NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017622

Metagenome / Metatranscriptome Family F017622

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017622
Family Type Metagenome / Metatranscriptome
Number of Sequences 239
Average Sequence Length 40 residues
Representative Sequence MSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA
Number of Associated Samples 113
Number of Associated Scaffolds 239

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.95 %
% of genes near scaffold ends (potentially truncated) 41.42 %
% of genes from short scaffolds (< 2000 bps) 91.63 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.598 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.431 % of family members)
Environment Ontology (ENVO) Unclassified
(49.791 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(69.874 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.48%    β-sheet: 0.00%    Coil/Unstructured: 51.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 239 Family Scaffolds
PF04392ABC_sub_bind 18.41
PF03401TctC 2.51
PF07690MFS_1 2.09
PF02705K_trans 1.26
PF13924Lipocalin_5 1.26
PF00239Resolvase 0.84
PF07813LTXXQ 0.84
PF12832MFS_1_like 0.42
PF06742DUF1214 0.42
PF05443ROS_MUCR 0.42
PF02481DNA_processg_A 0.42
PF07647SAM_2 0.42
PF02371Transposase_20 0.42
PF13415Kelch_3 0.42
PF12706Lactamase_B_2 0.42
PF00144Beta-lactamase 0.42
PF03704BTAD 0.42
PF13936HTH_38 0.42
PF00512HisKA 0.42
PF02518HATPase_c 0.42
PF01344Kelch_1 0.42
PF08241Methyltransf_11 0.42
PF01548DEDD_Tnp_IS110 0.42
PF13340DUF4096 0.42
PF12697Abhydrolase_6 0.42
PF13442Cytochrome_CBB3 0.42
PF13492GAF_3 0.42
PF03466LysR_substrate 0.42
PF00536SAM_1 0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 239 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 18.41
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 3.35
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.51
COG3158K+ uptake protein KupInorganic ion transport and metabolism [P] 1.26
COG0758Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptakeReplication, recombination and repair [L] 0.84
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.84
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.84
COG3547TransposaseMobilome: prophages, transposons [X] 0.84
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.42
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.42
COG2367Beta-lactamase class ADefense mechanisms [V] 0.42
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.42
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.42
COG4957Predicted transcriptional regulatorTranscription [K] 0.42
COG5361Uncharacterized conserved proteinMobilome: prophages, transposons [X] 0.42
COG5402Uncharacterized protein, contains DUF1214 domainFunction unknown [S] 0.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.60 %
UnclassifiedrootN/A36.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000580|AF_2010_repII_A01DRAFT_1037480Not Available753Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10027088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1557Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10037053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1301Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10061190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria964Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10067314All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10094989All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300004629|Ga0008092_11322987Not Available1082Open in IMG/M
3300005093|Ga0062594_103208651Not Available513Open in IMG/M
3300005332|Ga0066388_101094467All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300005332|Ga0066388_101154392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1318Open in IMG/M
3300005332|Ga0066388_103780706Not Available772Open in IMG/M
3300005332|Ga0066388_104774286All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300005332|Ga0066388_106220914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300005332|Ga0066388_107547568All Organisms → cellular organisms → Bacteria → Proteobacteria545Open in IMG/M
3300005332|Ga0066388_107628728Not Available542Open in IMG/M
3300005363|Ga0008090_10135659All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005363|Ga0008090_10212040All Organisms → cellular organisms → Bacteria → Proteobacteria1005Open in IMG/M
3300005363|Ga0008090_10232119Not Available528Open in IMG/M
3300005363|Ga0008090_10254030Not Available1233Open in IMG/M
3300005549|Ga0070704_102261471Not Available506Open in IMG/M
3300005552|Ga0066701_10646119Not Available640Open in IMG/M
3300005553|Ga0066695_10707838All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300005560|Ga0066670_10174156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1276Open in IMG/M
3300005713|Ga0066905_100160584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1632Open in IMG/M
3300005713|Ga0066905_100187914All Organisms → cellular organisms → Bacteria → Proteobacteria1531Open in IMG/M
3300005713|Ga0066905_100230155All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300005713|Ga0066905_100457071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1051Open in IMG/M
3300005713|Ga0066905_100790142All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300005713|Ga0066905_101809301Not Available563Open in IMG/M
3300005764|Ga0066903_100393509All Organisms → cellular organisms → Bacteria2274Open in IMG/M
3300005764|Ga0066903_101282110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1367Open in IMG/M
3300005764|Ga0066903_101501146Not Available1272Open in IMG/M
