Basic Information | |
---|---|
Family ID | F017622 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 239 |
Average Sequence Length | 40 residues |
Representative Sequence | MSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 239 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 66.95 % |
% of genes near scaffold ends (potentially truncated) | 41.42 % |
% of genes from short scaffolds (< 2000 bps) | 91.63 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.598 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.431 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.791 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.874 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 239 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 18.41 |
PF03401 | TctC | 2.51 |
PF07690 | MFS_1 | 2.09 |
PF02705 | K_trans | 1.26 |
PF13924 | Lipocalin_5 | 1.26 |
PF00239 | Resolvase | 0.84 |
PF07813 | LTXXQ | 0.84 |
PF12832 | MFS_1_like | 0.42 |
PF06742 | DUF1214 | 0.42 |
PF05443 | ROS_MUCR | 0.42 |
PF02481 | DNA_processg_A | 0.42 |
PF07647 | SAM_2 | 0.42 |
PF02371 | Transposase_20 | 0.42 |
PF13415 | Kelch_3 | 0.42 |
PF12706 | Lactamase_B_2 | 0.42 |
PF00144 | Beta-lactamase | 0.42 |
PF03704 | BTAD | 0.42 |
PF13936 | HTH_38 | 0.42 |
PF00512 | HisKA | 0.42 |
PF02518 | HATPase_c | 0.42 |
PF01344 | Kelch_1 | 0.42 |
PF08241 | Methyltransf_11 | 0.42 |
PF01548 | DEDD_Tnp_IS110 | 0.42 |
PF13340 | DUF4096 | 0.42 |
PF12697 | Abhydrolase_6 | 0.42 |
PF13442 | Cytochrome_CBB3 | 0.42 |
PF13492 | GAF_3 | 0.42 |
PF03466 | LysR_substrate | 0.42 |
PF00536 | SAM_1 | 0.42 |
COG ID | Name | Functional Category | % Frequency in 239 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 18.41 |
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 3.35 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.51 |
COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 1.26 |
COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 0.84 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.84 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.84 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.42 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.42 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.42 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.42 |
COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.42 |
COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.42 |
COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.60 % |
Unclassified | root | N/A | 36.40 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000580|AF_2010_repII_A01DRAFT_1037480 | Not Available | 753 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10027088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1557 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10037053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1301 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10061190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 964 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10067314 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10094989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
3300004629|Ga0008092_11322987 | Not Available | 1082 | Open in IMG/M |
3300005093|Ga0062594_103208651 | Not Available | 513 | Open in IMG/M |
3300005332|Ga0066388_101094467 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
3300005332|Ga0066388_101154392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1318 | Open in IMG/M |
3300005332|Ga0066388_103780706 | Not Available | 772 | Open in IMG/M |
3300005332|Ga0066388_104774286 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300005332|Ga0066388_106220914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
3300005332|Ga0066388_107547568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
3300005332|Ga0066388_107628728 | Not Available | 542 | Open in IMG/M |
3300005363|Ga0008090_10135659 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005363|Ga0008090_10212040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
3300005363|Ga0008090_10232119 | Not Available | 528 | Open in IMG/M |
3300005363|Ga0008090_10254030 | Not Available | 1233 | Open in IMG/M |
3300005549|Ga0070704_102261471 | Not Available | 506 | Open in IMG/M |
3300005552|Ga0066701_10646119 | Not Available | 640 | Open in IMG/M |
3300005553|Ga0066695_10707838 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300005560|Ga0066670_10174156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1276 | Open in IMG/M |
3300005713|Ga0066905_100160584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1632 | Open in IMG/M |
3300005713|Ga0066905_100187914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1531 | Open in IMG/M |
3300005713|Ga0066905_100230155 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300005713|Ga0066905_100457071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1051 | Open in IMG/M |
3300005713|Ga0066905_100790142 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300005713|Ga0066905_101809301 | Not Available | 563 | Open in IMG/M |
3300005764|Ga0066903_100393509 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
3300005764|Ga0066903_101282110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1367 | Open in IMG/M |
