Basic Information | |
---|---|
Family ID | F017404 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 241 |
Average Sequence Length | 43 residues |
Representative Sequence | MLALKYLLMILGAGLFGSAGALVAYDIFLSEQLRRLLS |
Number of Associated Samples | 182 |
Number of Associated Scaffolds | 241 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 95.20 % |
% of genes near scaffold ends (potentially truncated) | 91.29 % |
% of genes from short scaffolds (< 2000 bps) | 80.50 % |
Associated GOLD sequencing projects | 163 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.934 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.481 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.556 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.452 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 241 Family Scaffolds |
---|---|---|
PF02163 | Peptidase_M50 | 10.79 |
PF00067 | p450 | 3.73 |
PF08241 | Methyltransf_11 | 2.07 |
PF00248 | Aldo_ket_red | 1.66 |
PF13473 | Cupredoxin_1 | 1.66 |
PF00903 | Glyoxalase | 1.66 |
PF00496 | SBP_bac_5 | 1.24 |
PF13398 | Peptidase_M50B | 1.24 |
PF13435 | Cytochrome_C554 | 0.83 |
PF04255 | DUF433 | 0.41 |
PF13510 | Fer2_4 | 0.41 |
PF00588 | SpoU_methylase | 0.41 |
PF01904 | DUF72 | 0.41 |
PF00290 | Trp_syntA | 0.41 |
PF07676 | PD40 | 0.41 |
PF01841 | Transglut_core | 0.41 |
PF13649 | Methyltransf_25 | 0.41 |
PF12704 | MacB_PCD | 0.41 |
COG ID | Name | Functional Category | % Frequency in 241 Family Scaffolds |
---|---|---|---|
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 3.73 |
COG0159 | Tryptophan synthase alpha chain | Amino acid transport and metabolism [E] | 0.41 |
COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.41 |
COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.41 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.41 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.41 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.93 % |
Unclassified | root | N/A | 24.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100697158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101573644 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300002909|JGI25388J43891_1053820 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300002912|JGI25386J43895_10125419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300002912|JGI25386J43895_10127227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300003367|JGI26338J50219_1017131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300004091|Ga0062387_100960367 | Not Available | 652 | Open in IMG/M |
3300004092|Ga0062389_100936014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1050 | Open in IMG/M |
3300004152|Ga0062386_101174505 | Not Available | 638 | Open in IMG/M |
3300005174|Ga0066680_10839850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300005177|Ga0066690_10032744 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
3300005332|Ga0066388_104431864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300005436|Ga0070713_100893534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 854 | Open in IMG/M |
3300005437|Ga0070710_10816431 | Not Available | 667 | Open in IMG/M |
3300005445|Ga0070708_100194990 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
3300005446|Ga0066686_10302182 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300005471|Ga0070698_101907214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300005533|Ga0070734_10036431 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
3300005542|Ga0070732_10001568 | All Organisms → cellular organisms → Bacteria | 12476 | Open in IMG/M |
3300005542|Ga0070732_10356187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300005542|Ga0070732_10706266 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300005556|Ga0066707_10837555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300005557|Ga0066704_10054383 | All Organisms → cellular organisms → Bacteria | 2537 | Open in IMG/M |
3300005560|Ga0066670_10176273 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300005560|Ga0066670_10475763 | Not Available | 769 | Open in IMG/M |
3300005563|Ga0068855_100661102 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300005574|Ga0066694_10207671 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300005591|Ga0070761_10105332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1629 | Open in IMG/M |
3300005591|Ga0070761_10176835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
3300005598|Ga0066706_10752227 | Not Available | 772 | Open in IMG/M |
3300005602|Ga0070762_11169953 | Not Available | 531 | Open in IMG/M |
3300006031|Ga0066651_10348869 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300006057|Ga0075026_100254904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
3300006163|Ga0070715_10889749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300006173|Ga0070716_101130632 | Not Available | 626 | Open in IMG/M |
3300006176|Ga0070765_101495333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300006797|Ga0066659_10168217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1575 | Open in IMG/M |
3300006904|Ga0075424_101774246 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300006914|Ga0075436_100857741 | Not Available | 678 | Open in IMG/M |
3300006954|Ga0079219_10086223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1494 | Open in IMG/M |
3300006954|Ga0079219_11133855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300007076|Ga0075435_101826456 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300007265|Ga0099794_10154507 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300007265|Ga0099794_10210682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
3300007265|Ga0099794_10218995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