3300005764|Ga0066903_101578069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi1243Open in IMG/M
3300005764|Ga0066903_101606508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1233Open in IMG/M
3300005764|Ga0066903_101615049All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300005764|Ga0066903_102056204All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300005764|Ga0066903_102153221Not Available1074Open in IMG/M
3300005764|Ga0066903_102204997All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300005764|Ga0066903_102524019Not Available995Open in IMG/M
3300005764|Ga0066903_102529598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium994Open in IMG/M
3300005764|Ga0066903_102626548Not Available976Open in IMG/M
3300005764|Ga0066903_102835546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria940Open in IMG/M
3300005764|Ga0066903_102865698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium935Open in IMG/M
3300005764|Ga0066903_103054559Not Available906Open in IMG/M
3300005764|Ga0066903_103304276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria871Open in IMG/M
3300005764|Ga0066903_103373166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria862Open in IMG/M
3300005764|Ga0066903_103574643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria837Open in IMG/M
3300005764|Ga0066903_104215025All Organisms → cellular organisms → Bacteria → Proteobacteria769Open in IMG/M
3300005764|Ga0066903_104256668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi765Open in IMG/M
3300005764|Ga0066903_104366885Not Available755Open in IMG/M
3300005764|Ga0066903_104434608Not Available749Open in IMG/M
3300005764|Ga0066903_104597865All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300005764|Ga0066903_104793206All Organisms → cellular organisms → Bacteria → Proteobacteria719Open in IMG/M
3300005764|Ga0066903_104985892All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300005764|Ga0066903_106140862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria628Open in IMG/M
3300005764|Ga0066903_106735329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300005764|Ga0066903_106921489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium588Open in IMG/M
3300005764|Ga0066903_107702150Not Available554Open in IMG/M
3300005764|Ga0066903_107773509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300005764|Ga0066903_107847633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium548Open in IMG/M
3300005764|Ga0066903_107849826All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005764|Ga0066903_107900655Not Available546Open in IMG/M
3300005764|Ga0066903_108608880Not Available519Open in IMG/M
3300005764|Ga0066903_108832110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300005937|Ga0081455_10008269All Organisms → cellular organisms → Bacteria → Proteobacteria10848Open in IMG/M
3300006028|Ga0070717_10947918All Organisms → cellular organisms → Bacteria → Proteobacteria784Open in IMG/M
3300006791|Ga0066653_10187265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1041Open in IMG/M
3300006844|Ga0075428_100576162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1203Open in IMG/M
3300006854|Ga0075425_100279209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1923Open in IMG/M
3300006854|Ga0075425_100836842Not Available1054Open in IMG/M
3300009100|Ga0075418_11062426Not Available877Open in IMG/M
3300009792|Ga0126374_10204295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1253Open in IMG/M
3300009792|Ga0126374_10626472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales798Open in IMG/M
3300009792|Ga0126374_10728596Not Available749Open in IMG/M
3300009792|Ga0126374_10849920Not Available702Open in IMG/M
3300009792|Ga0126374_10936536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria674Open in IMG/M
3300010043|Ga0126380_10456526All Organisms → cellular organisms → Bacteria → Proteobacteria967Open in IMG/M
3300010043|Ga0126380_11372900Not Available619Open in IMG/M
3300010043|Ga0126380_12249317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300010046|Ga0126384_10026878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3778Open in IMG/M
3300010046|Ga0126384_10310864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1299Open in IMG/M
3300010046|Ga0126384_10435891All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300010046|Ga0126384_10521023All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300010046|Ga0126384_10591237All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300010046|Ga0126384_11013569All Organisms → cellular organisms → Bacteria → Proteobacteria757Open in IMG/M
3300010047|Ga0126382_10056211All Organisms → cellular organisms → Bacteria → Proteobacteria2335Open in IMG/M
3300010047|Ga0126382_10292617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1218Open in IMG/M
3300010047|Ga0126382_11037180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria722Open in IMG/M
3300010047|Ga0126382_12111734Not Available539Open in IMG/M
3300010048|Ga0126373_10825546Not Available989Open in IMG/M
3300010329|Ga0134111_10184782All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300010333|Ga0134080_10380822Not Available649Open in IMG/M
3300010358|Ga0126370_10153275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1683Open in IMG/M
3300010358|Ga0126370_10613833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium941Open in IMG/M
3300010358|Ga0126370_10976140Not Available771Open in IMG/M
3300010359|Ga0126376_12347690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300010360|Ga0126372_10892035Not Available891Open in IMG/M
3300010360|Ga0126372_11935360Not Available635Open in IMG/M
