905|Ga0207685_10846779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 506 | Open in IMG/M |
3300025911|Ga0207654_11424073 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300025916|Ga0207663_10859909 | Not Available | 724 | Open in IMG/M |
3300025942|Ga0207689_10458095 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1066 | Open in IMG/M |
3300026332|Ga0209803_1101572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1175 | Open in IMG/M |
3300026333|Ga0209158_1211184 | Not Available | 673 | Open in IMG/M |
3300026359|Ga0257163_1057296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 623 | Open in IMG/M |
3300026499|Ga0257181_1006400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
3300026538|Ga0209056_10262078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1221 | Open in IMG/M |
3300026547|Ga0209156_10178981 | Not Available | 1019 | Open in IMG/M |
3300026555|Ga0179593_1204071 | Not Available | 2321 | Open in IMG/M |
3300026934|Ga0207816_1035305 | Not Available | 596 | Open in IMG/M |
3300026979|Ga0207817_1020577 | Not Available | 712 | Open in IMG/M |
3300027014|Ga0207815_1025568 | Not Available | 722 | Open in IMG/M |
3300027039|Ga0207855_1022909 | Not Available | 849 | Open in IMG/M |
3300027326|Ga0209731_1001833 | All Organisms → cellular organisms → Bacteria | 2362 | Open in IMG/M |
3300027583|Ga0209527_1149546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 517 | Open in IMG/M |
3300027603|Ga0209331_1031726 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300027605|Ga0209329_1100873 | Not Available | 632 | Open in IMG/M |
3300027629|Ga0209422_1105854 | Not Available | 648 | Open in IMG/M |
3300027643|Ga0209076_1004226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3318 | Open in IMG/M |
3300027651|Ga0209217_1124655 | Not Available | 724 | Open in IMG/M |
3300027674|Ga0209118_1166193 | Not Available | 605 | Open in IMG/M |
3300027684|Ga0209626_1021445 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300027701|Ga0209447_10054680 | Not Available | 1100 | Open in IMG/M |
3300027727|Ga0209328_10065410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
3300027737|Ga0209038_10018545 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
3300027767|Ga0209655_10085192 | Not Available | 1050 | Open in IMG/M |
3300027768|Ga0209772_10038578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
3300027768|Ga0209772_10049339 | Not Available | 1251 | Open in IMG/M |
3300027846|Ga0209180_10009950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 4886 | Open in IMG/M |
3300027846|Ga0209180_10064115 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
3300027853|Ga0209274_10096923 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300027862|Ga0209701_10043862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2884 | Open in IMG/M |
3300027875|Ga0209283_10059812 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
3300027875|Ga0209283_10674681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 648 | Open in IMG/M |
3300027903|Ga0209488_10725295 | Not Available | 710 | Open in IMG/M |
3300027911|Ga0209698_10784982 | Not Available | 720 | Open in IMG/M |
3300027986|Ga0209168_10039730 | All Organisms → cellular organisms → Bacteria | 2559 | Open in IMG/M |
3300028069|Ga0255358_1033840 | Not Available | 721 | Open in IMG/M |
3300028145|Ga0247663_1041799 | Not Available | 753 | Open in IMG/M |
3300028673|Ga0257175_1099806 | Not Available | 568 | Open in IMG/M |
3300029636|Ga0222749_10096389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1383 | Open in IMG/M |
3300029636|Ga0222749_10731049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 542 | Open in IMG/M |
3300029944|Ga0311352_10069924 | All Organisms → cellular organisms → Bacteria | 3143 | Open in IMG/M |
3300031057|Ga0170834_101326483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 520 | Open in IMG/M |
3300031057|Ga0170834_105900721 | Not Available | 961 | Open in IMG/M |
3300031231|Ga0170824_112529414 | Not Available | 880 | Open in IMG/M |