3300005764|Ga0066903_101501146 | Not Available | 1272 | Open in IMG/M |
3300005764|Ga0066903_101578069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1243 | Open in IMG/M |
3300005764|Ga0066903_101606508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1233 | Open in IMG/M |
3300005764|Ga0066903_101615049 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300005764|Ga0066903_102056204 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300005764|Ga0066903_102153221 | Not Available | 1074 | Open in IMG/M |
3300005764|Ga0066903_102204997 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300005764|Ga0066903_102524019 | Not Available | 995 | Open in IMG/M |
3300005764|Ga0066903_102529598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 994 | Open in IMG/M |
3300005764|Ga0066903_102626548 | Not Available | 976 | Open in IMG/M |
3300005764|Ga0066903_102835546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 940 | Open in IMG/M |
3300005764|Ga0066903_102865698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 935 | Open in IMG/M |
3300005764|Ga0066903_103054559 | Not Available | 906 | Open in IMG/M |
3300005764|Ga0066903_103304276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 871 | Open in IMG/M |
3300005764|Ga0066903_103373166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 862 | Open in IMG/M |
3300005764|Ga0066903_103574643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 837 | Open in IMG/M |
3300005764|Ga0066903_104215025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
3300005764|Ga0066903_104256668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 765 | Open in IMG/M |
3300005764|Ga0066903_104366885 | Not Available | 755 | Open in IMG/M |
3300005764|Ga0066903_104434608 | Not Available | 749 | Open in IMG/M |
3300005764|Ga0066903_104597865 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300005764|Ga0066903_104793206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
3300005764|Ga0066903_104985892 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300005764|Ga0066903_106140862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
3300005764|Ga0066903_106735329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
3300005764|Ga0066903_106921489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
3300005764|Ga0066903_107702150 | Not Available | 554 | Open in IMG/M |
3300005764|Ga0066903_107773509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
3300005764|Ga0066903_107847633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
3300005764|Ga0066903_107849826 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005764|Ga0066903_107900655 | Not Available | 546 | Open in IMG/M |
3300005764|Ga0066903_108608880 | Not Available | 519 | Open in IMG/M |
3300005764|Ga0066903_108832110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
3300005937|Ga0081455_10008269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10848 | Open in IMG/M |
3300006028|Ga0070717_10947918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
3300006791|Ga0066653_10187265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1041 | Open in IMG/M |
3300006844|Ga0075428_100576162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1203 | Open in IMG/M |
3300006854|Ga0075425_100279209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1923 | Open in IMG/M |
3300006854|Ga0075425_100836842 | Not Available | 1054 | Open in IMG/M |
3300009100|Ga0075418_11062426 | Not Available | 877 | Open in IMG/M |
3300009792|Ga0126374_10204295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1253 | Open in IMG/M |
3300009792|Ga0126374_10626472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 798 | Open in IMG/M |
3300009792|Ga0126374_10728596 | Not Available | 749 | Open in IMG/M |
3300009792|Ga0126374_10849920 | Not Available | 702 | Open in IMG/M |
3300009792|Ga0126374_10936536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
3300010043|Ga0126380_10456526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
3300010043|Ga0126380_11372900 | Not Available | 619 | Open in IMG/M |
3300010043|Ga0126380_12249317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
3300010046|Ga0126384_10026878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3778 | Open in IMG/M |
3300010046|Ga0126384_10310864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1299 | Open in IMG/M |
3300010046|Ga0126384_10435891 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300010046|Ga0126384_10521023 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300010046|Ga0126384_10591237 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300010046|Ga0126384_11013569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
3300010047|Ga0126382_10056211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2335 | Open in IMG/M |
3300010047|Ga0126382_10292617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1218 | Open in IMG/M |
3300010047|Ga0126382_11037180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 722 | Open in IMG/M |
3300010047|Ga0126382_12111734 | Not Available | 539 | Open in IMG/M |
3300010048|Ga0126373_10825546 | Not Available | 989 | Open in IMG/M |