3300010360|Ga0126372_13010537Not Available523Open in IMG/M
3300010361|Ga0126378_12610811All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300010361|Ga0126378_13183503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300010361|Ga0126378_13449451Not Available501Open in IMG/M
3300010362|Ga0126377_10510550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1235Open in IMG/M
3300010362|Ga0126377_10717446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1054Open in IMG/M
3300010366|Ga0126379_10627944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1162Open in IMG/M
3300010366|Ga0126379_10868191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli1004Open in IMG/M
3300010366|Ga0126379_11362275All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300010366|Ga0126379_13777030Not Available507Open in IMG/M
3300010376|Ga0126381_102182585All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300010376|Ga0126381_103014770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300010376|Ga0126381_104287980Not Available552Open in IMG/M
3300010376|Ga0126381_104533626Not Available536Open in IMG/M
3300010398|Ga0126383_10203579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1903Open in IMG/M
3300010398|Ga0126383_10867112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae988Open in IMG/M
3300010398|Ga0126383_11642169All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300010398|Ga0126383_11942757Not Available676Open in IMG/M
3300010398|Ga0126383_12326262All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300012021|Ga0120192_10102118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300012022|Ga0120191_10000282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3285Open in IMG/M
3300012199|Ga0137383_10191744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1498Open in IMG/M
3300012199|Ga0137383_11065300All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300012202|Ga0137363_11458749Not Available575Open in IMG/M
3300012206|Ga0137380_11130507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria667Open in IMG/M
3300012357|Ga0137384_11448969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium 13_1_40CM_3_65_7535Open in IMG/M
3300012944|Ga0137410_11777186Not Available544Open in IMG/M
3300012948|Ga0126375_10569785Not Available859Open in IMG/M
3300012971|Ga0126369_10515297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1256Open in IMG/M
3300012971|Ga0126369_11243738All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300012971|Ga0126369_11954390Not Available675Open in IMG/M
3300012971|Ga0126369_12295688All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300012971|Ga0126369_12947744Not Available557Open in IMG/M
3300012971|Ga0126369_13207732Not Available536Open in IMG/M
3300016294|Ga0182041_11173839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300016294|Ga0182041_11567679Not Available607Open in IMG/M
3300016341|Ga0182035_10257922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601410Open in IMG/M
3300016422|Ga0182039_10266745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1403Open in IMG/M
3300016445|Ga0182038_10064232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2517Open in IMG/M
3300016445|Ga0182038_12018524Not Available522Open in IMG/M
3300018061|Ga0184619_10182573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium962Open in IMG/M
3300018433|Ga0066667_10257534All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300018482|Ga0066669_10565027Not Available993Open in IMG/M
3300021082|Ga0210380_10036139Not Available2121Open in IMG/M
3300021170|Ga0210400_10377342Not Available1169Open in IMG/M
3300021560|Ga0126371_11399027Not Available830Open in IMG/M
3300021560|Ga0126371_11625554Not Available772Open in IMG/M
3300021560|Ga0126371_12205801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria665Open in IMG/M
3300021560|Ga0126371_12485556Not Available627Open in IMG/M
3300021560|Ga0126371_13543393Not Available527Open in IMG/M
3300025910|Ga0207684_10544635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283993Open in IMG/M
3300026536|Ga0209058_1134088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1200Open in IMG/M
3300027874|Ga0209465_10083288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi1559Open in IMG/M
3300027874|Ga0209465_10325862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium770Open in IMG/M
3300028047|Ga0209526_10046533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3053Open in IMG/M
3300028608|Ga0247819_10257607All Organisms → cellular organisms → Bacteria → Proteobacteria962Open in IMG/M
3300028708|Ga0307295_10024470Not Available1490Open in IMG/M
3300028708|Ga0307295_10124763Not Available705Open in IMG/M
3300028719|Ga0307301_10011327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2527Open in IMG/M
3300028744|Ga0307318_10377777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300028768|Ga0307280_10315841Not Available572Open in IMG/M
3300028771|Ga0307320_10378026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300028875|Ga0307289_10126910Not Available1046Open in IMG/M
3300031543|Ga0318516_10049700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2278Open in IMG/M
3300031543|Ga0318516_10234076All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300031544|Ga0318534_10302245All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300031544|Ga0318534_10536137Not Available667Open in IMG/M
3300031545|Ga0318541_10030643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2662Open in IMG/M
3300031545|Ga0318541_10226628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1036Open in IMG/M