3300007788|Ga0099795_10003730 | All Organisms → cellular organisms → Bacteria | 3819 | Open in IMG/M |
3300009012|Ga0066710_101613112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 993 | Open in IMG/M |
3300009038|Ga0099829_10068025 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
3300009038|Ga0099829_11369140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300009038|Ga0099829_11755433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300009088|Ga0099830_10108904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2080 | Open in IMG/M |
3300009088|Ga0099830_11101635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300010046|Ga0126384_10229015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1489 | Open in IMG/M |
3300010047|Ga0126382_10962555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
3300010048|Ga0126373_10660216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
3300010358|Ga0126370_10644109 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300010358|Ga0126370_11128471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300010358|Ga0126370_12163619 | Not Available | 547 | Open in IMG/M |
3300010358|Ga0126370_12664526 | Not Available | 501 | Open in IMG/M |
3300010359|Ga0126376_11330053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300010360|Ga0126372_12490791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300010361|Ga0126378_10863099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
3300010362|Ga0126377_10228951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1798 | Open in IMG/M |
3300010362|Ga0126377_10464087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
3300010376|Ga0126381_103027611 | Not Available | 667 | Open in IMG/M |
3300010376|Ga0126381_103379492 | Not Available | 628 | Open in IMG/M |
3300010376|Ga0126381_104613497 | Not Available | 531 | Open in IMG/M |
3300011269|Ga0137392_10187155 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
3300011269|Ga0137392_11130212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300011269|Ga0137392_11326510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300011270|Ga0137391_10055846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3372 | Open in IMG/M |
3300011271|Ga0137393_10595341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 948 | Open in IMG/M |
3300011271|Ga0137393_11381168 | Not Available | 593 | Open in IMG/M |
3300012096|Ga0137389_11314649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300012189|Ga0137388_10028935 | All Organisms → cellular organisms → Bacteria | 4289 | Open in IMG/M |
3300012199|Ga0137383_10013358 | All Organisms → cellular organisms → Bacteria | 5560 | Open in IMG/M |
3300012199|Ga0137383_10405286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
3300012202|Ga0137363_11153858 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300012203|Ga0137399_10008464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5985 | Open in IMG/M |
3300012205|Ga0137362_10098041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2465 | Open in IMG/M |
3300012205|Ga0137362_10727699 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300012206|Ga0137380_10791540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 819 | Open in IMG/M |
3300012209|Ga0137379_10127317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2448 | Open in IMG/M |
3300012351|Ga0137386_10857620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300012361|Ga0137360_10005703 | All Organisms → cellular organisms → Bacteria | 7639 | Open in IMG/M |
3300012362|Ga0137361_11037279 | Not Available | 740 | Open in IMG/M |
3300012363|Ga0137390_10821243 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300012409|Ga0134045_1294357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300012917|Ga0137395_10997293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300012918|Ga0137396_10193496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1494 | Open in IMG/M |
3300012918|Ga0137396_10468286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
3300012922|Ga0137394_10870514 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300012923|Ga0137359_10606239 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300012924|Ga0137413_10168106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1449 | Open in IMG/M |
3300012927|Ga0137416_11894722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300012929|Ga0137404_10241693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1546 | Open in IMG/M |
3300012930|Ga0137407_10338081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1384 | Open in IMG/M |
3300012930|Ga0137407_11135128 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300012931|Ga0153915_11723008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 733 | Open in IMG/M |
3300012948|Ga0126375_10555109 | Not Available | 868 | Open in IMG/M |
3300012948|Ga0126375_11727609 | Not Available | 544 | Open in IMG/M |
3300013296|Ga0157374_10643348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
3300015054|Ga0137420_1310730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7038 | Open in IMG/M |
3300015054|Ga0137420_1343649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2658 | Open in IMG/M |
3300015082|Ga0167662_1014191 | Not Available | 998 | Open in IMG/M |
3300015242|Ga0137412_10233547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
3300015264|Ga0137403_10053895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4137 | Open in IMG/M |
3300015264|Ga0137403_10989134 | Not Available | 688 | Open in IMG/M |
3300015373|Ga0132257_100247991 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
3300016371|Ga0182034_10617196 | Not Available | 916 | Open in IMG/M |
3300016445|Ga0182038_12116583 | Not Available | 510 | Open in IMG/M |