3300031231|Ga0170824_128892067 | Not Available | 619 | Open in IMG/M |
3300031446|Ga0170820_10234836 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300031549|Ga0318571_10274799 | Not Available | 626 | Open in IMG/M |
3300031723|Ga0318493_10500073 | Not Available | 672 | Open in IMG/M |
3300031747|Ga0318502_10172798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
3300031764|Ga0318535_10133592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
3300031771|Ga0318546_10910410 | Not Available | 619 | Open in IMG/M |
3300031780|Ga0318508_1064149 | Not Available | 988 | Open in IMG/M |
3300031820|Ga0307473_11232213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 557 | Open in IMG/M |
3300031823|Ga0307478_11151147 | Not Available | 647 | Open in IMG/M |
3300031896|Ga0318551_10583136 | Not Available | 645 | Open in IMG/M |
3300031912|Ga0306921_11001443 | Not Available | 943 | Open in IMG/M |
3300031912|Ga0306921_12337222 | Not Available | 559 | Open in IMG/M |
3300031962|Ga0307479_10117473 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
3300031962|Ga0307479_10205938 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
3300031962|Ga0307479_10886802 | Not Available | 865 | Open in IMG/M |
3300031962|Ga0307479_11359610 | Not Available | 670 | Open in IMG/M |
3300032055|Ga0318575_10358094 | Not Available | 740 | Open in IMG/M |
3300032059|Ga0318533_11262802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 540 | Open in IMG/M |
3300032059|Ga0318533_11400077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 511 | Open in IMG/M |
3300032090|Ga0318518_10460208 | Not Available | 652 | Open in IMG/M |
3300032094|Ga0318540_10659306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 504 | Open in IMG/M |
3300032174|Ga0307470_11227713 | Not Available | 610 | Open in IMG/M |
3300032174|Ga0307470_11532384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 555 | Open in IMG/M |
3300032174|Ga0307470_11581440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 548 | Open in IMG/M |
3300032180|Ga0307471_100568799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
3300032180|Ga0307471_100659571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1209 | Open in IMG/M |
3300032205|Ga0307472_101422593 | Not Available | 673 | Open in IMG/M |
3300032261|Ga0306920_102244304 | Not Available | 758 | Open in IMG/M |
3300032782|Ga0335082_10894879 | Not Available | 750 | Open in IMG/M |
3300032782|Ga0335082_11110781 | Not Available | 657 | Open in IMG/M |
3300032782|Ga0335082_11433007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 561 | Open in IMG/M |
3300033134|Ga0335073_10840557 | Not Available | 978 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.94% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.37% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.48% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.07% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.07% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.65% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.24% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.24% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.41% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.41% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.41% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.41% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.41% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.41% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.41% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004616 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010116 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026934 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 10 (SPAdes) | Environmental | Open in IMG/M |
3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_11601312 | 2228664022 | Soil | VKQQERQEIAQYRSTSKSSSTATIGDALKQKLSSR |
JGI1027J12803_1057591901 | 3300000955 | Soil | KQIERKEIEQYRSTSTSKSSSTATIGDALKSKLSAR* |