3300031546|Ga0318538_10275414Not Available905Open in IMG/M
3300031561|Ga0318528_10090366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1597Open in IMG/M
3300031561|Ga0318528_10752439Not Available521Open in IMG/M
3300031572|Ga0318515_10238733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium975Open in IMG/M
3300031572|Ga0318515_10635314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium566Open in IMG/M
3300031573|Ga0310915_10034642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3177Open in IMG/M
3300031573|Ga0310915_10086623All Organisms → cellular organisms → Bacteria2093Open in IMG/M
3300031573|Ga0310915_10906566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga ossetica617Open in IMG/M
3300031668|Ga0318542_10429859Not Available683Open in IMG/M
3300031681|Ga0318572_10529193Not Available702Open in IMG/M
3300031682|Ga0318560_10714621Not Available541Open in IMG/M
3300031719|Ga0306917_10661433Not Available821Open in IMG/M
3300031724|Ga0318500_10327179Not Available754Open in IMG/M
3300031724|Ga0318500_10406663Not Available677Open in IMG/M
3300031724|Ga0318500_10442960All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300031744|Ga0306918_10563932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria892Open in IMG/M
3300031744|Ga0306918_10940304Not Available672Open in IMG/M
3300031747|Ga0318502_10691072All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300031763|Ga0318537_10286819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300031764|Ga0318535_10029954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2171Open in IMG/M
3300031769|Ga0318526_10178823Not Available865Open in IMG/M
3300031770|Ga0318521_10734925All Organisms → cellular organisms → Bacteria → Proteobacteria600Open in IMG/M
3300031771|Ga0318546_11287718Not Available513Open in IMG/M
3300031777|Ga0318543_10393523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria621Open in IMG/M
3300031792|Ga0318529_10245727Not Available832Open in IMG/M
3300031792|Ga0318529_10458204All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300031792|Ga0318529_10560663Not Available530Open in IMG/M
3300031793|Ga0318548_10283020All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300031795|Ga0318557_10287076Not Available755Open in IMG/M
3300031796|Ga0318576_10207681Not Available921Open in IMG/M
3300031819|Ga0318568_10352175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria916Open in IMG/M
3300031821|Ga0318567_10250596Not Available994Open in IMG/M
3300031821|Ga0318567_10542252All Organisms → cellular organisms → Bacteria → Proteobacteria660Open in IMG/M
3300031821|Ga0318567_10690174All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031833|Ga0310917_10462391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria863Open in IMG/M
3300031879|Ga0306919_10289510Not Available1240Open in IMG/M
3300031879|Ga0306919_10485687Not Available952Open in IMG/M
3300031879|Ga0306919_10613062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria839Open in IMG/M
3300031890|Ga0306925_10083966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3372Open in IMG/M
3300031890|Ga0306925_10242859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1941Open in IMG/M
3300031890|Ga0306925_10676412All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300031890|Ga0306925_11238950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria745Open in IMG/M
3300031897|Ga0318520_10019271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3214Open in IMG/M
3300031910|Ga0306923_10098823All Organisms → cellular organisms → Bacteria3292Open in IMG/M
3300031910|Ga0306923_11147976Not Available834Open in IMG/M
3300031910|Ga0306923_11999249Not Available588Open in IMG/M
3300031912|Ga0306921_10105778All Organisms → cellular organisms → Bacteria → Proteobacteria3265Open in IMG/M
3300031912|Ga0306921_10801375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1076Open in IMG/M
3300031941|Ga0310912_10970908All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300031942|Ga0310916_10206808All Organisms → cellular organisms → Bacteria1644Open in IMG/M
3300031942|Ga0310916_11006116All Organisms → cellular organisms → Bacteria → Proteobacteria695Open in IMG/M
3300031942|Ga0310916_11633931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria522Open in IMG/M
3300031945|Ga0310913_10674647Not Available731Open in IMG/M
3300031946|Ga0310910_11003006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria652Open in IMG/M
3300031947|Ga0310909_10291739All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300031947|Ga0310909_10446007Not Available1086Open in IMG/M
3300031954|Ga0306926_10532244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1441Open in IMG/M
3300031954|Ga0306926_11722156All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031981|Ga0318531_10063569Not Available1586Open in IMG/M
3300032001|Ga0306922_10402207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1466Open in IMG/M
3300032025|Ga0318507_10478305Not Available542Open in IMG/M
3300032035|Ga0310911_10031120Not Available2662Open in IMG/M
3300032035|Ga0310911_10068513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1890Open in IMG/M
3300032059|Ga0318533_11337176Not Available523Open in IMG/M
3300032068|Ga0318553_10048984All Organisms → cellular organisms → Bacteria → Proteobacteria2076Open in IMG/M
3300032076|Ga0306924_10581355Not Available1269Open in IMG/M
3300032076|Ga0306924_10694457Not Available1143Open in IMG/M
3300032076|Ga0306924_12230023All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300032180|Ga0307471_100996396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1005Open in IMG/M