3300017656|Ga0134112_10056273 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
3300017927|Ga0187824_10194020 | Not Available | 688 | Open in IMG/M |
3300019789|Ga0137408_1147959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
3300019887|Ga0193729_1281201 | Not Available | 505 | Open in IMG/M |
3300020021|Ga0193726_1364856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300020034|Ga0193753_10153487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
3300020199|Ga0179592_10021756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2860 | Open in IMG/M |
3300020199|Ga0179592_10222248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 853 | Open in IMG/M |
3300020579|Ga0210407_10216141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1491 | Open in IMG/M |
3300020580|Ga0210403_10110503 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
3300020581|Ga0210399_10003742 | All Organisms → cellular organisms → Bacteria | 11853 | Open in IMG/M |
3300020581|Ga0210399_10376236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1185 | Open in IMG/M |
3300020581|Ga0210399_11166963 | Not Available | 613 | Open in IMG/M |
3300020583|Ga0210401_10872271 | Not Available | 759 | Open in IMG/M |
3300021046|Ga0215015_10299633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300021086|Ga0179596_10022363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2318 | Open in IMG/M |
3300021088|Ga0210404_10054346 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
3300021171|Ga0210405_10789878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300021178|Ga0210408_10092988 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
3300021178|Ga0210408_11361639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300021181|Ga0210388_10341265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
3300021401|Ga0210393_10573757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
3300021404|Ga0210389_10798996 | Not Available | 737 | Open in IMG/M |
3300021406|Ga0210386_10199560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1693 | Open in IMG/M |
3300021407|Ga0210383_10234599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1573 | Open in IMG/M |
3300021432|Ga0210384_11626672 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300021433|Ga0210391_10173764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1695 | Open in IMG/M |
3300021433|Ga0210391_10200600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1569 | Open in IMG/M |
3300021477|Ga0210398_10964375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300021478|Ga0210402_10014953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6634 | Open in IMG/M |
3300021478|Ga0210402_11937806 | Not Available | 515 | Open in IMG/M |
3300021479|Ga0210410_11168495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300021479|Ga0210410_11786831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300021559|Ga0210409_10031233 | All Organisms → cellular organisms → Bacteria | 5119 | Open in IMG/M |
3300021559|Ga0210409_10221367 | Not Available | 1719 | Open in IMG/M |
3300021559|Ga0210409_10415079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1203 | Open in IMG/M |
3300021559|Ga0210409_11345098 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300021861|Ga0213853_11422044 | Not Available | 581 | Open in IMG/M |
3300024179|Ga0247695_1015031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1085 | Open in IMG/M |
3300024222|Ga0247691_1043098 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300024323|Ga0247666_1097087 | Not Available | 586 | Open in IMG/M |
3300024325|Ga0247678_1061172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300025320|Ga0209171_10067236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2304 | Open in IMG/M |
3300025905|Ga0207685_10034572 | Not Available | 1837 | Open in IMG/M |
3300025910|Ga0207684_10631890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
3300025949|Ga0207667_11838843 | Not Available | 569 | Open in IMG/M |
3300026296|Ga0209235_1177843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
3300026298|Ga0209236_1059627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1860 | Open in IMG/M |
3300026305|Ga0209688_1074419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300026314|Ga0209268_1005478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5576 | Open in IMG/M |
3300026314|Ga0209268_1012029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3430 | Open in IMG/M |
3300026318|Ga0209471_1244975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300026324|Ga0209470_1241460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300026328|Ga0209802_1220798 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300026328|Ga0209802_1325335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300026333|Ga0209158_1197412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
3300026359|Ga0257163_1014121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
3300026482|Ga0257172_1043931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
3300026498|Ga0257156_1090448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300026532|Ga0209160_1301300 | Not Available | 545 | Open in IMG/M |
3300026532|Ga0209160_1320635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300026548|Ga0209161_10007147 | All Organisms → cellular organisms → Bacteria | 8671 | Open in IMG/M |
3300026551|Ga0209648_10831037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300026557|Ga0179587_10329559 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300027297|Ga0208241_1069420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300027521|Ga0209524_1125982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300027567|Ga0209115_1111014 | Not Available | 621 | Open in IMG/M |