3300010329|Ga0134111_10184782 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300010333|Ga0134080_10380822 | Not Available | 649 | Open in IMG/M |
3300010358|Ga0126370_10153275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1683 | Open in IMG/M |
3300010358|Ga0126370_10613833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
3300010358|Ga0126370_10976140 | Not Available | 771 | Open in IMG/M |
3300010359|Ga0126376_12347690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
3300010360|Ga0126372_10892035 | Not Available | 891 | Open in IMG/M |
3300010360|Ga0126372_11935360 | Not Available | 635 | Open in IMG/M |
3300010360|Ga0126372_13010537 | Not Available | 523 | Open in IMG/M |
3300010361|Ga0126378_12610811 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300010361|Ga0126378_13183503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
3300010361|Ga0126378_13449451 | Not Available | 501 | Open in IMG/M |
3300010362|Ga0126377_10510550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1235 | Open in IMG/M |
3300010362|Ga0126377_10717446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1054 | Open in IMG/M |
3300010366|Ga0126379_10627944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1162 | Open in IMG/M |
3300010366|Ga0126379_10868191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 1004 | Open in IMG/M |
3300010366|Ga0126379_11362275 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300010366|Ga0126379_13777030 | Not Available | 507 | Open in IMG/M |
3300010376|Ga0126381_102182585 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300010376|Ga0126381_103014770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
3300010376|Ga0126381_104287980 | Not Available | 552 | Open in IMG/M |
3300010376|Ga0126381_104533626 | Not Available | 536 | Open in IMG/M |
3300010398|Ga0126383_10203579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1903 | Open in IMG/M |
3300010398|Ga0126383_10867112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 988 | Open in IMG/M |
3300010398|Ga0126383_11642169 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300010398|Ga0126383_11942757 | Not Available | 676 | Open in IMG/M |
3300010398|Ga0126383_12326262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
3300012021|Ga0120192_10102118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
3300012022|Ga0120191_10000282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3285 | Open in IMG/M |
3300012199|Ga0137383_10191744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1498 | Open in IMG/M |
3300012199|Ga0137383_11065300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
3300012202|Ga0137363_11458749 | Not Available | 575 | Open in IMG/M |
3300012206|Ga0137380_11130507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
3300012357|Ga0137384_11448969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium 13_1_40CM_3_65_7 | 535 | Open in IMG/M |
3300012944|Ga0137410_11777186 | Not Available | 544 | Open in IMG/M |
3300012948|Ga0126375_10569785 | Not Available | 859 | Open in IMG/M |
3300012971|Ga0126369_10515297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1256 | Open in IMG/M |
3300012971|Ga0126369_11243738 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300012971|Ga0126369_11954390 | Not Available | 675 | Open in IMG/M |
3300012971|Ga0126369_12295688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
3300012971|Ga0126369_12947744 | Not Available | 557 | Open in IMG/M |
3300012971|Ga0126369_13207732 | Not Available | 536 | Open in IMG/M |
3300016294|Ga0182041_11173839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
3300016294|Ga0182041_11567679 | Not Available | 607 | Open in IMG/M |
3300016341|Ga0182035_10257922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1410 | Open in IMG/M |
3300016422|Ga0182039_10266745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1403 | Open in IMG/M |
3300016445|Ga0182038_10064232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2517 | Open in IMG/M |
3300016445|Ga0182038_12018524 | Not Available | 522 | Open in IMG/M |
3300018061|Ga0184619_10182573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 962 | Open in IMG/M |
3300018433|Ga0066667_10257534 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300018482|Ga0066669_10565027 | Not Available | 993 | Open in IMG/M |
3300021082|Ga0210380_10036139 | Not Available | 2121 | Open in IMG/M |
3300021170|Ga0210400_10377342 | Not Available | 1169 | Open in IMG/M |
3300021560|Ga0126371_11399027 | Not Available | 830 | Open in IMG/M |
3300021560|Ga0126371_11625554 | Not Available | 772 | Open in IMG/M |
3300021560|Ga0126371_12205801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
3300021560|Ga0126371_12485556 | Not Available | 627 | Open in IMG/M |
3300021560|Ga0126371_13543393 | Not Available | 527 | Open in IMG/M |
3300025910|Ga0207684_10544635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 993 | Open in IMG/M |
3300026536|Ga0209058_1134088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1200 | Open in IMG/M |
3300027874|Ga0209465_10083288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1559 | Open in IMG/M |
3300027874|Ga0209465_10325862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