3300032261|Ga0306920_101188263Not Available1102Open in IMG/M
3300033289|Ga0310914_10341828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1353Open in IMG/M
3300033290|Ga0318519_10172056Not Available1222Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil23.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil20.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.51%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.09%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil2.09%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.84%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.84%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.42%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.42%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012021Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A01DRAFT_103748023300000580Forest SoilMSEQAVEKRRGLASEIVWVVLYSVLIFLVMLLWVDVPA*
AF_2010_repII_A1DRAFT_1002708833300000597Forest SoilMSEQAVEERRGWASDIVWVVLYSILVLLAMLLWVVPA*
AF_2010_repII_A1DRAFT_1003705323300000597Forest SoilMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA*
AF_2010_repII_A1DRAFT_1006119023300000597Forest SoilMSEQAVEKRRNLASEIVWVVLYSVLIFLVMLLWVDVPA*
AF_2010_repII_A1DRAFT_1006731433300000597Forest SoilDRKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA*
AF_2010_repII_A001DRAFT_1009498923300000793Forest SoilMSEQAVEERRGWASDIVWVVLYSILVLLVMLLWV*
Ga0008092_1132298733300004629Tropical Rainforest SoilVVHCDRKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSLHVPA*
Ga0062594_10320865113300005093SoilMSERAIEERQSSWSSDIVWVVVYSILVFLLMLLWMHIPA*
Ga0066388_10109446713300005332Tropical Forest SoilLCGEPCVPYAPLRRSAMNEQVVAERRHSASDIVGVVLYSTVVLLVMLLWVYVPA*
Ga0066388_10115439243300005332Tropical Forest SoilTCDPGESTMSEQAVEKRRGLASEIVWVVLYSVLIFLVLLLWVDVPA*
Ga0066388_10378070613300005332Tropical Forest SoilLCGDPCVPFATLRRSAMNEQVVAERRHSASDIVGAVLYSIVVLLVMLLWVYVPA*
Ga0066388_10477428613300005332Tropical Forest SoilAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA*
Ga0066388_10622091413300005332Tropical Forest SoilKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPG*
Ga0066388_10754756823300005332Tropical Forest SoilLCGDPCVPFAPLRRSAMNEQIVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA*
Ga0066388_10762872813300005332Tropical Forest SoilAMTEQAVEERRGWASDIVWVVAYSILVLLVMLLWVYVPA*
Ga0008090_1013565923300005363Tropical Rainforest SoilEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA*
Ga0008090_1021204023300005363Tropical Rainforest SoilMSEQAVEERRGWASDIVWVVVYSILVLLVMLLLIDVPALRPRRQTG*
Ga0008090_1023211913300005363Tropical Rainforest SoilVVHCDRKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMV
Ga0008090_1025403013300005363Tropical Rainforest SoilLSLLHCDRKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA*
Ga0070704_10226147123300005549Corn, Switchgrass And Miscanthus RhizosphereVPFATLRRSAMNEQVVAERRHSASDIVGVVLYSILVLLVMLLWVYVPA*
Ga0066701_1064611923300005552SoilMSERAVEEGRSWTSDVVWVAFYSILVLLLMLMWVNVPA*
Ga0066695_1070783823300005553SoilMSEQAVEERRGWASDIVWVVLYSIVILLVMLLWVHVPA*
Ga0066670_1017415633300005560SoilMNEQDVEERRDWASDFVWVILYSILVLLVMLLWVSVPA*
Ga0066905_10016058413300005713Tropical Forest SoilMSEQAVEERRRWASDIVWVVAYSILVLLVMLLWIYVPA*
Ga0066905_10018791423300005713Tropical Forest SoilMSEQVVEETRGWASDIVWVVLYSILILLLMLLWV*
Ga0066905_10023015523300005713Tropical Forest SoilMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA*
Ga0066905_10045707113300005713Tropical Forest SoilMSEQAVEERRGWASDIVSVVVYSILVMLLWVYVPA*
Ga0066905_10079014233300005713Tropical Forest SoilMSEQAVEERWGWASDIVWVVLYSILVLLVMLLLIDVPA*
Ga0066905_10180930123300005713Tropical Forest SoilMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVHVPA*
Ga0066903_10039350943300005764Tropical Forest SoilMSEQAVEERRGWASDIVWVVLYSILILLVMLLWVHVPA*
Ga0066903_10128211033300005764Tropical Forest SoilMSEQAVEERWGWASEIVWVVLYSILVLLVMLLWVYVPA*
Ga0066903_10150114613300005764Tropical Forest SoilMNEQVVTERRHSASDIVGVVLYSIVVLLVMLLWVYVPA
Ga0066903_10157806913300005764Tropical Forest SoilMSEQAIEERRGWASDIVWVMVYSILVILVMLLWVYVPA*
Ga0066903_10160650823300005764Tropical Forest SoilMNEQVVAERRHSASDIVEVVLYSIVVLLVMLLWVYVPA*
Ga0066903_10161504913300005764Tropical Forest SoilMSEQAVEERRGWASDIVWVVVYSILVFLVMLLLIDIPA*
Ga0066903_10205620423300005764Tropical Forest SoilMSEQAVEERRGWASDIVWVVVYSILVLLIMLLWVYVPA*
Ga0066903_10215322153300005764Tropical Forest SoilMSEQAVEERRRWASDIVWVVAYSILVLLVMLLWVY
Ga0066903_10220499733300005764Tropical Forest SoilMNEQVVAERRHSASDIGGVVLYSIVVLLVMLLWEYVPA*
Ga0066903_10252401913300005764Tropical Forest SoilMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYV
Ga0066903_10252959813300005764Tropical Forest SoilMSEQAVEERRGWASDIVWVMAYSILVLLVMLLWVYVPA*
Ga0066903_10262654823300005764Tropical Forest SoilMNEQIVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA*
Ga0066903_10283554623300005764Tropical Forest SoilMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVCVPA*
Ga0066903_10286569823300005764Tropical Forest SoilMSEQAVEERRGWASDIVWVVVYSILVLLVMLLLIDVPA*
Ga0066903_10305455923300005764Tropical Forest SoilMSEQAVGERRGWSSDIVWVVVYSILVLLVMLLWVDVPA*
Ga0066903_10330427623300005764Tropical Forest SoilVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA*
Ga0066903_10337316613300005764Tropical Forest SoilMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVSVPA*
Ga0066903_10357464323300005764Tropical Forest SoilMSEQTIEERRGWASDIVWVVLYSILILLVMLLWVDVPA*
Ga0066903_10421502523300005764Tropical Forest SoilVSEQAAEERRGWPSDVVGVVLYSMLILLVMLLWA*
Ga0066903_10425666823300005764Tropical Forest SoilMSEQAVEERRRWASDIVWVVAYSILVLLVVLLWVSVPA*