3300027635|Ga0209625_1110067 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300027671|Ga0209588_1043986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1444 | Open in IMG/M |
3300027725|Ga0209178_1120848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
3300027773|Ga0209810_1022919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3987 | Open in IMG/M |
3300027775|Ga0209177_10046845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
3300027842|Ga0209580_10063583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1742 | Open in IMG/M |
3300027846|Ga0209180_10171652 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300027846|Ga0209180_10550483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300027846|Ga0209180_10691570 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300027862|Ga0209701_10091316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1910 | Open in IMG/M |
3300027862|Ga0209701_10377967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
3300027862|Ga0209701_10539623 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300027874|Ga0209465_10247413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
3300027884|Ga0209275_10172327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
3300027911|Ga0209698_10767819 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300029636|Ga0222749_10248284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
3300030974|Ga0075371_11659316 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300031057|Ga0170834_100974266 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300031122|Ga0170822_17123753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300031128|Ga0170823_14714247 | Not Available | 588 | Open in IMG/M |
3300031231|Ga0170824_100998677 | Not Available | 510 | Open in IMG/M |
3300031231|Ga0170824_115640399 | Not Available | 698 | Open in IMG/M |
3300031231|Ga0170824_116813539 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300031231|Ga0170824_117462101 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300031231|Ga0170824_127959763 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300031573|Ga0310915_10062751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2428 | Open in IMG/M |
3300031640|Ga0318555_10413856 | Not Available | 730 | Open in IMG/M |
3300031679|Ga0318561_10139562 | Not Available | 1297 | Open in IMG/M |
3300031682|Ga0318560_10693306 | Not Available | 551 | Open in IMG/M |
3300031718|Ga0307474_10176324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1621 | Open in IMG/M |
3300031718|Ga0307474_10704772 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300031720|Ga0307469_10282536 | Not Available | 1356 | Open in IMG/M |
3300031747|Ga0318502_10228319 | Not Available | 1082 | Open in IMG/M |
3300031764|Ga0318535_10231463 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300031805|Ga0318497_10403948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300031820|Ga0307473_11243606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300031823|Ga0307478_11095007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
3300031890|Ga0306925_10036869 | All Organisms → cellular organisms → Bacteria | 5031 | Open in IMG/M |
3300031890|Ga0306925_11961265 | Not Available | 554 | Open in IMG/M |
3300031942|Ga0310916_11145200 | Not Available | 645 | Open in IMG/M |
3300031946|Ga0310910_10066333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2592 | Open in IMG/M |
3300031962|Ga0307479_10007130 | All Organisms → cellular organisms → Bacteria | 10303 | Open in IMG/M |
3300031962|Ga0307479_10083527 | All Organisms → cellular organisms → Bacteria | 3091 | Open in IMG/M |
3300031962|Ga0307479_10585498 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300031962|Ga0307479_11734187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300032042|Ga0318545_10143712 | Not Available | 846 | Open in IMG/M |
3300032076|Ga0306924_10371265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1639 | Open in IMG/M |
3300032089|Ga0318525_10153288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1183 | Open in IMG/M |
3300032205|Ga0307472_100402184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
3300032898|Ga0335072_10859312 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300033158|Ga0335077_11480334 | Not Available | 651 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.13% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.05% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.15% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.73% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.73% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.32% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.90% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.49% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.07% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.66% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.66% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.24% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.24% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.41% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.41% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.41% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.41% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.41% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300003367 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1006971582 | 3300002245 | Forest Soil | MLALKYLLMLLGAGLFGSAGAVVVYDVYVSEQLRRL |
JGIcombinedJ26739_1015736441 | 3300002245 | Forest Soil | MLLLKYLLIILGIGLFGSSGALLAYDIYLSSQLRRF |
JGI25388J43891_10538202 | 3300002909 | Grasslands Soil | MLALKYLLMILGAGLFGSAGALVAYDIFLSEQLRRLLSRGKTEECGAEVG |
JGI25386J43895_101254191 | 3300002912 | Grasslands Soil | MLALKYFLMLLGAVVFGSAGALVAYDIYLSEQLRRLLSRNK |