JGI12683J13190_10020485 | 3300001089 | Forest Soil | SYRAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLSAR* |
JGI12635J15846_103486603 | 3300001593 | Forest Soil | KQQERREIDHYKSATKSSSTATIGDAMKSKLSAR* |
JGIcombinedJ26739_1013545231 | 3300002245 | Forest Soil | KQQERREIDQYRSTSNSKSSSTATIGDALKSKLGR* |
JGI25613J43889_101214051 | 3300002907 | Grasslands Soil | TRRIGLSYRAAVKQIERKEIEQYRSTTKTSSTATIGDALKSKLSAR* |
JGI25616J43925_101794002 | 3300002917 | Grasslands Soil | LSYRAAVKQVERREIEQYKSTSKSSSTATIGDAIQSKLSAR* |
JGI26345J50200_10275332 | 3300003352 | Bog Forest Soil | GLSYRAAAKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
JGI26340J50214_101304862 | 3300003368 | Bog Forest Soil | LSYRAAVRQIERKEIEQYKTSKSSATATIGDALKQKLASR* |
JGIcombinedJ51221_101688631 | 3300003505 | Forest Soil | SYRAAAKQIERREIEQYRSTTKSSSTATIGDMMKSKLSAR* |
Ga0068930_13596402 | 3300004616 | Peatlands Soil | TRRIGLSYRAAVRQIERKEIEQYKSTKSSATATIGDAMKQKLASR* |
Ga0062388_1028880051 | 3300004635 | Bog Forest Soil | IKISPETRRIGLSYRAAVKQIERREIDQYKQTTKTSSTATLGDVMRAKLASTKS* |
Ga0070711_1020071902 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LSYRAAVKQIERKEIEQYRSTTKSSSTATIGDVMKQKLASR* |
Ga0070698_1018082041 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | IGLSYRAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLSAR* |
Ga0070699_1010490991 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KIIKISPESRRIGLSYKSAVKQQERQEIAQYRSTSKTSSTATIGDVLKQKLSSR* |
Ga0070735_100599861 | 3300005534 | Surface Soil | TRRIGLSYRAAAKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR* |
Ga0070735_101580754 | 3300005534 | Surface Soil | SYRAAAKQIERREIEQYRSTTKSSSTATIGDALKQKLAGLK* |
Ga0070696_1017932552 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ISPESRRIGLSYKSAVKQQERQEIAQYRSTSKTSSTATIGDVLKQKLSSR* |
Ga0066661_103227541 | 3300005554 | Soil | RIGLSYRAAVRQIERKEIDQYKSSKSSATATIGDVMKQKLASR* |
Ga0066661_106479662 | 3300005554 | Soil | AVKQVERREIDQYKSTTKSSSTATIGDAIQSKLSAR* |
Ga0066699_107128582 | 3300005561 | Soil | SYRAAVKQQERREIEHYRSTSKSSSTATIGDAIQSKLSAR* |
Ga0066702_100596144 | 3300005575 | Soil | AAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0066706_101308924 | 3300005598 | Soil | YRAAVKQIERKEIEQYRSTTKSSSTATIGDVMKQKLASR* |
Ga0070762_103878312 | 3300005602 | Soil | RIGLSYRAATKQIERREIEQYRSTTKSSSTATIGDVMKSKLSAR* |
Ga0070763_102620832 | 3300005610 | Soil | IGLSYRAAAKQIERREIEQYRSTTKTSSTATIGDALKQKLAGLK* |
Ga0070763_108582992 | 3300005610 | Soil | ATKQIERREIEQYRSTTKSSSTATIGDVMKSKLSAR* |
Ga0070702_1004028113 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LSYKAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR* |
Ga0070717_112856092 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RIGLSYRAAAKQIERREIEQYRSTTKSSSTATIGDALKQKLASR* |
Ga0070715_102280441 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VKQVERREIEQYKSTSKSSSTATIGDAIQSKLSAR* |
Ga0070715_107778901 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | KQVERREIEQYKSTTKSSSTATIGDAIQSKLSAR* |
Ga0070716_1002017791 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | IIKISPESRRIGLSYKSAVKQQERQEIAQYRSTSKTSSTATIGDVLKQKLSSR* |
Ga0070765_1008053963 | 3300006176 | Soil | AVKQQERKEIDQYRGSKSSSTATIGDVMKQKLASR* |
Ga0070765_1009903962 | 3300006176 | Soil | SYRAAAKQIERKEIEQYRSTTKSSSTATIGDALKQKLAGLK* |
Ga0068871_1005943423 | 3300006358 | Miscanthus Rhizosphere | IKISPESRRIGLSYKAAVKQVERQEIAQYRSTSRASSTATIGDALKQKLSSR* |
Ga0066665_100610055 | 3300006796 | Soil | AVKHQERQEIAQYRSTSKTSSTATIRDVLKQKLSSR* |
Ga0066665_102760251 | 3300006796 | Soil | KQVERREIEQYRTSKTSASATIGDALKQKLASRG* |
Ga0066660_110835331 | 3300006800 | Soil | KQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0075434_1004586873 | 3300006871 | Populus Rhizosphere | RIGLSYKAAVKQVERQEIAQYRSTSRSSSTATIGDALKQKLSSR* |
Ga0075434_1010501941 | 3300006871 | Populus Rhizosphere | KQIERKEIEQYRSASKSSSTATIGDALKSKLQAR* |
Ga0099794_104903632 | 3300007265 | Vadose Zone Soil | WRIGLSYRAAVKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR* |
Ga0066710_1013817823 | 3300009012 | Grasslands Soil | ISPETRRIGLSYRSAVKQLERKEIEQYRSASKSSSTATIGDALKSKLSAR |