3300028047|Ga0209526_10046533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3053 | Open in IMG/M |
3300028608|Ga0247819_10257607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
3300028708|Ga0307295_10024470 | Not Available | 1490 | Open in IMG/M |
3300028708|Ga0307295_10124763 | Not Available | 705 | Open in IMG/M |
3300028719|Ga0307301_10011327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2527 | Open in IMG/M |
3300028744|Ga0307318_10377777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
3300028768|Ga0307280_10315841 | Not Available | 572 | Open in IMG/M |
3300028771|Ga0307320_10378026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
3300028875|Ga0307289_10126910 | Not Available | 1046 | Open in IMG/M |
3300031543|Ga0318516_10049700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2278 | Open in IMG/M |
3300031543|Ga0318516_10234076 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300031544|Ga0318534_10302245 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300031544|Ga0318534_10536137 | Not Available | 667 | Open in IMG/M |
3300031545|Ga0318541_10030643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2662 | Open in IMG/M |
3300031545|Ga0318541_10226628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1036 | Open in IMG/M |
3300031546|Ga0318538_10275414 | Not Available | 905 | Open in IMG/M |
3300031561|Ga0318528_10090366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1597 | Open in IMG/M |
3300031561|Ga0318528_10752439 | Not Available | 521 | Open in IMG/M |
3300031572|Ga0318515_10238733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 975 | Open in IMG/M |
3300031572|Ga0318515_10635314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 566 | Open in IMG/M |
3300031573|Ga0310915_10034642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3177 | Open in IMG/M |
3300031573|Ga0310915_10086623 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
3300031573|Ga0310915_10906566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga ossetica | 617 | Open in IMG/M |
3300031668|Ga0318542_10429859 | Not Available | 683 | Open in IMG/M |
3300031681|Ga0318572_10529193 | Not Available | 702 | Open in IMG/M |
3300031682|Ga0318560_10714621 | Not Available | 541 | Open in IMG/M |
3300031719|Ga0306917_10661433 | Not Available | 821 | Open in IMG/M |
3300031724|Ga0318500_10327179 | Not Available | 754 | Open in IMG/M |
3300031724|Ga0318500_10406663 | Not Available | 677 | Open in IMG/M |
3300031724|Ga0318500_10442960 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300031744|Ga0306918_10563932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
3300031744|Ga0306918_10940304 | Not Available | 672 | Open in IMG/M |
3300031747|Ga0318502_10691072 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300031763|Ga0318537_10286819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
3300031764|Ga0318535_10029954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2171 | Open in IMG/M |
3300031769|Ga0318526_10178823 | Not Available | 865 | Open in IMG/M |
3300031770|Ga0318521_10734925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
3300031771|Ga0318546_11287718 | Not Available | 513 | Open in IMG/M |
3300031777|Ga0318543_10393523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
3300031792|Ga0318529_10245727 | Not Available | 832 | Open in IMG/M |
3300031792|Ga0318529_10458204 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300031792|Ga0318529_10560663 | Not Available | 530 | Open in IMG/M |
3300031793|Ga0318548_10283020 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300031795|Ga0318557_10287076 | Not Available | 755 | Open in IMG/M |
3300031796|Ga0318576_10207681 | Not Available | 921 | Open in IMG/M |
3300031819|Ga0318568_10352175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
3300031821|Ga0318567_10250596 | Not Available | 994 | Open in IMG/M |
3300031821|Ga0318567_10542252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
3300031821|Ga0318567_10690174 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300031833|Ga0310917_10462391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 863 | Open in IMG/M |
3300031879|Ga0306919_10289510 | Not Available | 1240 | Open in IMG/M |
3300031879|Ga0306919_10485687 | Not Available | 952 | Open in IMG/M |
3300031879|Ga0306919_10613062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
3300031890|Ga0306925_10083966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3372 | Open in IMG/M |
3300031890|Ga0306925_10242859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1941 | Open in IMG/M |
3300031890|Ga0306925_10676412 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300031890|Ga0306925_11238950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 745 | Open in IMG/M |
3300031897|Ga0318520_10019271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3214 | Open in IMG/M |
3300031910|Ga0306923_10098823 | All Organisms → cellular organisms → Bacteria | 3292 | Open in IMG/M |
3300031910|Ga0306923_11147976 | Not Available | 834 | Open in IMG/M |
3300031910|Ga0306923_11999249 | Not Available | 588 | Open in IMG/M |
3300031912|Ga0306921_10105778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3265 | Open in IMG/M |