JGI25386J43895_101272271 | 3300002912 | Grasslands Soil | MLALKYFLMLXGAXXFGSAGALVAYDIYLSEQLRRLLSRNKTDESGADLKS |
JGI26338J50219_10171311 | 3300003367 | Bog Forest Soil | MLALKYLLMILGVGLFGSSGALVIYDIYIAEQLRRLLARN |
Ga0062387_1009603672 | 3300004091 | Bog Forest Soil | MSCREKCAMLMLKYLVMIAGLALFGSAAALVGYDIFLSAQ |
Ga0062389_1009360141 | 3300004092 | Bog Forest Soil | MLVLKYLLILLGAVLFGGAGILVAYDIYLSEQLRRLLSGN |
Ga0062386_1011745051 | 3300004152 | Bog Forest Soil | MVALKYLLMLVGTGLLTSAAGLVAYDIYLSEELRRLLARGRTEEAGAGSLARRGA |
Ga0066680_108398501 | 3300005174 | Soil | MLALKYFLMLVGAGLFGSAGALVAYDIYLSEQLLRLLSRNK |
Ga0066690_100327441 | 3300005177 | Soil | MVALKWLLMIVGAGLFGSAGALVAYDVYLSEQLRRLLSRNKTD |
Ga0066388_1044318641 | 3300005332 | Tropical Forest Soil | MLVLKYLLMILGAGLFGSAAALVVYDIFLSEQLRRLLGRCAEP |
Ga0070713_1008935343 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVGAAAFGSAGALVAYDVYLSEQLRQLLSRNKTDESGADLRSRVERN |
Ga0070710_108164311 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MIALKWLLVIAGIGLFGSSAALVVYDVYVAEQLRRLLRRQREESTTAGVGSGALGGGPLLPSR |
Ga0070708_1001949902 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIALKYLLVVLGIGLFGSAAALVAYDVYISSQLQRLLRRSSEEGAAGTGATFL |
Ga0066686_103021823 | 3300005446 | Soil | MLALKYFLMLLGAAVFGSAGALVAYDIYLSEQLRRLLSRNKTDESGADLKS |
Ga0070698_1019072142 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVALRWLLMLVGAGVFGSAGALVAYDIYLSEQLRRLLSRNRTDESGADL |
Ga0070741_107629162 | 3300005529 | Surface Soil | MLALRILLIVAGLVLLGSTTALIAYDIYLSSQLRRLLRKH* |
Ga0070739_100213556 | 3300005532 | Surface Soil | MLALRILLIVAGLVLLGSTTALMAYDIYLSSQLRRLLRKH* |
Ga0070734_100364314 | 3300005533 | Surface Soil | MVALKWLLAILGLGLFGSAGALVVYDIYIASQLRRLLSRG |
Ga0070732_100015681 | 3300005542 | Surface Soil | MPALRYLLMILGLGLFGSASALAAYDIFLATQLRRLLH |
Ga0070732_103561871 | 3300005542 | Surface Soil | MLLLKYLLVILGLVLFGSSGSLVVYDIYLSSQLRRLL |
Ga0070732_107062663 | 3300005542 | Surface Soil | MLALKTLLVVLGIVLFGSSGALVAYDIFLSSQLRRLLAR |
Ga0066707_108375551 | 3300005556 | Soil | MTILRYLLMALSLALFGSAGVLVAYDVYLAAQLRRLLR |
Ga0066704_100543831 | 3300005557 | Soil | MIALKYLLVILGIGLFGSAGALVVYDVYVSSQLRRLLRR |
Ga0066670_101762733 | 3300005560 | Soil | MLALKWLLMLVGAGLFGSAGALVAYDIFLSEQLRRLLSPGKR |
Ga0066670_104757631 | 3300005560 | Soil | MNVLKLLLVILGIGLFGSAGALVVYDVVVAAQLRR |
Ga0068855_1006611021 | 3300005563 | Corn Rhizosphere | MLVLKYLLMLAGAGLFTSAAAIVLYDIYLASQLRRLL |
Ga0066694_102076713 | 3300005574 | Soil | MVVLRYVLMILGLGLFGSAGALAAYDIFLAAQLRRLLHG |
Ga0070761_101053321 | 3300005591 | Soil | MLALKYLLMILGVGLFGSAGSLVVYDIYISEQLRRLLA |
Ga0070761_101768351 | 3300005591 | Soil | MLVLKYLLMILGVGLFGSAATLVTYDIYLSAQLRRLLRRG |
Ga0066706_107522271 | 3300005598 | Soil | MLVLKYLLMLAGAGLFTSAAAIVLYDIYLASQLRRLLGGSTPGA |
Ga0070762_111699531 | 3300005602 | Soil | MLVLKYLVMFLGAGLFGSAAALVGYDIFLSAQLRRL |
Ga0066903_1044547511 | 3300005764 | Tropical Forest Soil | MVALKWLLVIAGIGLFGSAGALVVYDVYISSQLRRLLRRSRELASGEAGTASGSTSFL |
Ga0066651_103488691 | 3300006031 | Soil | MIALKYLLAILGIGLFGSAGALVVYDVYVSSQLRRLL |
Ga0075026_1002549041 | 3300006057 | Watersheds | MLVLRWFLMILGVSLFGSAGALVAYDIYLSSQLRRLLHRRATIKY |
Ga0070715_108897493 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MIALKYLLVILGIGLFGSAGALVVYDVYVSSQLRRLLRRSSQ |
Ga0070716_1011306322 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIALKYLLAILGIALFGSAGALVVYDVYVSSQLRRLLRRS |
Ga0070712_1000734801 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIALKYLLVILGIGLFGSAGALVIYDVYISSQLRRLLRRSREEAAGGAGAATLL |
Ga0070765_1014953331 | 3300006176 | Soil | MLALKWLLMILGAGLFGSAGALVAYDIFLSEQLRRLLSRGKTDESGAEV |
Ga0066659_101682171 | 3300006797 | Soil | MLALKYLLMILGAGLFGSAGALVAYDIFLSAQLRRLLR |
Ga0075424_1017742461 | 3300006904 | Populus Rhizosphere | MVALKWLLVILGLGLFGSAGALVAYDVYVASQLRRLLK |
Ga0075436_1008577411 | 3300006914 | Populus Rhizosphere | MVALKWLLVILGLGLFGSAGALVVYDVYVASQLRRLLKRKSEEEGG |
Ga0079219_100862231 | 3300006954 | Agricultural Soil | MLALKYFLMILGVGLFGSAGALAAYDVFLATQLRRLLRG |
Ga0079219_111338552 | 3300006954 | Agricultural Soil | MLALKYLLMILGVGLFGSAGALVAYDILLATQLRRLL |
Ga0075435_1018264561 | 3300007076 | Populus Rhizosphere | MVALKWLLVILGIGLFGSAGALVVYDVYVSSQLRRLLRRSRELE |
Ga0099794_101545071 | 3300007265 | Vadose Zone Soil | MAALKWLLMLGGAALFGSAGALVAYDIYLSEQLRRLLSRNQTDESGADLKVRATQKPPRHRFT |
Ga0099794_102008652 | 3300007265 | Vadose Zone Soil | MLALKYLLMILGVGLFGSSGILVAYDIYIAARLRWLLGQGE* |
Ga0099794_102106823 | 3300007265 | Vadose Zone Soil | MLALKYLLMILGVGLFSSSGILVAYDIYIAARLRWLLGGDRRRSA* |
Ga0099794_102189952 | 3300007265 | Vadose Zone Soil | MLALKYLLMILGFGLFGSAGALVVYDIFLSAQLRKLLRRNTTEETATKRICTA* |
Ga0099795_100037301 | 3300007788 | Vadose Zone Soil | MKERITTMIALKYLLIILGIGLFGSAGALVVYDVYVSS |
Ga0066710_1016131121 | 3300009012 | Grasslands Soil | MSALKWLLMLLGAAVFGSAGALVAYDVYLSEQLRRLLSRNKTD |
Ga0099829_100680255 | 3300009038 | Vadose Zone Soil | MQTLKYLLMILGAGLFGSAGALVAYDIFLSEQLRRLL |
Ga0099829_113691402 | 3300009038 | Vadose Zone Soil | MLALKYLLMILGAGLFGSAGALVAYDIFLSEQLRRLLS |
Ga0099829_117554332 | 3300009038 | Vadose Zone Soil | MLALKWLLMILGAGLFGSAGALVAYDIFLSEQLRRLLSWN |
Ga0099830_101089041 | 3300009088 | Vadose Zone Soil | MVALKYLIAALGIGIFGSATALAVYDAYLAARLRRLLRRTPRAFAR* |
Ga0099830_111016351 | 3300009088 | Vadose Zone Soil | MLALKWLLMLVGAGLFGSAGALVAYDIYLAEQLRRLLSRNKTDQAGAEV |
Ga0126384_102290154 | 3300010046 | Tropical Forest Soil | MAALKWLLAILGLLLFGSAGALVVYDVYVASQLRRLLK |
Ga0126382_109625553 | 3300010047 | Tropical Forest Soil | MLKYLLMILGLGLFGSASALAAYDIFLATQLRRLLH |
Ga0126373_106602163 | 3300010048 | Tropical Forest Soil | MLVLKYLLMILGAGLFGSAAALVVYDIFLSEQLRRLLG |
Ga0126370_106441091 | 3300010358 | Tropical Forest Soil | MAVLKWLLGILGLVLFGSAGALVAYDVYVASELRRLLKRKSEGGARGIASQPA |