Ga0066903_10436688523300005764Tropical Forest SoilPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA*
Ga0066903_10443460833300005764Tropical Forest SoilMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA*
Ga0066903_10459786523300005764Tropical Forest SoilMNEQVVAERRHSASDIVGIVLYSIVVLLVMLLWVYVPA*
Ga0066903_10479320613300005764Tropical Forest SoilQAVEQRRSWAADIVWVVLYSIVILLVMLLWAHVPA*
Ga0066903_10498589223300005764Tropical Forest SoilMNEQVAAERRHSAPDIVGVVPYSIVVLLVMLLWVYIPA*
Ga0066903_10614086223300005764Tropical Forest SoilMSERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA*
Ga0066903_10673532913300005764Tropical Forest SoilMNEQVVAERRHSASDIVGVVLYSTVVLLVMLLWVYVPA*
Ga0066903_10692148923300005764Tropical Forest SoilTMSEQAVEERRGWASDIVWVVLYSILVLLAMLLWVLPA*
Ga0066903_10770215023300005764Tropical Forest SoilMNEQVVAERRHSASDIVGLVLYSIVVLLVMLLWVYVPA*
Ga0066903_10777350923300005764Tropical Forest SoilEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA*
Ga0066903_10784763323300005764Tropical Forest SoilMSEQAVEERRGWASDIMWVVVYSILVLLVMLLWVYV
Ga0066903_10784982613300005764Tropical Forest SoilMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWIYVPA*
Ga0066903_10790065523300005764Tropical Forest SoilLRPQGESTMSERAVEERRDWASDVLWVVVYSILVLLVMLLWVYVPA*
Ga0066903_10860888033300005764Tropical Forest SoilVSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPV*
Ga0066903_10883211033300005764Tropical Forest SoilNWAPRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVILLWVYVPA*
Ga0081455_10008269193300005937Tabebuia Heterophylla RhizosphereMTPTMSEQTVEERRGWASDIVWVVLYSILVLVVMIVWVYVPA*
Ga0070717_1094791813300006028Corn, Switchgrass And Miscanthus RhizosphereMSEQAVEERRGWASDIVWVVLYSILILLVMLLWVDVPA*
Ga0066653_1018726523300006791SoilMNEQDVEERRDRASDFVWVILYSILVLLVMLLWVSVPA
Ga0075428_10057616233300006844Populus RhizosphereMSEQAAEARRGWASDIVWVVLYSMVVLLIMVLSVHAPA*
Ga0075425_10027920923300006854Populus RhizosphereMSEQAVEEKRGWTSDIVWVVVCTILVMLLWVYVPA*
Ga0075425_10083684213300006854Populus RhizosphereEQAVEERRGWASDIVWVALYSILVLLLMVAWANIPA*
Ga0075418_1106242623300009100Populus RhizosphereMSEQVVEERRGWASDIVWVVLYSILVLLVMLLWVDVPA*
Ga0126374_1020429523300009792Tropical Forest SoilMSEQTVEERRGWASDIVWVVLYSIVILLVLLLWVHVPA*
Ga0126374_1062647213300009792Tropical Forest SoilIGPQGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA*
Ga0126374_1072859623300009792Tropical Forest SoilMSEQAVEERRGWASEIVWVVVYSILVLLVMLLWVYVPA*
Ga0126374_1084992013300009792Tropical Forest SoilMNEQVVAERRHSASDIVGAVLYSIVVLLVMLLWVYVPA*
Ga0126374_1093653613300009792Tropical Forest SoilLRPQGESTMSERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA*
Ga0126380_1045652623300010043Tropical Forest SoilMSEQAVEERWGWASDIVWVVLYSILVLLVMLLWIYVPA*
Ga0126380_1137290023300010043Tropical Forest SoilMSDQAVEERRGWTSDIVWVVAYSILVLLVMLLWVYVPA*
Ga0126380_1224931723300010043Tropical Forest SoilMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA*
Ga0126384_1002687823300010046Tropical Forest SoilMSEQTVEERRGWASDIVWVVLYSILILLVMLLWVDVPA*
Ga0126384_1031086443300010046Tropical Forest SoilMSEQATEERLGWASDIVWVVLYSILVLLIMLLWVYVPA*
Ga0126384_1043589123300010046Tropical Forest SoilMSEQAVQDRRGWASDIVWVVVYSILVLLVMLLLIDVPA*
Ga0126384_1052102323300010046Tropical Forest SoilMSEQAVGERRGWASDIVWVVVYSILVLLVMLLLVDVPA*
Ga0126384_1059123713300010046Tropical Forest SoilVPSATLRRSALNEQVVAERRHSASDIVEVVLYSIVVLLVMLLW
Ga0126384_1101356923300010046Tropical Forest SoilVSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVY
Ga0126382_1005621153300010047Tropical Forest SoilMSEQAVAERRGWASDILWVVLYSILVLLVMLLWIYVPA*
Ga0126382_1029261713300010047Tropical Forest SoilPQGEFAMSEQAVEERRGWASDIVWVVVYSILVILVMLLWV*
Ga0126382_1103718023300010047Tropical Forest SoilMSERAVQERRGWASDIVWVVLYSILVLLVMLLWV*
Ga0126382_1211173423300010047Tropical Forest SoilMSEQAVEERRRWASDIVWVVAYSILVLLVMLLWVYVPA*
Ga0126373_1082554623300010048Tropical Forest SoilMNEQVVAERRHSASDIVGVVLYSIAVLLVMLLWVYVPA*
Ga0134111_1018478213300010329Grasslands SoilMSEQAVEERRGWASDIVWVVLYLIVILLVMLLWVHVPA*
Ga0134080_1038082223300010333Grasslands SoilMSEQAVEERRGWASDIVWVVLYSIVILLVMLLWVYVPA*
Ga0126370_1015327523300010358Tropical Forest SoilMNEQVAAERRHSASEIVGVVLYSIVVLLVMLLWVYVPA*
Ga0126370_1061383323300010358Tropical Forest SoilLRPQGGPAMSERAVEERRRWASDIVWVVAYSILVLLVMLLWVYVPA*
Ga0126370_1097614023300010358Tropical Forest SoilMNEQVVTERRHSASDIVGVVLYSIVVLLVMLLWVYVPA*
Ga0126376_1234769023300010359Tropical Forest SoilMSEQAVEERRGWASDIVWVVVYSILVILVMLLWV*
Ga0126372_1089203523300010360Tropical Forest SoilMNEQVVAERRHSASDIVGAVLFSIVVLLVMLLWVYVPA*
Ga0126372_1193536023300010360Tropical Forest SoilMSEQAIEERRGWASDIVWVGVYSILVLLVMLLWVYVPA*
Ga0126372_1301053713300010360Tropical Forest SoilLRPQGKSTMSERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA*
Ga0126378_1261081123300010361Tropical Forest SoilMSEQAVEKRRGLASEIVWVVLYSVLIFLVLLLWVDVPA*
Ga0126378_1318350323300010361Tropical Forest SoilMSERAVEERRGWASDVMWVVVYSILVLLVMLLWVHVPA*
Ga0126378_1344945133300010361Tropical Forest SoilMSEQAVEERRRWASDIVWVVAYSILVLLVMLLWVYIPA*
Ga0126377_1051055023300010362Tropical Forest SoilMSEQAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA*
Ga0126377_1071744613300010362Tropical Forest SoilMNEQILAERRRSASDIVGVVFYSIVVLLVMLLWVYVPG*
Ga0126379_1062794433300010366Tropical Forest SoilMSEQAIEERRGWASDIVWVVVYSILVLLAMLLWVYVPA*
Ga0126379_1086819123300010366Tropical Forest SoilMSEQAVEQRRSWAADIVWVVLYSIVILLVMLLWAHVPA*
Ga0126379_1136227513300010366Tropical Forest SoilGRLNWAPRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA*
Ga0126379_1377703013300010366Tropical Forest SoilMSEQAVEERRGWASDIVWVAVYSILVLLVMLLWAYVPA*
Ga0126381_10218258523300010376Tropical Forest SoilRFAPLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA*