3300031912|Ga0306921_10801375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1076 | Open in IMG/M |
3300031941|Ga0310912_10970908 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300031942|Ga0310916_10206808 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
3300031942|Ga0310916_11006116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
3300031942|Ga0310916_11633931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
3300031945|Ga0310913_10674647 | Not Available | 731 | Open in IMG/M |
3300031946|Ga0310910_11003006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
3300031947|Ga0310909_10291739 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
3300031947|Ga0310909_10446007 | Not Available | 1086 | Open in IMG/M |
3300031954|Ga0306926_10532244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1441 | Open in IMG/M |
3300031954|Ga0306926_11722156 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300031981|Ga0318531_10063569 | Not Available | 1586 | Open in IMG/M |
3300032001|Ga0306922_10402207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1466 | Open in IMG/M |
3300032025|Ga0318507_10478305 | Not Available | 542 | Open in IMG/M |
3300032035|Ga0310911_10031120 | Not Available | 2662 | Open in IMG/M |
3300032035|Ga0310911_10068513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1890 | Open in IMG/M |
3300032059|Ga0318533_11337176 | Not Available | 523 | Open in IMG/M |
3300032068|Ga0318553_10048984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2076 | Open in IMG/M |
3300032076|Ga0306924_10581355 | Not Available | 1269 | Open in IMG/M |
3300032076|Ga0306924_10694457 | Not Available | 1143 | Open in IMG/M |
3300032076|Ga0306924_12230023 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300032180|Ga0307471_100996396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1005 | Open in IMG/M |
3300032261|Ga0306920_101188263 | Not Available | 1102 | Open in IMG/M |
3300033289|Ga0310914_10341828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1353 | Open in IMG/M |
3300033290|Ga0318519_10172056 | Not Available | 1222 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 23.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 20.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.51% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.09% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 2.09% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.84% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.42% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.42% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.42% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.42% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A01DRAFT_10374802 | 3300000580 | Forest Soil | MSEQAVEKRRGLASEIVWVVLYSVLIFLVMLLWVDVPA* |
AF_2010_repII_A1DRAFT_100270883 | 3300000597 | Forest Soil | MSEQAVEERRGWASDIVWVVLYSILVLLAMLLWVVPA* |
AF_2010_repII_A1DRAFT_100370532 | 3300000597 | Forest Soil | MSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA* |
AF_2010_repII_A1DRAFT_100611902 | 3300000597 | Forest Soil | MSEQAVEKRRNLASEIVWVVLYSVLIFLVMLLWVDVPA* |
AF_2010_repII_A1DRAFT_100673143 | 3300000597 | Forest Soil | DRKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA* |
AF_2010_repII_A001DRAFT_100949892 | 3300000793 | Forest Soil | MSEQAVEERRGWASDIVWVVLYSILVLLVMLLWV* |
Ga0008092_113229873 | 3300004629 | Tropical Rainforest Soil | VVHCDRKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSLHVPA* |
Ga0062594_1032086511 | 3300005093 | Soil | MSERAIEERQSSWSSDIVWVVVYSILVFLLMLLWMHIPA* |
Ga0066388_1010944671 | 3300005332 | Tropical Forest Soil | LCGEPCVPYAPLRRSAMNEQVVAERRHSASDIVGVVLYSTVVLLVMLLWVYVPA* |
Ga0066388_1011543924 | 3300005332 | Tropical Forest Soil | TCDPGESTMSEQAVEKRRGLASEIVWVVLYSVLIFLVLLLWVDVPA* |
Ga0066388_1037807061 | 3300005332 | Tropical Forest Soil | LCGDPCVPFATLRRSAMNEQVVAERRHSASDIVGAVLYSIVVLLVMLLWVYVPA* |
Ga0066388_1047742861 | 3300005332 | Tropical Forest Soil | AMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA* |
Ga0066388_1062209141 | 3300005332 | Tropical Forest Soil | KEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPG* |
Ga0066388_1075475682 | 3300005332 | Tropical Forest Soil | LCGDPCVPFAPLRRSAMNEQIVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA* |
Ga0066388_1076287281 | 3300005332 | Tropical Forest Soil | AMTEQAVEERRGWASDIVWVVAYSILVLLVMLLWVYVPA* |
Ga0008090_101356592 | 3300005363 | Tropical Rainforest Soil | EYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA* |
Ga0008090_102120402 | 3300005363 | Tropical Rainforest Soil | MSEQAVEERRGWASDIVWVVVYSILVLLVMLLLIDVPALRPRRQTG* |
Ga0008090_102321191 | 3300005363 | Tropical Rainforest Soil | VVHCDRKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMV |
Ga0008090_102540301 | 3300005363 | Tropical Rainforest Soil | LSLLHCDRKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA* |
Ga0070704_1022614712 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VPFATLRRSAMNEQVVAERRHSASDIVGVVLYSILVLLVMLLWVYVPA* |
Ga0066701_106461192 | 3300005552 | Soil | MSERAVEEGRSWTSDVVWVAFYSILVLLLMLMWVNVPA* |
Ga0066695_107078382 | 3300005553 | Soil | MSEQAVEERRGWASDIVWVVLYSIVILLVMLLWVHVPA* |