Ga0126370_111284711 | 3300010358 | Tropical Forest Soil | MEGSNSMLALKYLLMILGVGLFGSAGTLVAYDVFLATQLRRLLRGRA |
Ga0126370_121636192 | 3300010358 | Tropical Forest Soil | MVVLKLVLVILGIGLFGSAGALVVYDVVVAAQLRRLLRRS |
Ga0126370_126645262 | 3300010358 | Tropical Forest Soil | MVALKWLLVILGIGLFGSAGALVVYDVYVASQLRRLLKRKSEEEGGVG |
Ga0126376_113300531 | 3300010359 | Tropical Forest Soil | MLALKYLLIILGVGLYGSAGALVAYDMFLAAQLRRLLRGSATGDSST |
Ga0126372_124907911 | 3300010360 | Tropical Forest Soil | MLALKYLLMILGVGLFGSAAALVAYDVFLATQLRRLLR |
Ga0126378_108630991 | 3300010361 | Tropical Forest Soil | MLVLKYLLMILGAGLFGSAAALVVYDIFLSEQLRR |
Ga0126377_102289514 | 3300010362 | Tropical Forest Soil | MLVLKYLLLFVGAGLFTGAAAVVIYDILVASQLRRLLGRT |
Ga0126377_104640871 | 3300010362 | Tropical Forest Soil | MIALKWLLIILGIGLFGSAGALVAYDVYLRSQLRRLLMRSAEAGEGGVAGTIDL |
Ga0126381_1030276111 | 3300010376 | Tropical Forest Soil | MVALKWLLVILGIGLFGSAGALVVYDVYVASQLRRLLKSEAEGG |
Ga0126381_1033794921 | 3300010376 | Tropical Forest Soil | VRRAAMAALKWLLAILGLLLFGSAGALVVYDVYVA |
Ga0126381_1046134972 | 3300010376 | Tropical Forest Soil | MAALKWLLAILGLLLFGSAGALVVYDVYVASQLRRLLKRKSEGGADA |
Ga0137392_101871551 | 3300011269 | Vadose Zone Soil | MKERITTLIALKYLLIILGIGLFGSAGALVAYDVYVSSQLRR |
Ga0137392_111302122 | 3300011269 | Vadose Zone Soil | MERRGNSMLALKYLLMILGAGLFGSAGALVAYDIFLSEQ |
Ga0137392_113265102 | 3300011269 | Vadose Zone Soil | MLALKYLLMVLGVALFGSAGALAAYDIYLSEQLRRLLSR |
Ga0137391_100558466 | 3300011270 | Vadose Zone Soil | MSALKWLLMLVGAAVFGSAGVLVAYDIYLSEQLRRLLSRNKTDESGADL |
Ga0137393_105953413 | 3300011271 | Vadose Zone Soil | MSALKWLLMLVGAAVFGSAGALVAYDVYLSEQLRRLLSRNK |
Ga0137393_113811682 | 3300011271 | Vadose Zone Soil | MLLLKYLLMITGVGLFGSAAALVTYDIFLAAQLRRLLSRGETKPAMSS* |
Ga0137389_113146492 | 3300012096 | Vadose Zone Soil | MSALRWLLMLLGAVVFGSAGALVAYDIYLSEQLRRLLSRNRTDESGADLKSGET |
Ga0137388_100289356 | 3300012189 | Vadose Zone Soil | MLALKYLLVILGIGLFGSSGALVAYDIYLSSQLRRLLGW |
Ga0137383_100133581 | 3300012199 | Vadose Zone Soil | MIALKYLLVILGIGLFGSAGALVVYDVYVSSQLRRLLRRSSEEGAGGV |
Ga0137383_104052861 | 3300012199 | Vadose Zone Soil | MLVLKYLLMVLGVGLFGSASALVAYDIFLAAQLRRLLRRDTTD |
Ga0137363_111538582 | 3300012202 | Vadose Zone Soil | MLALKYLLVILGIGLFGSSGALVVYDVYLSSQLRRLLR |
Ga0137399_100084641 | 3300012203 | Vadose Zone Soil | MLALKYLLMLVGAGLFGSAGALVAYDIFLSEQLRRLL |
Ga0137362_100980411 | 3300012205 | Vadose Zone Soil | MSALKWLLMLMGAAVFGSAGALVAYDVYLSEQLRRLLSRNKTDES |
Ga0137362_107276992 | 3300012205 | Vadose Zone Soil | MKERITTMIALKYLLIVLGIGLFGSAGALVVYDVYLSSQLRRLLRRSSEDAAGGASS |
Ga0137380_107915401 | 3300012206 | Vadose Zone Soil | MEERGTSMVALRWLLMLMGAGLFGSAGALVAYDIYLSEQLRRLLSRNK |
Ga0137379_101273173 | 3300012209 | Vadose Zone Soil | MSALKWLLMLVGAVVFGSAGALAAYDVYLSEQLRRLLSGNKTDESGADL |
Ga0137386_108576201 | 3300012351 | Vadose Zone Soil | MVVLRYVLMILWLGLFGSAGALAAYDIFLAAQLRRLLHG |
Ga0137360_100057031 | 3300012361 | Vadose Zone Soil | MSALKWLLMLVGAAVFGSAGALVAYDVYLSEQLRRLLSRNKTDESGAD |
Ga0137361_110372791 | 3300012362 | Vadose Zone Soil | MKERITTMIALKWLLVILGIGLFGSAGALVIYDVYVSSQ |
Ga0137390_108212431 | 3300012363 | Vadose Zone Soil | MSALRWLLMLLGAVVFGSAGALVAYDIYLSEQLRRLLSRNRTDESGADLK |
Ga0134045_12943571 | 3300012409 | Grasslands Soil | MVALKWLLMIVGAGLFGSAGALVAYDVYLSAQLRRLLSRNKTDESGAEVGTL |
Ga0137395_109972932 | 3300012917 | Vadose Zone Soil | MLALKYLLMILGAGLFGSAGALVAYDIFLSEQLRRLLSRGKTEEYG |
Ga0137396_101934963 | 3300012918 | Vadose Zone Soil | MLALKYLLMILGAGLFGSAGALVAYDIFLSEQLRRLLSRGKTDQSG |
Ga0137396_104682861 | 3300012918 | Vadose Zone Soil | MLALKYLLMILGAGLFGSAGALVAYDIFLSAQLRK |
Ga0137394_108705143 | 3300012922 | Vadose Zone Soil | MIALKYLLVILGIGLFGSAGALVVYDVYVSSQLRRLLRRSSEEGAGVG |
Ga0137359_1001053210 | 3300012923 | Vadose Zone Soil | MLALKYLLTILGVGLFGSAGILVVYDIYIAARLRWLLE |
Ga0137359_106062393 | 3300012923 | Vadose Zone Soil | MKERITTMIALKWLLVILGIGLFGSAGALVIYDVYVSSQLRRLLRRSSEEAAGGATA |
Ga0137413_101681063 | 3300012924 | Vadose Zone Soil | MSALKWLLMLVGASVFGSAGALVAYDVYLSEQLRRLLSRNKTDESGADLKAPA |
Ga0137416_118947221 | 3300012927 | Vadose Zone Soil | MLALKYLLMILGAGLFGSAGALVTYDIYLSEQLRRLLSRNKTDESGAE |
Ga0137404_102416933 | 3300012929 | Vadose Zone Soil | MIALKYLLVILGIGLFGSAGALVVYDVYVSSQLRRLLRRSSEESAGVGE |
Ga0137407_103380811 | 3300012930 | Vadose Zone Soil | MLALKWLLMIVGVGLFGSAGALVAYDVYLSEQLRRLLSRNETDESGAE |
Ga0137407_111351283 | 3300012930 | Vadose Zone Soil | MVALKYLLAILGIGLFGSAGALVVYDVYVSSQLRRLLR |
Ga0153915_117230081 | 3300012931 | Freshwater Wetlands | MLLLKYLLMIAGFAIFGSAAALVAYDVYLAAQLRRL |
Ga0126375_105551091 | 3300012948 | Tropical Forest Soil | MVALKWLLVILGIGLFGSAGALVVYDVYVASQLRRLLKRKG |
Ga0126375_117276091 | 3300012948 | Tropical Forest Soil | MVALKWLLAILGIGLFGSAGALVVYDVYVASQLRRLLKRKSEEEAG |
Ga0157374_106433483 | 3300013296 | Miscanthus Rhizosphere | MLVLKYLLMLAGAGLFTSAAAIVLYDIYLASQLRRLLG |
Ga0137420_13107307 | 3300015054 | Vadose Zone Soil | MSALKWLLMLVAPQSSEARGLLVAYDVYLSEQLRRLLSRNKTDESGADLKARAERSRNRNPFHCA* |
Ga0137420_13436491 | 3300015054 | Vadose Zone Soil | MSALKWLLMLMGAAVFGSAGALVAYDVYLSEQLRRLLSRNRTDESGTE |
Ga0167662_10141911 | 3300015082 | Glacier Forefield Soil | MIALKYLLVIVGIGLFGCAGLLVAYDVYFSARLRRLLRGATGEGEG |
Ga0137412_102335473 | 3300015242 | Vadose Zone Soil | MSALKWLLMLVGASVFGSAGALVAYDVYLSEQLRRLLSRNKTDESGADLKARVERS |
Ga0137403_100538957 | 3300015264 | Vadose Zone Soil | MNVLKLLLVILGIGLFGSAGALVVYDVAVAAQLRRLLRR |
Ga0137403_109891341 | 3300015264 | Vadose Zone Soil | MKERITTMIALKWLLVILGIGLFGSAGALVIYDVYVSSQL |
Ga0132257_1002479915 | 3300015373 | Arabidopsis Rhizosphere | MVALKWLLVILGLGLFGSAGALLAYDVYVASQLRRLLKRK |
Ga0182034_106171961 | 3300016371 | Soil | MIALKWILVILGLGLFGSAGALVVYDVYVAAQLRWLLKRSSEGGEAEPGASP |
Ga0182034_109207213 | 3300016371 | Soil | MLALRCLVMLLAVGLFSSVGILLARDIVMATRLRWLLARQ |
Ga0182038_121165832 | 3300016445 | Soil | MVALKWLLMILGISLFGSAAALVAYDVYLAAQLRWLLKQESEGGEPGAG |