Ga0099829_100472461 | 3300009038 | Vadose Zone Soil | AAKQIERKEIEQYRSTTKTSSTATIGDALKSKLSAR* |
Ga0099829_116644501 | 3300009038 | Vadose Zone Soil | DTRRIGLSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0099828_117195682 | 3300009089 | Vadose Zone Soil | RIGLSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0099827_115102892 | 3300009090 | Vadose Zone Soil | AAAKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR* |
Ga0099792_109203891 | 3300009143 | Vadose Zone Soil | RIGLSYRAALKQIERREIEQYKSTTKSSSTATIGDAIQSKLSAR* |
Ga0116221_12913222 | 3300009523 | Peatlands Soil | RIGLSYRAAARQIERKEIEQYKSTTKSSATATIGDAMKQKLASR* |
Ga0116220_101261943 | 3300009525 | Peatlands Soil | AAVRQIERKEIEQYKSTKSSATATIGDAMKQKLASR* |
Ga0105249_116234442 | 3300009553 | Switchgrass Rhizosphere | YDFKFIKISPESRRIGLSYKAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR* |
Ga0116125_10700541 | 3300009628 | Peatland | KISPETRRIGLSYRAAVKQIERREIDQYKQTTKTSSTATIGDAMRSKLAATKS* |
Ga0126380_112782531 | 3300010043 | Tropical Forest Soil | SPESRRIGLSYKAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR* |
Ga0127466_10657302 | 3300010116 | Grasslands Soil | IGLSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0134067_104322861 | 3300010321 | Grasslands Soil | RAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0134062_1000023918 | 3300010337 | Grasslands Soil | KISPETRRIGLGYRAAVKQIERKEIEQYRSTSKSSSKATIGDALKSKLSAR* |
Ga0126376_102268411 | 3300010359 | Tropical Forest Soil | KISPESRRIGLSYKAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLASR* |
Ga0126372_102253051 | 3300010360 | Tropical Forest Soil | SYKAAVKQQERREIEQYRTSKSSATATIGDALKQKLASRG* |
Ga0126372_102647641 | 3300010360 | Tropical Forest Soil | AAVKQQERREIEQYRTSKSSATATIGDALKQKLASRG* |
Ga0126372_114903202 | 3300010360 | Tropical Forest Soil | GLSYKAAVKQQERREIEQYRTSKSSATATIGDALKQKLASRG* |
Ga0126372_131661022 | 3300010360 | Tropical Forest Soil | FKIIKISPESRKIALSYKAAVKQQERQEIAQYRSTSRSSATATIGDALKQKLQQR* |
Ga0126377_110962993 | 3300010362 | Tropical Forest Soil | IGLSYKAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR* |
Ga0126381_1009171101 | 3300010376 | Tropical Forest Soil | RAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLQAR* |
Ga0126381_1017374491 | 3300010376 | Tropical Forest Soil | YRAAVKQLERKEIAQYRSSSKSSSTATIGDALKSKLSAR* |
Ga0126383_113554441 | 3300010398 | Tropical Forest Soil | ESRRIGLSYKAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR* |
Ga0126383_118567791 | 3300010398 | Tropical Forest Soil | PDSRRTGLSYKAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR* |
Ga0126383_122268472 | 3300010398 | Tropical Forest Soil | YKAAVKQLERREIEQYRTSKSSATATIGDALKQKLASRG* |
Ga0134121_120671791 | 3300010401 | Terrestrial Soil | LSYRAAVKQIERKEIDQYRSTATSSKSSSTATLGDVLKSKLANR* |
Ga0126344_14030891 | 3300010866 | Boreal Forest Soil | RRIGLSYRAAAKQIERKEIEQYRSTTKSSSTATIGDALKQKLASR* |
Ga0126344_14444381 | 3300010866 | Boreal Forest Soil | AAAKQIERKEIEQYRTTSKTSSTATIGDALKSKLSAR* |
Ga0138559_10411642 | 3300011074 | Peatlands Soil | SDTRRIGLSYRAAVRQIERKEIEQYKSTTKSSATATIGDAMKQKLASR* |
Ga0138555_10539302 | 3300011075 | Peatlands Soil | GLSYRAAVRQIERKEIEQYKSTTKSSATATIGDAMKQKLASR* |
Ga0150983_104215302 | 3300011120 | Forest Soil | LSYRAAVRQIERKEIEQYKSSKSSATATIGDAMKQKLASR* |
Ga0150983_135144381 | 3300011120 | Forest Soil | KQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR* |
Ga0150983_135618073 | 3300011120 | Forest Soil | LSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0150983_157349021 | 3300011120 | Forest Soil | RIGLSYRAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLTAR* |
Ga0137392_105791242 | 3300011269 | Vadose Zone Soil | AVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0137392_115826351 | 3300011269 | Vadose Zone Soil | VKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0137393_101969801 | 3300011271 | Vadose Zone Soil | SAETRRIDLSYRAAVKQIERKEIDQYRSSKTSSGATIGDVMKQKLASR* |
Ga0137393_106805581 | 3300011271 | Vadose Zone Soil | IKISPESRKIALSYKAAVKQVERQEIAQYRSTTKTSSTATIGDALKQKLNSR* |