Ga0066670_101741563 | 3300005560 | Soil | MNEQDVEERRDWASDFVWVILYSILVLLVMLLWVSVPA* |
Ga0066905_1001605841 | 3300005713 | Tropical Forest Soil | MSEQAVEERRRWASDIVWVVAYSILVLLVMLLWIYVPA* |
Ga0066905_1001879142 | 3300005713 | Tropical Forest Soil | MSEQVVEETRGWASDIVWVVLYSILILLLMLLWV* |
Ga0066905_1002301552 | 3300005713 | Tropical Forest Soil | MNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA* |
Ga0066905_1004570711 | 3300005713 | Tropical Forest Soil | MSEQAVEERRGWASDIVSVVVYSILVMLLWVYVPA* |
Ga0066905_1007901423 | 3300005713 | Tropical Forest Soil | MSEQAVEERWGWASDIVWVVLYSILVLLVMLLLIDVPA* |
Ga0066905_1018093012 | 3300005713 | Tropical Forest Soil | MSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVHVPA* |
Ga0066903_1003935094 | 3300005764 | Tropical Forest Soil | MSEQAVEERRGWASDIVWVVLYSILILLVMLLWVHVPA* |
Ga0066903_1012821103 | 3300005764 | Tropical Forest Soil | MSEQAVEERWGWASEIVWVVLYSILVLLVMLLWVYVPA* |
Ga0066903_1015011461 | 3300005764 | Tropical Forest Soil | MNEQVVTERRHSASDIVGVVLYSIVVLLVMLLWVYVPA |
Ga0066903_1015780691 | 3300005764 | Tropical Forest Soil | MSEQAIEERRGWASDIVWVMVYSILVILVMLLWVYVPA* |
Ga0066903_1016065082 | 3300005764 | Tropical Forest Soil | MNEQVVAERRHSASDIVEVVLYSIVVLLVMLLWVYVPA* |
Ga0066903_1016150491 | 3300005764 | Tropical Forest Soil | MSEQAVEERRGWASDIVWVVVYSILVFLVMLLLIDIPA* |
Ga0066903_1020562042 | 3300005764 | Tropical Forest Soil | MSEQAVEERRGWASDIVWVVVYSILVLLIMLLWVYVPA* |
Ga0066903_1021532215 | 3300005764 | Tropical Forest Soil | MSEQAVEERRRWASDIVWVVAYSILVLLVMLLWVY |
Ga0066903_1022049973 | 3300005764 | Tropical Forest Soil | MNEQVVAERRHSASDIGGVVLYSIVVLLVMLLWEYVPA* |
Ga0066903_1025240191 | 3300005764 | Tropical Forest Soil | MNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYV |
Ga0066903_1025295981 | 3300005764 | Tropical Forest Soil | MSEQAVEERRGWASDIVWVMAYSILVLLVMLLWVYVPA* |
Ga0066903_1026265482 | 3300005764 | Tropical Forest Soil | MNEQIVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA* |
Ga0066903_1028355462 | 3300005764 | Tropical Forest Soil | MNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVCVPA* |
Ga0066903_1028656982 | 3300005764 | Tropical Forest Soil | MSEQAVEERRGWASDIVWVVVYSILVLLVMLLLIDVPA* |
Ga0066903_1030545592 | 3300005764 | Tropical Forest Soil | MSEQAVGERRGWSSDIVWVVVYSILVLLVMLLWVDVPA* |
Ga0066903_1033042762 | 3300005764 | Tropical Forest Soil | VVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA* |
Ga0066903_1033731661 | 3300005764 | Tropical Forest Soil | MSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVSVPA* |
Ga0066903_1035746432 | 3300005764 | Tropical Forest Soil | MSEQTIEERRGWASDIVWVVLYSILILLVMLLWVDVPA* |
Ga0066903_1042150252 | 3300005764 | Tropical Forest Soil | VSEQAAEERRGWPSDVVGVVLYSMLILLVMLLWA* |
Ga0066903_1042566682 | 3300005764 | Tropical Forest Soil | MSEQAVEERRRWASDIVWVVAYSILVLLVVLLWVSVPA* |
Ga0066903_1043668852 | 3300005764 | Tropical Forest Soil | PAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA* |
Ga0066903_1044346083 | 3300005764 | Tropical Forest Soil | MSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA* |
Ga0066903_1045978652 | 3300005764 | Tropical Forest Soil | MNEQVVAERRHSASDIVGIVLYSIVVLLVMLLWVYVPA* |
Ga0066903_1047932061 | 3300005764 | Tropical Forest Soil | QAVEQRRSWAADIVWVVLYSIVILLVMLLWAHVPA* |
Ga0066903_1049858922 | 3300005764 | Tropical Forest Soil | MNEQVAAERRHSAPDIVGVVPYSIVVLLVMLLWVYIPA* |
Ga0066903_1061408622 | 3300005764 | Tropical Forest Soil | MSERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA* |
Ga0066903_1067353291 | 3300005764 | Tropical Forest Soil | MNEQVVAERRHSASDIVGVVLYSTVVLLVMLLWVYVPA* |
Ga0066903_1069214892 | 3300005764 | Tropical Forest Soil | TMSEQAVEERRGWASDIVWVVLYSILVLLAMLLWVLPA* |
Ga0066903_1077021502 | 3300005764 | Tropical Forest Soil | MNEQVVAERRHSASDIVGLVLYSIVVLLVMLLWVYVPA* |
Ga0066903_1077735092 | 3300005764 | Tropical Forest Soil | EQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA* |
Ga0066903_1078476332 | 3300005764 | Tropical Forest Soil | MSEQAVEERRGWASDIMWVVVYSILVLLVMLLWVYV |
Ga0066903_1078498261 | 3300005764 | Tropical Forest Soil | MSEQAIEERRGWASDIVWVVVYSILVLLVMLLWIYVPA* |
Ga0066903_1079006552 | 3300005764 | Tropical Forest Soil | LRPQGESTMSERAVEERRDWASDVLWVVVYSILVLLVMLLWVYVPA* |
Ga0066903_1086088803 | 3300005764 | Tropical Forest Soil | VSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPV* |
Ga0066903_1088321103 | 3300005764 | Tropical Forest Soil | NWAPRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVILLWVYVPA* |
Ga0081455_1000826919 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTPTMSEQTVEERRGWASDIVWVVLYSILVLVVMIVWVYVPA* |
Ga0070717_109479181 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEQAVEERRGWASDIVWVVLYSILILLVMLLWVDVPA* |
Ga0066653_101872652 | 3300006791 | Soil | MNEQDVEERRDRASDFVWVILYSILVLLVMLLWVSVPA |
Ga0075428_1005761623 | 3300006844 | Populus Rhizosphere | MSEQAAEARRGWASDIVWVVLYSMVVLLIMVLSVHAPA* |
Ga0075425_1002792092 | 3300006854 | Populus Rhizosphere | MSEQAVEEKRGWTSDIVWVVVCTILVMLLWVYVPA* |
Ga0075425_1008368421 | 3300006854 | Populus Rhizosphere | EQAVEERRGWASDIVWVALYSILVLLLMVAWANIPA* |
Ga0075418_110624262 | 3300009100 | Populus Rhizosphere | MSEQVVEERRGWASDIVWVVLYSILVLLVMLLWVDVPA* |
Ga0126374_102042952 | 3300009792 | Tropical Forest Soil | MSEQTVEERRGWASDIVWVVLYSIVILLVLLLWVHVPA* |