Ga0126381_10301477023300010376Tropical Forest SoilMSEQAVEERRGWASDITWVVLYSILVLLAMLLWI*
Ga0126381_10428798013300010376Tropical Forest SoilMSEQAVEQRRSWAADIVWVVLYSIVILLVMLLWVHVPA*
Ga0126381_10453362613300010376Tropical Forest SoilMNKQVLAERRHSASDIVGVVLYSIAVLLVMLLWVYVPA*
Ga0126383_1020357923300010398Tropical Forest SoilMSEQAVEERRRRASDIVWVVAYSILVLLVMLLWIYVPA*
Ga0126383_1086711233300010398Tropical Forest SoilGPQGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVHVPA*
Ga0126383_1164216923300010398Tropical Forest SoilMNEQIVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA
Ga0126383_1194275713300010398Tropical Forest SoilLGGDPCVPFATLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLV
Ga0126383_1232626213300010398Tropical Forest SoilPRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWIYVPA*
Ga0120192_1010211823300012021TerrestrialMSERAVDERQSRASDIAGVVFYSTLVLLLMLLWVYVPA*
Ga0120191_1000028223300012022TerrestrialMSEQVVEERRGWASDIVWVVLYSMLVLLVMLLWVYVPA*
Ga0137383_1019174413300012199Vadose Zone SoilMSERAVEEGRSWTSDVVWVAFYSILVLLLMLMWVNVP
Ga0137383_1106530013300012199Vadose Zone SoilGGPAMSERGVEERRRWASDIVWVVAYSILVLLVMLLWVYVPA*
Ga0137363_1145874923300012202Vadose Zone SoilMSEQAVEERWGWASDIMWVALYSILVLLVMLLWI*
Ga0137380_1113050713300012206Vadose Zone SoilMSEQAVEERRGWASDIVWGALYSILILLLMLLWV*
Ga0137384_1144896923300012357Vadose Zone SoilMSERGVDERQSWASDIVWVVFCSILVLLLMLLWAYVPA*
Ga0137410_1177718613300012944Vadose Zone SoilMSTQLVGERRDRASDVVGVTLYSILVLLVVLLCVYVP
Ga0126375_1056978523300012948Tropical Forest SoilMSDQAVEERRGWTSDIVWVVAYSILVLLVLLLWVYVPA*
Ga0126369_1051529733300012971Tropical Forest SoilAVEERRGWTSDIVWVVAYSILVLLVMLLWVYVPA*
Ga0126369_1124373823300012971Tropical Forest SoilFAPLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA*
Ga0126369_1195439013300012971Tropical Forest SoilMSEQAIEERRGWASDIVWVALYSVLVFLLMVAWANIPA*
Ga0126369_1229568823300012971Tropical Forest SoilRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA*
Ga0126369_1294774413300012971Tropical Forest SoilMSEQAVGERRGWSSDIVWVVVYSILVLLVMLLWVDV
Ga0126369_1320773213300012971Tropical Forest SoilVPFATLRRSAINEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVP
Ga0182041_1117383923300016294SoilMSEQAVEERRGWASDIMWVALYSILVLLAMLLWVYVP
Ga0182041_1156767913300016294SoilGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVVVPA
Ga0182035_1025792243300016341SoilTMSEQAVGERRGWASEIVWVVLYSIVILLIMLLWVEVPG
Ga0182039_1026674513300016422SoilMSEQAVGERRGWASEIVWVVLYSIVILLIMLLWVE
Ga0182038_1006423213300016445SoilALRPQGEPAMSEQAVEERRGWGSDIVWVVVYSILVLLVMLLWVYVPA
Ga0182038_1201852423300016445SoilSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVVVPA
Ga0184619_1018257323300018061Groundwater SedimentTMSERVEERPSWASDIGGMVFYSTLVLLVMLPWVYVAA
Ga0066667_1025753413300018433Grasslands SoilMSEQAVEERRGWASDIVWVVLYSIVILLVMLLWVHVPA
Ga0066669_1056502733300018482Grasslands SoilMSEQAVEERRGWASDIVWVVLYSIVILLVMLLWVDVLV
Ga0210380_1003613923300021082Groundwater SedimentMPMSERAVEDRQNRASDIVELAFYSILVLLLMLLWVYVPA
Ga0210400_1037734213300021170SoilLRPQGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0126371_1139902713300021560Tropical Forest SoilPQGEPAMSEQAVEERRGWASEIVWVVVYSILVLLVMLLWVYVPA
Ga0126371_1162555413300021560Tropical Forest SoilMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVP
Ga0126371_1220580113300021560Tropical Forest SoilMSERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA
Ga0126371_1248555613300021560Tropical Forest SoilMSEQAVGERRGWSSDIVWVVVYSILVLLVMLLWVDVPA
Ga0126371_1354339313300021560Tropical Forest SoilAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLWAYVPA
Ga0207684_1054463513300025910Corn, Switchgrass And Miscanthus RhizosphereMSEQAVEERRGWASDIVWVVVYSIVVLLVMLLWVYVPA
Ga0209058_113408833300026536SoilMNEQDVEERRDWASDFVWVILYSILVLLVMLLWVSVPA
Ga0209465_1008328833300027874Tropical Forest SoilMSERAVEERLGWASDVMWVVVYSILVLLVMLLWVYVPA
Ga0209465_1032586213300027874Tropical Forest SoilMSEQAVEERRRWASDIVWVVAYSILVLLVMLLWVYVPA
Ga0209526_1004653343300028047Forest SoilMSEQAVEERRGWASDIVWVVVYSILVLLVILLWVYVPA
Ga0247819_1025760723300028608SoilMSERAIEERQSSWSSDIVWVVVYSILVFLLMLLWMHIPA
Ga0307295_1002447023300028708SoilMPMSERAVEDRQNPASDIVELAFYSILVLLLMLLWVYVPA
Ga0307295_1012476313300028708SoilERAIEERQSSWSSDIVWVVVYSILVFLLMLLWMHIPA
Ga0307301_1001132753300028719SoilMSERAIEERQSSWSSDIVWVVVYSILVFLLMLLWMHIPT
Ga0307318_1037777713300028744SoilSIMSERAVEERQSSWASDIVWVVFYSILVLLLMLLWIYVPA
Ga0307280_1031584123300028768SoilMSEPAVAEGQSWASDVVWVAFYSILVLLLMLLWVY
Ga0307320_1037802623300028771SoilMSTQLVGERRDRASDVVGVTLYSILVLLVVLLCVYVPA
Ga0307289_1012691013300028875SoilGSMPMSERAVEDRQNPASDIVELAFYSILVLLLMLLWVYVPA
Ga0318516_1004970033300031543SoilMSEQAVEERRGWASDIVGVVVYSILVLLVMLLLIDVPA
Ga0318516_1023407623300031543SoilMSEQAVEERRGWASDIVWVLLYSIVVLLVMLLWVYVPA
Ga0318534_1030224513300031544SoilRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0318534_1053613723300031544SoilEPAMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0318541_1003064333300031545SoilMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA
Ga0318541_1022662813300031545SoilAMSEQAVEERRGWASDIVWVAVYSILVLLVILLWAYVPA
Ga0318538_1027541423300031546SoilTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA
Ga0318528_1009036613300031561SoilMSEQAVEERRGWASDIVGVVVYSILVLLVMLLLID
Ga0318528_1075243913300031561SoilTLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA
Ga0318515_1023873333300031572SoilMSDQAVEERRGWTSDIVWVVAYSILVLLVMLLWVYVPA
Ga0318515_1063531413300031572SoilSEQAIEERPGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0310915_1003464243300031573SoilMSEQAVEERRGWASDIVWVAVYSILVLLVILLWAYVPA