Ga0137389_100731226 | 3300012096 | Vadose Zone Soil | GLSYRAAAKQIERKEIEQYRSTTKTSSTATIGDALKSKLSAR* |
Ga0137388_106882892 | 3300012189 | Vadose Zone Soil | YRAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLSAR* |
Ga0137388_111193923 | 3300012189 | Vadose Zone Soil | RRIGLSYRAAVRQVERREIEQYRTTAKTSSTATIGDAIMSKRSQ* |
Ga0137363_101427994 | 3300012202 | Vadose Zone Soil | RAAVKQVERREIDQYKSTTKSSSTATIGDAIQSKLSAR* |
Ga0137363_101794994 | 3300012202 | Vadose Zone Soil | PESRKIALSYKAAVKQVERQEIAQYRSTTKTSSTATIGDVLKQKLSSR* |
Ga0137363_103185333 | 3300012202 | Vadose Zone Soil | LSYRAAAKQIERKEIEQYRSTSTSKSSSTATIGDALKSKLSAR* |
Ga0137362_102207291 | 3300012205 | Vadose Zone Soil | ISPESRRIGLSYKSAVKQQERQEIGQYRSTSKTSSTATIGDVLKQKLSSR* |
Ga0137362_106097582 | 3300012205 | Vadose Zone Soil | YRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0137380_104739551 | 3300012206 | Vadose Zone Soil | AAVKQIERKEIEQYRSASKSSSTATIGDALKSKLSAR* |
Ga0137380_106849743 | 3300012206 | Vadose Zone Soil | VRQIERKEIEQYRSTSKSSSTATIGDALKSKLSDS* |
Ga0137378_102125601 | 3300012210 | Vadose Zone Soil | GLSYRAAVKQIERKEIEQYRSASKSSSTATIGDALKSKLSAR* |
Ga0137370_109223372 | 3300012285 | Vadose Zone Soil | FKIIKISPESRRIGLSYKSAVKQQERQEIAQYRSTSKTSSTATIGDVLKQNLSSR* |
Ga0137384_115800791 | 3300012357 | Vadose Zone Soil | IALSYKAAVKQVERQEIAQYRSTTKTSSTATIGDVLKQKLSSR* |
Ga0137360_118940442 | 3300012361 | Vadose Zone Soil | ETRRIGLSYRAAAKQIERKEIEQYRSTTKTSSTATIGDALKSKLSAR* |
Ga0137361_102040744 | 3300012362 | Vadose Zone Soil | RAAVKQVERREIEQYKSTSKSSSTATIGDAIQSKLSAR* |
Ga0137358_101511371 | 3300012582 | Vadose Zone Soil | LSYRAAAKQIERREIEQYRTTSKSSSTATIGDAIQSKLSAR* |
Ga0137394_105243181 | 3300012922 | Vadose Zone Soil | RRIGLSYRAAVKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR* |
Ga0137359_103120061 | 3300012923 | Vadose Zone Soil | ALSYKAAVKQVERQEIAQYRSTTKTSSTATIGDVLKQKLSSR* |
Ga0137419_114620871 | 3300012925 | Vadose Zone Soil | QIERKEIDQYRSTASSSKTSSTATLGDVLKSKLAGR* |
Ga0137416_101227631 | 3300012927 | Vadose Zone Soil | RAAVKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR* |
Ga0137416_103382901 | 3300012927 | Vadose Zone Soil | IGLSYRAAVKQVERREIDQYKSSTKSSSTATIGDAIQSKLSAR* |
Ga0137404_116085061 | 3300012929 | Vadose Zone Soil | IGLSYRAAVKQVERREIDRYKSTTKSSSTATIGDAIQSKLSAR* |
Ga0137407_108527543 | 3300012930 | Vadose Zone Soil | SYRAAVKQIERKEIEQYRSTTKSSSTATIGDVMKQKLASR* |
Ga0137407_110970512 | 3300012930 | Vadose Zone Soil | IIKISPESRKIALSYKAAVKQVERQEIAQYRSTTKTSSTATIGDVLKQKLSSR* |
Ga0126369_1000931211 | 3300012971 | Tropical Forest Soil | VKQLERKEIEQYRSASKSSSTATIGDALKSKLQAR* |
Ga0134087_101105593 | 3300012977 | Grasslands Soil | VKQIERKEIEQYRSASKSSSTATIGDALKSKLSAR* |
Ga0181523_101348364 | 3300014165 | Bog | YRAAVRQQERREIEQYKTSKSSATATIGDALKQKLSSR* |
Ga0181531_100234325 | 3300014169 | Bog | AKQIERQEIQQYRSTTKSSSTATIGDVMKSKLSAR* |
Ga0181531_109195771 | 3300014169 | Bog | AKQIERREIEQYRSTTKSSSTATIGDALKQKLASR* |
Ga0181516_106697792 | 3300014655 | Bog | YRAAVKQIERREIDQYKHTTRTSSTATIGDAMRSKLASTK* |
Ga0137405_10850553 | 3300015053 | Vadose Zone Soil | SAVKQQERQEIAQYRSTSKTSSTATIGDVLKQKLSSR* |
Ga0137420_10774301 | 3300015054 | Vadose Zone Soil | KIALSYKAAVKQVERQEIAQYRSTTKTSSTATIGDVLKQKLSSR* |
Ga0137420_11780463 | 3300015054 | Vadose Zone Soil | AVRQIERKEIEQYKSSKSSATATIGDAMKQKLASR* |
Ga0137420_12163201 | 3300015054 | Vadose Zone Soil | RGASAGLSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR* |
Ga0137403_102906644 | 3300015264 | Vadose Zone Soil | KQVERQEIAQYRSTTKTSSTATIGDVLKQKLSSR* |
Ga0181505_107639521 | 3300016750 | Peatland | RRIGLIYRAAARQQERREIEQYKTSKSSATATIGDALKQKLSSR |
Ga0187824_100612793 | 3300017927 | Freshwater Sediment | RRIGLSYKAAVKQQERQEIAQYRSTSKSSSTATIGDALKQKLSSR |
Ga0187825_103616101 | 3300017930 | Freshwater Sediment | AKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0187814_103975972 | 3300017932 | Freshwater Sediment | ETRRIGLSYRAAVKQIERKEIEQYRSTTKSSSTATIGDALKSKLSAR |
Ga0187803_100958113 | 3300017934 | Freshwater Sediment | GLSYRAAVRQQERREIDQYKSSKSSATATIGDAMKQKLASR |