Ga0134112_100562733 | 3300017656 | Grasslands Soil | MVALKWLLMIVGAGLFGSAGALVAYDVYLSEQLRRLLSRN |
Ga0187824_101940201 | 3300017927 | Freshwater Sediment | MLALKYLLMLLGLGLFGSSAALVAYDIYISEQLRRLLARSRTSEPGAET |
Ga0137408_11479592 | 3300019789 | Vadose Zone Soil | MLALKYLLMILGFGLFGSAGALVVYDIFLSAQLRKLLRRNTTEETATKRICTA |
Ga0193729_12812011 | 3300019887 | Soil | MLVLKYLLMILGVGVFGSAAALVIYDIYLSAQLLRLLRREKTAEG |
Ga0193726_13648562 | 3300020021 | Soil | MLTLKYLMMILGIGLFGSAGSLLAYDIYLAAQLRRL |
Ga0193753_101534873 | 3300020034 | Soil | MLALKYLLMLLGVGLFGSAGAVVVYDVYVSERLRRLIQR |
Ga0179592_100217564 | 3300020199 | Vadose Zone Soil | MSALKWLLMLVGAAVFGSAGALVAYDIYLSEQLRRLLSRNRTHESGTALKARVKRNRTRN |
Ga0179592_102222481 | 3300020199 | Vadose Zone Soil | MVALKWLLMLVGAGLFGSAGALVAYDIFLSEQLRRL |
Ga0210407_102161413 | 3300020579 | Soil | MLALKYLLMILGVGLFGSAGALVVYDVYLSEQLRRLLARHKTSD |
Ga0210403_101105031 | 3300020580 | Soil | MLALKYLLMFLGAALFGSSGALVAYDIFLSEQLRRLLSRGKQDERGAHA |
Ga0210399_100037421 | 3300020581 | Soil | MLALKYLLMLVGVGLFGSAGALVAYDIFLSEQLRRLLAWGKKDEPGAE |
Ga0210399_103762363 | 3300020581 | Soil | MLALKYLLMILGVGLFGSAGALVVYDVYLSEQLRRLLARSKTSDL |
Ga0210399_111669631 | 3300020581 | Soil | MLALKYLLVILGIGLFGSSAALVVYDVYLSSQLRRLL |
Ga0210401_108722711 | 3300020583 | Soil | MLVLKYLLMILGVGVFGSAAALVIYDIYLSAQLLRLLRREK |
Ga0215015_102996333 | 3300021046 | Soil | MLVLKWLLMVLGVGLFGSAGALVVYDIYISAQLRRLLDRTLSLIHI |
Ga0179596_100223631 | 3300021086 | Vadose Zone Soil | MLALKYLLMILGAGLFGSAGALVAYDIFLSEQLRR |
Ga0210404_100543465 | 3300021088 | Soil | MLALKYLLMILGVGLFGSSGILVAYDIYIAARLRWL |
Ga0210405_105185401 | 3300021171 | Soil | MLALKCLLMILGVGLFSSSGILVAYDIYIAARLRWLLNTRGTNARN |
Ga0210405_107898781 | 3300021171 | Soil | MVFLKWLLTILGVGLFGSAGALVVYDVYLSEQLRRLLGRAVTDASGAE |
Ga0210408_100929884 | 3300021178 | Soil | MLALKYLLMILGAVLFGSSAGLVAYDIFLSTQLRRLLRRGT |
Ga0210408_113616391 | 3300021178 | Soil | MLALKYLLMILGVGLFGSASALVVYDIFLSTQLRRLLRRSATDETGAE |
Ga0210388_103412651 | 3300021181 | Soil | MLALKYLLMILGVGLFGSAGALVVYDIFISEQLRRLLARNKT |
Ga0210393_105737571 | 3300021401 | Soil | MLALKYLLMILGVGLFGSAGALVVYDVYLSEQLRRLLA |
Ga0210389_107989961 | 3300021404 | Soil | MLVLKYLLVLAGVGLFGSAAALVAYDIYISSQLRRLLRRKASAG |
Ga0210387_111330342 | 3300021405 | Soil | MLALKYLLLILGVGLFSSSGILVAYDIYIAARLRWLLNTRGTNVRN |
Ga0210386_101995601 | 3300021406 | Soil | MIALKYLLMLAGIGIFGSAAALVAYDIYIAARLRWLLEKTSGEAG |
Ga0210383_102345991 | 3300021407 | Soil | MLALKYLLMILGVGLFGSAGSLVVYDIFISEQLRRLLARSKKTETGAT |
Ga0210384_116266722 | 3300021432 | Soil | MLALKYLLMILGVGLFGSAGALVVYDVYLSEQLRRLLARSKTSELGAETG |
Ga0210391_101737641 | 3300021433 | Soil | MLALKYLLMILGVGLFGSAGSLVVYDIFISEQLRRLLARNKTSEAGTGTLTSTGI |
Ga0210391_102006003 | 3300021433 | Soil | MLALKYLLMILGVGLFGSAGSLVVYDIFISEQLRRLLARNK |
Ga0210398_109643752 | 3300021477 | Soil | MLVLKYLLMILGVGLFGSAATLVTYDIYLSAQLRRLLRRGAAGEA |
Ga0210402_100149536 | 3300021478 | Soil | LILGVGLFSSSGILVAYDIYIAARLRWLLNTRGTNVRN |
Ga0210402_119378062 | 3300021478 | Soil | MLVLKYLLMLAGVGLFGSAAALVLYDIYISSQLRRLLRR |
Ga0210410_111684952 | 3300021479 | Soil | MLALKYLLIILGLGLFGSAGALVVYDVYLSEQLRRLL |
Ga0210410_117868312 | 3300021479 | Soil | MLVLKYLLMILGAGLFGSAGALVVYDIYLSEQLRRLLNRSTTGES |
Ga0210409_100312337 | 3300021559 | Soil | MLALKYLLMTLGVALFGSAGALVVYDVYISEQLRRLLARSKTSETSRETG |
Ga0210409_102213671 | 3300021559 | Soil | MAALKWLLMLVGAALFGSAGVLVAYDIYLAEQLRRLLSRNKTDESGADLKVRAERKP |
Ga0210409_104150791 | 3300021559 | Soil | MLALKYLLMFLGAALFGSSGALVAYDIFLSEQLQRLLSRGKQDERRA |
Ga0210409_113450982 | 3300021559 | Soil | MLALKYLLMIIGTLLFGSAVGLVAYDIFLSTQLRRL |
Ga0213853_114220442 | 3300021861 | Watersheds | MLVLKYLLVILGIALLGSSGSLVAYDIYLSSQLRRLL |
Ga0247695_10150311 | 3300024179 | Soil | MLALKYLLMILGLGLFGSSGALVAYDIYLAEQLRRLLARSKTSEPGGETGIT |
Ga0247691_10430983 | 3300024222 | Soil | MLALKYLLMILGLGLFGSAGALVVYDIYISEQLRRLLARSKTIEPGAET |
Ga0247666_10970872 | 3300024323 | Soil | MNVLKLLLVILGIGLFGSAGALVVYDVVVATQLRRLLRW |
Ga0247678_10611721 | 3300024325 | Soil | MLALKYLLMILGVGLFSSSGILVAYDIYIAARLRWLLG |
Ga0209171_100672361 | 3300025320 | Iron-Sulfur Acid Spring | MLALKYLLMLLGVGLFGSAGALVVYDVYVSERLRRLIKQKANS |
Ga0207685_100345724 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MIALKYLLVILGIGLFGSAGALVIYDVYISSQLRRLLRRSSEEA |
Ga0207684_106318903 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIALKYLLVVLGIGLFGSAGALVVYDVYVSSQLRRL |
Ga0207667_118388432 | 3300025949 | Corn Rhizosphere | MLVLKYLLMLAGAGLFTSAAAIVLYDIYLASQLRRLLGRSVPV |
Ga0209235_11778432 | 3300026296 | Grasslands Soil | MLALKYFLMLVGAGLFGSAGALVAYDIYLSEQLLRLLSRN |
Ga0209236_10596273 | 3300026298 | Grasslands Soil | MLALKYLLMILGAGLFGSAGALVAYDIFLSAQLRRLL |
Ga0209688_10744192 | 3300026305 | Soil | LALKWLLMIVGAGLFGSAGALVAYDVYLSEQLRRLL |
Ga0209268_10054781 | 3300026314 | Soil | MLALKYLLMILGVGLFGSAGALVAYDVFLATQLRRLLGGRGGG |
Ga0209268_10120291 | 3300026314 | Soil | MVALKWLLMIVGAGLFGSAGALVAYDVYLSAQLRRLLSRN |
Ga0209471_12449751 | 3300026318 | Soil | MLALKWLLMILGAGLFGSAGALVAYDIFLAEQLRRLL |
Ga0209470_12414603 | 3300026324 | Soil | MLALKYLLMILGVGLFGSAGAVVAYDVFLATQLRRLLGGRGG |
Ga0209802_12207982 | 3300026328 | Soil | MLALRWLLMLVGAVVLGSAAALVSYDIYLAEQLRRLLSRNKTDESGTEVG |
Ga0209802_13253352 | 3300026328 | Soil | MLALKWLLMIVGAGLFGSAGALVAYDVYLSEQLRRLL |
Ga0209158_11974121 | 3300026333 | Soil | MVALRWLLMLVGAGVFGSAGALVAYDIYLSEQLRRLLSRNRTDESGADLRVRAARKP |
Ga0257163_10141211 | 3300026359 | Soil | MLVLKYLLVILGIGLFGSSGALVVYDIYLSSQLRR |
Ga0257172_10439311 | 3300026482 | Soil | MLVLKYLLVILGIGLFGSSGALVVYDIYLSSQLRRLLGR |
Ga0257156_10904482 | 3300026498 | Soil | MLALKYLLMILGVGLFSSSGILVAYDIYIAARLRWLLGGDRRRSA |
Ga0209160_13013002 | 3300026532 | Soil | MNVLKLLLVILGIGLFGSAGALVVYDVVVAAQLRRLLRRR |
Ga0209160_13206351 | 3300026532 | Soil | MVALKWLLMIVGAGLFGSAGALVAYDVYLSEQLRRLLSRNKTDESG |