Ga0126374_106264721 | 3300009792 | Tropical Forest Soil | IGPQGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA* |
Ga0126374_107285962 | 3300009792 | Tropical Forest Soil | MSEQAVEERRGWASEIVWVVVYSILVLLVMLLWVYVPA* |
Ga0126374_108499201 | 3300009792 | Tropical Forest Soil | MNEQVVAERRHSASDIVGAVLYSIVVLLVMLLWVYVPA* |
Ga0126374_109365361 | 3300009792 | Tropical Forest Soil | LRPQGESTMSERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA* |
Ga0126380_104565262 | 3300010043 | Tropical Forest Soil | MSEQAVEERWGWASDIVWVVLYSILVLLVMLLWIYVPA* |
Ga0126380_113729002 | 3300010043 | Tropical Forest Soil | MSDQAVEERRGWTSDIVWVVAYSILVLLVMLLWVYVPA* |
Ga0126380_122493172 | 3300010043 | Tropical Forest Soil | MSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA* |
Ga0126384_100268782 | 3300010046 | Tropical Forest Soil | MSEQTVEERRGWASDIVWVVLYSILILLVMLLWVDVPA* |
Ga0126384_103108644 | 3300010046 | Tropical Forest Soil | MSEQATEERLGWASDIVWVVLYSILVLLIMLLWVYVPA* |
Ga0126384_104358912 | 3300010046 | Tropical Forest Soil | MSEQAVQDRRGWASDIVWVVVYSILVLLVMLLLIDVPA* |
Ga0126384_105210232 | 3300010046 | Tropical Forest Soil | MSEQAVGERRGWASDIVWVVVYSILVLLVMLLLVDVPA* |
Ga0126384_105912371 | 3300010046 | Tropical Forest Soil | VPSATLRRSALNEQVVAERRHSASDIVEVVLYSIVVLLVMLLW |
Ga0126384_110135692 | 3300010046 | Tropical Forest Soil | VSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVY |
Ga0126382_100562115 | 3300010047 | Tropical Forest Soil | MSEQAVAERRGWASDILWVVLYSILVLLVMLLWIYVPA* |
Ga0126382_102926171 | 3300010047 | Tropical Forest Soil | PQGEFAMSEQAVEERRGWASDIVWVVVYSILVILVMLLWV* |
Ga0126382_110371802 | 3300010047 | Tropical Forest Soil | MSERAVQERRGWASDIVWVVLYSILVLLVMLLWV* |
Ga0126382_121117342 | 3300010047 | Tropical Forest Soil | MSEQAVEERRRWASDIVWVVAYSILVLLVMLLWVYVPA* |
Ga0126373_108255462 | 3300010048 | Tropical Forest Soil | MNEQVVAERRHSASDIVGVVLYSIAVLLVMLLWVYVPA* |
Ga0134111_101847821 | 3300010329 | Grasslands Soil | MSEQAVEERRGWASDIVWVVLYLIVILLVMLLWVHVPA* |
Ga0134080_103808222 | 3300010333 | Grasslands Soil | MSEQAVEERRGWASDIVWVVLYSIVILLVMLLWVYVPA* |
Ga0126370_101532752 | 3300010358 | Tropical Forest Soil | MNEQVAAERRHSASEIVGVVLYSIVVLLVMLLWVYVPA* |
Ga0126370_106138332 | 3300010358 | Tropical Forest Soil | LRPQGGPAMSERAVEERRRWASDIVWVVAYSILVLLVMLLWVYVPA* |
Ga0126370_109761402 | 3300010358 | Tropical Forest Soil | MNEQVVTERRHSASDIVGVVLYSIVVLLVMLLWVYVPA* |
Ga0126376_123476902 | 3300010359 | Tropical Forest Soil | MSEQAVEERRGWASDIVWVVVYSILVILVMLLWV* |
Ga0126372_108920352 | 3300010360 | Tropical Forest Soil | MNEQVVAERRHSASDIVGAVLFSIVVLLVMLLWVYVPA* |
Ga0126372_119353602 | 3300010360 | Tropical Forest Soil | MSEQAIEERRGWASDIVWVGVYSILVLLVMLLWVYVPA* |
Ga0126372_130105371 | 3300010360 | Tropical Forest Soil | LRPQGKSTMSERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA* |
Ga0126378_126108112 | 3300010361 | Tropical Forest Soil | MSEQAVEKRRGLASEIVWVVLYSVLIFLVLLLWVDVPA* |
Ga0126378_131835032 | 3300010361 | Tropical Forest Soil | MSERAVEERRGWASDVMWVVVYSILVLLVMLLWVHVPA* |
Ga0126378_134494513 | 3300010361 | Tropical Forest Soil | MSEQAVEERRRWASDIVWVVAYSILVLLVMLLWVYIPA* |
Ga0126377_105105502 | 3300010362 | Tropical Forest Soil | MSEQAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA* |
Ga0126377_107174461 | 3300010362 | Tropical Forest Soil | MNEQILAERRRSASDIVGVVFYSIVVLLVMLLWVYVPG* |
Ga0126379_106279443 | 3300010366 | Tropical Forest Soil | MSEQAIEERRGWASDIVWVVVYSILVLLAMLLWVYVPA* |
Ga0126379_108681912 | 3300010366 | Tropical Forest Soil | MSEQAVEQRRSWAADIVWVVLYSIVILLVMLLWAHVPA* |
Ga0126379_113622751 | 3300010366 | Tropical Forest Soil | GRLNWAPRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA* |
Ga0126379_137770301 | 3300010366 | Tropical Forest Soil | MSEQAVEERRGWASDIVWVAVYSILVLLVMLLWAYVPA* |
Ga0126381_1021825852 | 3300010376 | Tropical Forest Soil | RFAPLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA* |
Ga0126381_1030147702 | 3300010376 | Tropical Forest Soil | MSEQAVEERRGWASDITWVVLYSILVLLAMLLWI* |
Ga0126381_1042879801 | 3300010376 | Tropical Forest Soil | MSEQAVEQRRSWAADIVWVVLYSIVILLVMLLWVHVPA* |
Ga0126381_1045336261 | 3300010376 | Tropical Forest Soil | MNKQVLAERRHSASDIVGVVLYSIAVLLVMLLWVYVPA* |
Ga0126383_102035792 | 3300010398 | Tropical Forest Soil | MSEQAVEERRRRASDIVWVVAYSILVLLVMLLWIYVPA* |
Ga0126383_108671123 | 3300010398 | Tropical Forest Soil | GPQGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVHVPA* |
Ga0126383_116421692 | 3300010398 | Tropical Forest Soil | MNEQIVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA |
Ga0126383_119427571 | 3300010398 | Tropical Forest Soil | LGGDPCVPFATLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLV |
Ga0126383_123262621 | 3300010398 | Tropical Forest Soil | PRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWIYVPA* |
Ga0120192_101021182 | 3300012021 | Terrestrial | MSERAVDERQSRASDIAGVVFYSTLVLLLMLLWVYVPA* |
Ga0120191_100002822 | 3300012022 | Terrestrial | MSEQVVEERRGWASDIVWVVLYSMLVLLVMLLWVYVPA* |
Ga0137383_101917441 | 3300012199 | Vadose Zone Soil | MSERAVEEGRSWTSDVVWVAFYSILVLLLMLMWVNVP |
Ga0137383_110653001 | 3300012199 | Vadose Zone Soil | GGPAMSERGVEERRRWASDIVWVVAYSILVLLVMLLWVYVPA* |