Ga0187777_112212161 | 3300017974 | Tropical Peatland | SQDTRRIGLSYRAAVKQQERREIEQYKSTSRSSSTATIGDAIQSKLQTR |
Ga0187823_102934721 | 3300017993 | Freshwater Sediment | IIKISPESRRIGLSYKAAVKQQERQEIAQYRSTSKSSSTATIGDALKQKLSSR |
Ga0187816_103102751 | 3300017995 | Freshwater Sediment | AVRQQERKEIEQYKSSKSSATATIGDAMKQKLASR |
Ga0187804_104228072 | 3300018006 | Freshwater Sediment | VKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR |
Ga0187862_100927094 | 3300018040 | Peatland | AVRQIERKEIEQYKSTTKSSATATIGDAMKQKLASR |
Ga0187772_101828483 | 3300018085 | Tropical Peatland | IGLSYRAAVRQQERREIDQYKSATRSSATATIGDAMKQKLAHR |
Ga0187771_100981261 | 3300018088 | Tropical Peatland | RAAVRQAERREIEQYRATKTSATATIGDAILSKREPL |
Ga0187771_109099822 | 3300018088 | Tropical Peatland | SYRAAVRQLERREIEQYKSTTKSSATATIGDAMKQKLASR |
Ga0066667_101379594 | 3300018433 | Grasslands Soil | VKQIERKEIEQYRSASKSSSTATIGDALKSKLSAR |
Ga0193754_10147262 | 3300019872 | Soil | GLSYRAAVKQQERREIDQYRSTSTSKSSSTATIGDALKSKLGR |
Ga0193729_10109405 | 3300019887 | Soil | SPETRRIGLSYRAAVKQQERREIDQYRSTSTGKSSSTATIGDALKSKLGR |
Ga0193717_11507352 | 3300020060 | Soil | IERKEIDQYRSTATSSKSSSTATLGDVLKSKLAGR |
Ga0179592_101907961 | 3300020199 | Vadose Zone Soil | AKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR |
Ga0210407_102517673 | 3300020579 | Soil | ALSYKAAVKQVERQEIAQYRSQTKTSSTATIGDALKQKLNSR |
Ga0210399_108063331 | 3300020581 | Soil | SPETRRIGLSYRAAAKQIEGKEIEQYRSTSTSKSSSTATIGDALKSKLSAR |
Ga0210401_113022171 | 3300020583 | Soil | SYRAAAKQIERQEIQQYRSTTKSSSTATIGDVMKSKLSAR |
Ga0210400_107866601 | 3300021170 | Soil | IGLSYRAAAKQIERKEIEQYRSTSTSKSSSTATIGDALKSKLSAR |
Ga0210408_100405461 | 3300021178 | Soil | SYRAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLSAR |
Ga0210408_108722862 | 3300021178 | Soil | TRRIGLSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0210388_100992044 | 3300021181 | Soil | AVRQQERREIEQYKTSKSSSTATIGDALKQKLSSR |
Ga0210388_115273282 | 3300021181 | Soil | RRIGLSYRAAAKQIERREIDQYRATTKSSSTATIGDALKQKLNSR |
Ga0210393_103954991 | 3300021401 | Soil | RIGLSYRAAAKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR |
Ga0210387_118450881 | 3300021405 | Soil | TRRIGLSYRAAAKQIERKEIEQYRSTSTSKSSSTATIGDALKSKLSAR |
Ga0210394_110534972 | 3300021420 | Soil | ETRRIGLSYRAAVKQVERREIDQYKSTTKSSSTATIGDAIQSKLSAR |
Ga0210394_118570882 | 3300021420 | Soil | RAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLTAR |
Ga0210384_109545112 | 3300021432 | Soil | ETRRIGLSYRAAVKQIERKEIEQYRSTTKTSSTATIGDALKSKLSAR |
Ga0210391_115383991 | 3300021433 | Soil | RIGLSYRAATKQIERREIEQYRSTTKSSSTATIGDVMKSKLSTR |
Ga0210392_109311042 | 3300021475 | Soil | TKQIERREIEQYRSTTKSSSTATIGDVMKSKLSAR |
Ga0187846_102238742 | 3300021476 | Biofilm | GLSFRAAVKQMERREIEQYRSASKSSSTATIGDALKSKLSAR |
Ga0187846_103832732 | 3300021476 | Biofilm | YRAAVKQLERREIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0210402_100185467 | 3300021478 | Soil | IGLSYRAAVRQIERKEIEQYKSSKSSATATIGDVMKQKLASR |
Ga0210402_105328923 | 3300021478 | Soil | FKIIKISPESRKIALSYKAAVKQVERQEIAQYRSTTKTSSTATIGDVLKQKLSSR |
Ga0210402_112377052 | 3300021478 | Soil | GLSYRAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLSAR |
Ga0210409_101609991 | 3300021559 | Soil | AVKQLERKEIEQYRSTSKSSATATIGDAIQSKLAGR |
Ga0242660_11456232 | 3300022531 | Soil | YRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0212123_100854494 | 3300022557 | Iron-Sulfur Acid Spring | SDRAAVKQIERREIDQYKSTSTGKSSSTATIGDALKSKLGR |
Ga0242674_10310671 | 3300022711 | Soil | ETRRIGLTYRAAAKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR |
Ga0242675_10534672 | 3300022718 | Soil | RIGLSYRAAAKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0247665_10587892 | 3300024219 | Soil | YKAAAKQQERQEIAQYRSTSKSSSTATIGDALKQKLSSR |
Ga0228598_11208681 | 3300024227 | Rhizosphere | RIGLSYRAAVKQIERREIDQYKQTTKSSSTATLGDVMRAKLASTKP |
Ga0137417_10115711 | 3300024330 | Vadose Zone Soil | LSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0137417_10975491 | 3300024330 | Vadose Zone Soil | AAVKQIERKEIEQYRSTSKSSSTATIGDALKSKRLSFRRVS |