Ga0310915_1008662333300031573SoilMSEQAIEERPGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0310915_1090656623300031573SoilGPQGEPAMSEQAIEERRGWASDIVWVVVYSILVLLVMLPWVYVPA
Ga0318542_1042985913300031668SoilMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA
Ga0318572_1052919313300031681SoilLRPQGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLRVY
Ga0318560_1071462113300031682SoilLRPQGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVML
Ga0306917_1066143323300031719SoilMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVVVPA
Ga0318500_1032717913300031724SoilMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVP
Ga0318500_1040666323300031724SoilLRPQGEPAMSEQAVEERRGWGSDIVWVVVYSILVLLVMLLWVYVPA
Ga0318500_1044296013300031724SoilLRPQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA
Ga0306918_1056393213300031744SoilMSEQAVEERRGWSSDIVWVVLYSILVLLVMLLLIDIPA
Ga0306918_1094030423300031744SoilPRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA
Ga0318502_1069107223300031747SoilRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0318537_1028681923300031763SoilLTRSSTMSEQAVEERRGWASDIVGVVVYSILVLLVMLLLIDVPA
Ga0318535_1002995433300031764SoilQREFAMSEQAVEERRGWASDIVWVVVYSILVILVMLLWV
Ga0318526_1017882333300031769SoilREFAMSEQAVEERRGWASDIVWVVVYSILVILVMLLWV
Ga0318521_1073492513300031770SoilPFAPLRRSAMNEQVVAERRHSASDIVGVVLCSIVVLLVLLLWVYVPA
Ga0318546_1128771823300031771SoilLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA
Ga0318543_1039352313300031777SoilPQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA
Ga0318529_1024572713300031792SoilMSEQAIEERPGWASDIVWVVVYSILVLLVMILWVY
Ga0318529_1045820413300031792SoilLRPQGESTMSERAVEERRGWASDVMWVVVYSILVLLVLLLWVYVPA
Ga0318529_1056066323300031792SoilSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA
Ga0318548_1028302013300031793SoilLSLLHCDRKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA
Ga0318557_1028707613300031795SoilMSEQAVEERRGWASDIVWVAVYSILVLLVILLWAY
Ga0318576_1020768123300031796SoilEQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA
Ga0318568_1035217513300031819SoilALRPRGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWI
Ga0318567_1025059613300031821SoilMSEQAIEERRGWASDIVWVVVCSILVLLVMLLWVYVPA
Ga0318567_1054225213300031821SoilRRTSMSEQAIEERPGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0318567_1069017413300031821SoilWAPRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0310917_1046239123300031833SoilMSEQAIEERWGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0306919_1028951013300031879SoilLGPKEKSAMSEQAIEERWGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0306919_1048568723300031879SoilMHLRPEGEPAMSEQAVEERRGWASDIVWVVVYSILVLRVML
Ga0306919_1061306223300031879SoilMNEQVVAERRHSASDIVGVVLCSIVVLLVMLLWVYVPA
Ga0306925_1008396673300031890SoilMSEQAVGERRGWASEIVWVVLYSIVILLIMLLWVEVPG
Ga0306925_1024285923300031890SoilMNEQVVAERRHSASDIVGVVLCSIVVLLVLLLWVYVPA
Ga0306925_1067641233300031890SoilLRPQGESTMSERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA
Ga0306925_1123895023300031890SoilMSEQAVEERRGWASDIVWVVVYSILVFLVMLLLIDIPA
Ga0318520_1001927133300031897SoilMSEQAVEERRGWASDIVWVVVYSILVLLVMLLRVYVPA
Ga0306923_1009882333300031910SoilMSEQAIEERRDWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0306923_1114797613300031910SoilMSGQAVEEKRGWASDILWVVLYSILVLLVMVLWAYAPA
Ga0306923_1199924923300031910SoilMSEQAVEERRGWASDIQWVVLYSILVLLVMLLWIYVPA
Ga0306921_1010577863300031912SoilERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA
Ga0306921_1080137513300031912SoilMSEQAVEERRGWASDIVWVVLYSILVLLAMLLWVLPA
Ga0310912_1097090823300031941SoilPRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0310916_1020680813300031942SoilMSEQAVEERRGWASDTVWVVVYSILVLLVMLLWVYVPA
Ga0310916_1100611613300031942SoilTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0310916_1163393123300031942SoilPAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA
Ga0310913_1067464713300031945SoilMSEQAIEERWGWASDIVWVVVYSILVLLVMLLWVYV
Ga0310910_1100300623300031946SoilCVRFAPLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA
Ga0310909_1029173923300031947SoilSTMSEQAVEERRGWASDIVWVLLYSIVVLLVMLLWVYVPA
Ga0310909_1044600713300031947SoilMSEQAVEERRGWGSDIVWVVVYSILVLLVMLLWVYVPA
Ga0306926_1053224413300031954SoilQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA
Ga0306926_1172215613300031954SoilEPAMSEQAIEERRGWASDIVWVVVYSILVLLVMLPWVYVPA
Ga0318531_1006356933300031981SoilGLRPQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVILLWAYVPA
Ga0306922_1040220713300032001SoilRPQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA
Ga0318507_1047830513300032025SoilQVVAERRHSASDIVGVVLCSIVVLLVMLLWVYVPA
Ga0310911_1003112023300032035SoilEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0310911_1006851333300032035SoilLRPQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVILLWAYVPA
Ga0318533_1133717613300032059SoilRPSMREQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA
Ga0318553_1004898433300032068SoilMSEQAVEERRGWASDIVWVLLYSIVVLLVMLLWVY
Ga0306924_1058135523300032076SoilMHLRPEGEPAMSEQAVEERRGWASDIVWVVVYSIVVLLVMLLWVYVPA
Ga0306924_1069445713300032076SoilPEGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVVVPA
Ga0306924_1223002313300032076SoilMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA
Ga0307471_10099639613300032180Hardwood Forest SoilEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA
Ga0306920_10118826313300032261SoilMHLRPEGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVVVPA
Ga0310914_1034182833300033289SoilRAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA
Ga0318519_1017205633300033290SoilLRPQREFAMSEQAVEERRGWASDIVWVVVYSILVILVMLLWV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.