Ga0209161_100071478 | 3300026548 | Soil | MLALKWLLMLLGAGLFGSAGALVAYDIFLSEQLRRLLSRDK |
Ga0209648_108310371 | 3300026551 | Grasslands Soil | MLALKWLLMIVGAGLFGSAGALVAYDVYLSEQLRRLLSRNKTDESGAE |
Ga0179587_1000339611 | 3300026557 | Vadose Zone Soil | MLALKCLLLILGVGLFSSSGIMVAHDIYIATRLRCLLEQ |
Ga0179587_103295593 | 3300026557 | Vadose Zone Soil | MLALKYLLTILGVGLFGSSGILVAYDIYIAARLRWLL |
Ga0208241_10694201 | 3300027297 | Forest Soil | MLALKYLLMILGVGLFGSAGSLVVYDIFISEQLRRLLARNKTN |
Ga0209524_11259822 | 3300027521 | Forest Soil | MLALKYLLMLLGVGLFGSAGALVVYDVYVSERLRRLIKRNANGE |
Ga0209115_11110141 | 3300027567 | Forest Soil | MLVLKYLLMMAGVGLFGSAAVLVAYDIYISSQLRRLLRRDV |
Ga0209625_11100671 | 3300027635 | Forest Soil | MIALKWLLIILGIGLFGSAGALVIYDVYVSSQLRRLLRRSSEEAGGGAGAG |
Ga0209588_10439861 | 3300027671 | Vadose Zone Soil | MSALKWLLMLVGAAVFGSAGALVAYDVYLSEQLRRLL |
Ga0209581_10442412 | 3300027706 | Surface Soil | MLALRILLIVAGLVLLGSTTALMAYDIYLSSQLRRLLRKH |
Ga0209178_11208481 | 3300027725 | Agricultural Soil | MLVLKYVLVVLGLGLLGSAGALVVYDVYLAAQLRRLLGRTPP |
Ga0209810_10229192 | 3300027773 | Surface Soil | MLALRILLIVAGLVLLGSTTALIAYDIYLSSQLRRLLRKH |
Ga0209177_100468453 | 3300027775 | Agricultural Soil | MLALKYFLMILGVGLFGSAGALAAYDVFLATQLRRLLRGRAGGEAG |
Ga0209580_100635834 | 3300027842 | Surface Soil | MPALKYLLMILGLGLFGSASALAAYDIFLATQLRRLL |
Ga0209180_101716523 | 3300027846 | Vadose Zone Soil | MLALKYLLMILGAGLFGSAGALVAYDIFLSEQLRRLLSRGK |
Ga0209180_105504832 | 3300027846 | Vadose Zone Soil | MLALKYLLMILGAGLFGSAGALVAYDIFLSEQLRRLLSRNKTDESGADLR |
Ga0209180_106915702 | 3300027846 | Vadose Zone Soil | MSALKWLLMLVGAAVFGSAGVLVAYDIYLSEQLRRLLSRNKTDESGADLKAPAKRSRTR |
Ga0209701_100913161 | 3300027862 | Vadose Zone Soil | MSALKWLLMLVGAGLFGSAGALAAYDIYLSEQLRRLLSRNKTDESGAG |
Ga0209701_103779671 | 3300027862 | Vadose Zone Soil | MLALKWLLMLVGAGLFGSAGALVAYDIYLAEQLRRL |
Ga0209701_105396232 | 3300027862 | Vadose Zone Soil | MAALKWLLMLVGAGLFGSAGALVAYDIYLAEQLRRL |
Ga0209465_102474131 | 3300027874 | Tropical Forest Soil | MLALKYLLMILGVGLFGSAGALVAYDIFLATQLRR |
Ga0209275_101723271 | 3300027884 | Soil | MLALKYLLMILGVGLFGSAGSLVVYDIYISEQLRRLLARSKTSEMATPPVATTGI |
Ga0209698_107678191 | 3300027911 | Watersheds | MLALKYLLMVLGVGLFGSAGSLVVYDIYISEQLRRLLARSK |
Ga0222749_102482843 | 3300029636 | Soil | MLALKYLLMILGVGLFGSAGALVVYDIYLSAQLRRLLGRHTTD |
Ga0075371_116593161 | 3300030974 | Soil | MIALKYLLIILGIGLFGSAGALVIYDVYVSSQLRRLLRRSSEETAGGASAGATSFLSSG |
Ga0170834_1009742661 | 3300031057 | Forest Soil | MIALKYLLIILGIGLFGSAGALVAYDVYVSSQLRRLLRRSSEQTAGGASAGATSFLSSGH |
Ga0170822_171237531 | 3300031122 | Forest Soil | MLALKYLLMLLGVGLFGSAGAVVVYDVYVSERLRR |
Ga0170823_147142471 | 3300031128 | Forest Soil | MLALKYLLMFLGVGLFINKEKVVVNDVYVSERLRRLTQRKGNG |
Ga0170824_1009986772 | 3300031231 | Forest Soil | MIVLKWLLGLVSIGLFGSAGALVVYDVYVSSQLRRLLKRSSETD |
Ga0170824_1156403991 | 3300031231 | Forest Soil | MIALKWLLVILGIGLFGSAGALVIYDFYVSSQLRRLLRRSSEEAAGDA |
Ga0170824_1168135392 | 3300031231 | Forest Soil | MLALKYLLMILGVGMFGSAGSLVIYDIYISEQLRRLLARSKTTEAG |
Ga0170824_1174621014 | 3300031231 | Forest Soil | MLALKYLLMILGVGLFSSSGILVAHDIYIATRLRWLLNTRGTNARN |
Ga0170824_1279597631 | 3300031231 | Forest Soil | MLALKYLLMLLGVGLFGIAGAVVVYDVYVSERLRRLLQRKAN |
Ga0310915_100627515 | 3300031573 | Soil | MAALKWLLAILGLLLFGSAGALVVYDVYVTSQLRRLL |
Ga0318555_104138562 | 3300031640 | Soil | MAALKWLLAILGLLLFGSAGALVVYDVYVTSQLRRLLKRKSEG |
Ga0318561_101395621 | 3300031679 | Soil | MVALKWLLMILGISLFGSAAALVAYDVYLAAQLRWLLKQESEGGEPGAGAAA |
Ga0318560_106933061 | 3300031682 | Soil | MAALKWLLAILGLLLFGSAGALVVYDVYVTSQLRRLLKRK |
Ga0307474_101763241 | 3300031718 | Hardwood Forest Soil | MLALKTLLVVLGIVLFGSSGALVAYDIFLSSQLRRLL |
Ga0307474_107047721 | 3300031718 | Hardwood Forest Soil | MLALKYLLMIFGVALFGSAGALVVYDVYLSEQLRRLLARNKTSETGGETEI |
Ga0307469_102825364 | 3300031720 | Hardwood Forest Soil | MLVLRYLLVILGIGLLGSSGALVVYDIYLSSQLRRLLGRR |
Ga0318502_102283193 | 3300031747 | Soil | MAALKWLLAILGLLLFGSAGALVVYDVYVASQLRRLLKRKSEGSADATTSLP |
Ga0318535_102314633 | 3300031764 | Soil | MVALKWLLMILGISLFGSAAALVAYDVYLAAQLRWLLKQE |
Ga0318497_104039483 | 3300031805 | Soil | MVALRYVLMILGLGLFGSASALAAYDIFLATQLRRLLRR |
Ga0307473_112436061 | 3300031820 | Hardwood Forest Soil | MLVLKYLLMLVGAGFFGSAGALVAYDVYLSEQLRRLLS |
Ga0307478_110950071 | 3300031823 | Hardwood Forest Soil | MLALKYLLMILGAVLFGSAGALVAYDIFLSEQLRRLLSRGKTDESGAE |
Ga0306925_100368691 | 3300031890 | Soil | MAALKWLLAILGLLLFGSAGALVVYDVYVTSQLRRL |
Ga0306925_119612651 | 3300031890 | Soil | MVALKWLLVILGLALFGSAGALAAYDVYLASELRRLLKGSS |
Ga0310916_111452001 | 3300031942 | Soil | MVALKWLLMILGISLFGSAAALVAYDVYLAAQLRWLLKQSSEGGEPGA |
Ga0310910_100663331 | 3300031946 | Soil | MAALKWLLAILGLLLFGSAGALVVYDVYVTSQLRRLLKRKSE |
Ga0306926_118345212 | 3300031954 | Soil | MLALRYLLMALGVGLFSTAGILVAYDIYMAARLRWLVMTPMIRRR |
Ga0307479_100071309 | 3300031962 | Hardwood Forest Soil | MLALKYLLMLLGVGLFGSAGAIVVYDVYVSERLRRLIQRYANG |
Ga0307479_100835271 | 3300031962 | Hardwood Forest Soil | MLALKYLLMFLGAALFGSSGALVAYDIFLSEQLRRLLSRGKQDEPRAHA |
Ga0307479_105854982 | 3300031962 | Hardwood Forest Soil | MIALKWLLVILGIGLFGSAGALVIYDVYVSSQLRRLLRR |
Ga0307479_117341871 | 3300031962 | Hardwood Forest Soil | VPLGFRDVEEGNSSMAALRWLLMLVGAVVFGSAGALVAYDIYLSEQLRQLLSRNKT |
Ga0318545_101437122 | 3300032042 | Soil | MAALKWLLAILGLLLFGSAGALVVYDVYVTSQLRRLLK |
Ga0306924_103712651 | 3300032076 | Soil | MVALKWLLMILGISLFGSAAALVAYDVYLAAQLRWLLKQ |
Ga0318525_101532881 | 3300032089 | Soil | MAALKWLLAILGLLLFGSAGALVVYDVYVTSQLRRLLKRKSEGRAD |
Ga0307472_1004021841 | 3300032205 | Hardwood Forest Soil | MVALRWLLMLVGAGVFGSAGALVAYDIYLSEQLRRLLS |
Ga0335072_108593123 | 3300032898 | Soil | MLGLKYLLMILGLGLFGSASALVAYDVYLSEQLRRVLMRRRTSRDGAR |
Ga0335077_114803343 | 3300033158 | Soil | MVALKMLLVILGIGLFGSAGALVIYDVVVATQLRRLLRR |
⦗Top⦘ |