Ga0137417_14145062 | 3300024330 | Vadose Zone Soil | LSYRAAVKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR |
Ga0207685_108467792 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SYRAAVKQVERREIEQYKSTSKSSSTATIGDAIQSKLSAR |
Ga0207654_114240732 | 3300025911 | Corn Rhizosphere | LSYRAAVKQIERKEIEQYRSTTKSSSTATIGDVMKQKLASR |
Ga0207663_108599091 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PETRRIGLSYRAAVKQIERKEIEQYRSTTKSSSTATIGDVMKQKLASR |
Ga0207689_104580952 | 3300025942 | Miscanthus Rhizosphere | AAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR |
Ga0209803_11015723 | 3300026332 | Soil | IGLSYKSAVKQQERQEIAQYRSTSKTSSTATIGDVLKQKLSSR |
Ga0209158_12111841 | 3300026333 | Soil | SYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0257163_10572961 | 3300026359 | Soil | RIGLSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0257181_10064001 | 3300026499 | Soil | LSYRAAVKQIERKEIEQYRSTTKTSSTATIGDALKSKLSAR |
Ga0209056_102620783 | 3300026538 | Soil | IGLSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0209156_101789811 | 3300026547 | Soil | LSYRAAVKQIERKEIEQYRTTSKSSSTATIGDALKSKLSAR |
Ga0179593_12040715 | 3300026555 | Vadose Zone Soil | LIAPRQKQIERQEIQQYRSTTKSSSTATIGDVMKSKLSAR |
Ga0207816_10353052 | 3300026934 | Tropical Forest Soil | SYRAAVRQQERKEIEQYKSSRSSATATIGDAMKQKLASR |
Ga0207817_10205771 | 3300026979 | Tropical Forest Soil | RRIGLSYRAAVRQQERKEIEQYKSSRSSATATIGDAMKQKLASR |
Ga0207815_10255681 | 3300027014 | Tropical Forest Soil | VRQLERKEIDQYKSTAKSSSTATIGDAMKQKLASR |
Ga0207855_10229091 | 3300027039 | Tropical Forest Soil | YRAAVRQQERKEIEQYKSSRSSATATIGDAMKQKLASR |
Ga0209731_10018334 | 3300027326 | Forest Soil | AAVRQQERKEIEQYKSSKSSATATIGDAMKQKLASR |
Ga0209527_11495462 | 3300027583 | Forest Soil | TRRIGLSYRAAAKQIERREIEQYRSTTKSSSTATIGDMMKSKLSAR |
Ga0209331_10317264 | 3300027603 | Forest Soil | YRAAVKQVERREIEQYKSTSKSSSTATIGDAIQSKLSAR |
Ga0209329_11008732 | 3300027605 | Forest Soil | AAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0209422_11058542 | 3300027629 | Forest Soil | RRIGLSYRAAVKQIERREIDQYKSTSTGKSSSTATIGDALKSKLGR |
Ga0209076_10042261 | 3300027643 | Vadose Zone Soil | LSYRAAVRQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0209217_11246552 | 3300027651 | Forest Soil | KQIERKEIEQYRSTSKTTSSATATIGDMMKSKLTNR |
Ga0209118_11661931 | 3300027674 | Forest Soil | IGLSYRAAVKQQERREIDQYKSTSTGKSSSTATIGDALKSKLGR |
Ga0209626_10214454 | 3300027684 | Forest Soil | ISPETRRIGLSYRAAVKQIERREIDQYKSTSTGKSSSTATIGDALKSKLGR |
Ga0209447_100546802 | 3300027701 | Bog Forest Soil | AVKQIERREIDQYKQTTKTSSTATLGDVMRAKLASTKS |
Ga0209328_100654101 | 3300027727 | Forest Soil | RIGLSYRAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLSAR |
Ga0209038_100185451 | 3300027737 | Bog Forest Soil | VKQIERREIDQYRQTTKTSSTATLGDVMRAKLASTKS |
Ga0209655_100851921 | 3300027767 | Bog Forest Soil | IGLSYRAAVKQIERREIDQYKQTTKSSSTATLGDVMRAKLASTKP |
Ga0209772_100385781 | 3300027768 | Bog Forest Soil | AAKQIERKEIEQYRSTSTSKSSSTATIGDALKSKLSAR |
Ga0209772_100493393 | 3300027768 | Bog Forest Soil | PETRRIGLSYRAAVKQIERREIDQYKQTTKTSSTATLGDVMRAKLASTKS |
Ga0209180_100099508 | 3300027846 | Vadose Zone Soil | AAVKQQERREIEQYRTTSKSSSTATIGDAIQSKLAGR |
Ga0209180_100641154 | 3300027846 | Vadose Zone Soil | LSYRAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLSAR |
Ga0209274_100969234 | 3300027853 | Soil | YRAAAKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0209701_100438621 | 3300027862 | Vadose Zone Soil | YRAAAKQIERKEIEQYRSTSTSKSSSTATIGDALKSKLSAR |
Ga0209283_100598121 | 3300027875 | Vadose Zone Soil | AVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0209283_106746812 | 3300027875 | Vadose Zone Soil | RRIGLSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0209488_107252951 | 3300027903 | Vadose Zone Soil | DTRRIGLSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0209698_107849822 | 3300027911 | Watersheds | YRAAAKQIERREIEQYRTTSKSSSTATIGDAIQSKLSVR |
Ga0209168_100397305 | 3300027986 | Surface Soil | TRRIGLSYRAAAKQIERKEIEQYRSTSKTSSTATIGDALKSKLSAR |
Ga0255358_10338402 | 3300028069 | Soil | IGLSYRAAVRQIERKEIEQYKSTKSSATATIGDAMKQKLASR |
Ga0247663_10417993 | 3300028145 | Soil | AAVKQVERQEIAQYRSATKTSSTATIGDALKQKLSSR |
Ga0257175_10998061 | 3300028673 | Soil | AAVRQIERKEIEQYKSSKSSATATIGDAMKQKLASR |
Ga0222749_100963893 | 3300029636 | Soil | DFNIIKISPETRRIGLSYLAAVKQIERKEIEQYRSTSTSKSSSTATIGDALKSKLSAR |
Ga0222749_107310492 | 3300029636 | Soil | ETRRIGLSYRAAVKQQERREIDQYKSASTGKSSSTATIGDALKSKLGR |
Ga0311352_100699241 | 3300029944 | Palsa | IGLSYRAAVKQIERREIDQYKQTTRTSSTATIGDAMRSKLASTK |
Ga0170834_1013264831 | 3300031057 | Forest Soil | TRRIGLSFRAAVKQIERKEIEQYKSTTKSSSTATIGDAIQSKLSAR |
Ga0170834_1059007212 | 3300031057 | Forest Soil | GLSYRAAVRQIERKEIEQYKSSKSSATATIGDVMKQKLASR |
Ga0170824_1125294143 | 3300031231 | Forest Soil | YKAAVKQVERQEIAQYRSQTKSSSTATIGDALKQKLNSR |
Ga0170824_1288920672 | 3300031231 | Forest Soil | KISPESRKIALSYKAAVKQVERQEIAQYRSTTKTSSTATIGDVLKQKLSSR |
Ga0170820_102348361 | 3300031446 | Forest Soil | KQIERKEIEQYRSTTKTSSTATIGDALKQKLAGLK |
Ga0318571_102747991 | 3300031549 | Soil | ISPESRRIGLSYKAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR |
Ga0318493_105000731 | 3300031723 | Soil | SYRAAVRQQERKEIEQYKSSKSSATATIGDAMKQKLASR |
Ga0318502_101727983 | 3300031747 | Soil | LSYKAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR |
Ga0318535_101335921 | 3300031764 | Soil | GLSYRAAVRQQERKEIEQYKSSKSSATATIGDAMKQKLASR |
Ga0318546_109104102 | 3300031771 | Soil | GLSYRAAVKQLERKEIEQYRSSSKSSSTATIGDALKSKLSAR |
Ga0318508_10641491 | 3300031780 | Soil | YRAAVKQLERKEIEQYRSSSKSSSTATIGDALKSKLSAR |
Ga0307473_112322132 | 3300031820 | Hardwood Forest Soil | TRRIGLSYRAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLSAR |
Ga0307478_111511472 | 3300031823 | Hardwood Forest Soil | RAAVKQLERREIEQYRSTSKSSATATIGDAIQSKLAGR |
Ga0318551_105831362 | 3300031896 | Soil | FKIIKISPESRRIGLSYKAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR |
Ga0306921_110014433 | 3300031912 | Soil | AAVKQQERKEIEQYRTSKSSATATIGDALKQKLASRG |
Ga0306921_123372221 | 3300031912 | Soil | LSYRAAVRQQERKEIEQYKSAKSSATATIGDALKQKLASR |
Ga0307479_101174734 | 3300031962 | Hardwood Forest Soil | GLSYRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0307479_102059381 | 3300031962 | Hardwood Forest Soil | VKQVERREIEQYKSTTKSSSTATIGDAIQSKLTAR |
Ga0307479_108868022 | 3300031962 | Hardwood Forest Soil | AVKQQERREIDQYKSASTGKSSSTATIGDALKSKLGR |
Ga0307479_113596102 | 3300031962 | Hardwood Forest Soil | RRIGLSYRAAVKQVERREIEQYKSTSKSSSTATIGDAIQSKLSAR |
Ga0318575_103580941 | 3300032055 | Soil | YRAAVRQLERREIEQYKSSKSSATATIGDAMKQKLASR |
Ga0318533_112628022 | 3300032059 | Soil | AVKQLERKEIEQYRSASKSSSTATIGDALKSKLQTR |
Ga0318533_114000772 | 3300032059 | Soil | GLSYRAAVRQQERREIEQYKTSKTSATATIGDALKQKLSSR |
Ga0318518_104602082 | 3300032090 | Soil | SYKAAVKQQERQEIAQYRSTSRSSATATIGDALKQKLSSR |
Ga0318540_106593062 | 3300032094 | Soil | KAAVKQQERQEIAQYRSTSKSSATATIGDALKQKLSSR |
Ga0307470_112277131 | 3300032174 | Hardwood Forest Soil | RAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLSAR |
Ga0307470_115323842 | 3300032174 | Hardwood Forest Soil | KISPETRRIGLSFRAAVKQIERKEIEQYKSTTKSSSTATIGDAIQSKLSAR |
Ga0307470_115814401 | 3300032174 | Hardwood Forest Soil | GLSYRAAVKQIERKEIEQYRSTSKSSSTATNGDALKSKLQAR |
Ga0307471_1005687993 | 3300032180 | Hardwood Forest Soil | LSYRAAVKQVERREIEQYKSTTKSSSTATIGDAIQSKLTAR |
Ga0307471_1006595711 | 3300032180 | Hardwood Forest Soil | KISPETRRIGLSFRAAVKQIERKEIEQYRSTSKSSSTATIGDALKSKLSAR |
Ga0307472_1014225931 | 3300032205 | Hardwood Forest Soil | KIALSYKAAVKQVERQEIAQYRSTTKTSSTATIGDVLKQKLSSR |
Ga0306920_1022443041 | 3300032261 | Soil | SYRAAVKQLERKEIEQYRSASKSSSTATIGDALKSKLQTR |
Ga0335082_108948792 | 3300032782 | Soil | AAVKQVERREIEQYRSNKSAATATIGDALKQKLASRS |
Ga0335082_111107811 | 3300032782 | Soil | SYRAAVRQQERREIEQYKSSKSSATATIGDAMKQKLASR |
Ga0335082_114330071 | 3300032782 | Soil | SFKAAAKQQERQEIAQYSRASKSSSTATIGDAIQSKLSRSNS |
Ga0335073_108405573 | 3300033134 | Soil | YRAAVRQQERREIEQYKTSKSSATATIGDALKQKLSSR |
⦗Top⦘ |