Ga0137363_114587492 | 3300012202 | Vadose Zone Soil | MSEQAVEERWGWASDIMWVALYSILVLLVMLLWI* |
Ga0137380_111305071 | 3300012206 | Vadose Zone Soil | MSEQAVEERRGWASDIVWGALYSILILLLMLLWV* |
Ga0137384_114489692 | 3300012357 | Vadose Zone Soil | MSERGVDERQSWASDIVWVVFCSILVLLLMLLWAYVPA* |
Ga0137410_117771861 | 3300012944 | Vadose Zone Soil | MSTQLVGERRDRASDVVGVTLYSILVLLVVLLCVYVP |
Ga0126375_105697852 | 3300012948 | Tropical Forest Soil | MSDQAVEERRGWTSDIVWVVAYSILVLLVLLLWVYVPA* |
Ga0126369_105152973 | 3300012971 | Tropical Forest Soil | AVEERRGWTSDIVWVVAYSILVLLVMLLWVYVPA* |
Ga0126369_112437382 | 3300012971 | Tropical Forest Soil | FAPLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA* |
Ga0126369_119543901 | 3300012971 | Tropical Forest Soil | MSEQAIEERRGWASDIVWVALYSVLVFLLMVAWANIPA* |
Ga0126369_122956882 | 3300012971 | Tropical Forest Soil | RTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA* |
Ga0126369_129477441 | 3300012971 | Tropical Forest Soil | MSEQAVGERRGWSSDIVWVVVYSILVLLVMLLWVDV |
Ga0126369_132077321 | 3300012971 | Tropical Forest Soil | VPFATLRRSAINEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVP |
Ga0182041_111738392 | 3300016294 | Soil | MSEQAVEERRGWASDIMWVALYSILVLLAMLLWVYVP |
Ga0182041_115676791 | 3300016294 | Soil | GEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVVVPA |
Ga0182035_102579224 | 3300016341 | Soil | TMSEQAVGERRGWASEIVWVVLYSIVILLIMLLWVEVPG |
Ga0182039_102667451 | 3300016422 | Soil | MSEQAVGERRGWASEIVWVVLYSIVILLIMLLWVE |
Ga0182038_100642321 | 3300016445 | Soil | ALRPQGEPAMSEQAVEERRGWGSDIVWVVVYSILVLLVMLLWVYVPA |
Ga0182038_120185242 | 3300016445 | Soil | SEQAVEERRGWASDIVWVVVYSILVLLVMLLWVVVPA |
Ga0184619_101825732 | 3300018061 | Groundwater Sediment | TMSERVEERPSWASDIGGMVFYSTLVLLVMLPWVYVAA |
Ga0066667_102575341 | 3300018433 | Grasslands Soil | MSEQAVEERRGWASDIVWVVLYSIVILLVMLLWVHVPA |
Ga0066669_105650273 | 3300018482 | Grasslands Soil | MSEQAVEERRGWASDIVWVVLYSIVILLVMLLWVDVLV |
Ga0210380_100361392 | 3300021082 | Groundwater Sediment | MPMSERAVEDRQNRASDIVELAFYSILVLLLMLLWVYVPA |
Ga0210400_103773421 | 3300021170 | Soil | LRPQGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0126371_113990271 | 3300021560 | Tropical Forest Soil | PQGEPAMSEQAVEERRGWASEIVWVVVYSILVLLVMLLWVYVPA |
Ga0126371_116255541 | 3300021560 | Tropical Forest Soil | MSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVP |
Ga0126371_122058011 | 3300021560 | Tropical Forest Soil | MSERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA |
Ga0126371_124855561 | 3300021560 | Tropical Forest Soil | MSEQAVGERRGWSSDIVWVVVYSILVLLVMLLWVDVPA |
Ga0126371_135433931 | 3300021560 | Tropical Forest Soil | AMSEQAVEERRGWASDIVWVAVYSILVLLVMLLWAYVPA |
Ga0207684_105446351 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEQAVEERRGWASDIVWVVVYSIVVLLVMLLWVYVPA |
Ga0209058_11340883 | 3300026536 | Soil | MNEQDVEERRDWASDFVWVILYSILVLLVMLLWVSVPA |
Ga0209465_100832883 | 3300027874 | Tropical Forest Soil | MSERAVEERLGWASDVMWVVVYSILVLLVMLLWVYVPA |
Ga0209465_103258621 | 3300027874 | Tropical Forest Soil | MSEQAVEERRRWASDIVWVVAYSILVLLVMLLWVYVPA |
Ga0209526_100465334 | 3300028047 | Forest Soil | MSEQAVEERRGWASDIVWVVVYSILVLLVILLWVYVPA |
Ga0247819_102576072 | 3300028608 | Soil | MSERAIEERQSSWSSDIVWVVVYSILVFLLMLLWMHIPA |
Ga0307295_100244702 | 3300028708 | Soil | MPMSERAVEDRQNPASDIVELAFYSILVLLLMLLWVYVPA |
Ga0307295_101247631 | 3300028708 | Soil | ERAIEERQSSWSSDIVWVVVYSILVFLLMLLWMHIPA |
Ga0307301_100113275 | 3300028719 | Soil | MSERAIEERQSSWSSDIVWVVVYSILVFLLMLLWMHIPT |
Ga0307318_103777771 | 3300028744 | Soil | SIMSERAVEERQSSWASDIVWVVFYSILVLLLMLLWIYVPA |
Ga0307280_103158412 | 3300028768 | Soil | MSEPAVAEGQSWASDVVWVAFYSILVLLLMLLWVY |
Ga0307320_103780262 | 3300028771 | Soil | MSTQLVGERRDRASDVVGVTLYSILVLLVVLLCVYVPA |
Ga0307289_101269101 | 3300028875 | Soil | GSMPMSERAVEDRQNPASDIVELAFYSILVLLLMLLWVYVPA |
Ga0318516_100497003 | 3300031543 | Soil | MSEQAVEERRGWASDIVGVVVYSILVLLVMLLLIDVPA |
Ga0318516_102340762 | 3300031543 | Soil | MSEQAVEERRGWASDIVWVLLYSIVVLLVMLLWVYVPA |
Ga0318534_103022451 | 3300031544 | Soil | RTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0318534_105361372 | 3300031544 | Soil | EPAMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0318541_100306433 | 3300031545 | Soil | MSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA |
Ga0318541_102266281 | 3300031545 | Soil | AMSEQAVEERRGWASDIVWVAVYSILVLLVILLWAYVPA |
Ga0318538_102754142 | 3300031546 | Soil | TSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA |
Ga0318528_100903661 | 3300031561 | Soil | MSEQAVEERRGWASDIVGVVVYSILVLLVMLLLID |
Ga0318528_107524391 | 3300031561 | Soil | TLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA |
Ga0318515_102387333 | 3300031572 | Soil | MSDQAVEERRGWTSDIVWVVAYSILVLLVMLLWVYVPA |
Ga0318515_106353141 | 3300031572 | Soil | SEQAIEERPGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0310915_100346424 | 3300031573 | Soil | MSEQAVEERRGWASDIVWVAVYSILVLLVILLWAYVPA |
Ga0310915_100866233 | 3300031573 | Soil | MSEQAIEERPGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0310915_109065662 | 3300031573 | Soil | GPQGEPAMSEQAIEERRGWASDIVWVVVYSILVLLVMLPWVYVPA |
Ga0318542_104298591 | 3300031668 | Soil | MSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA |
Ga0318572_105291931 | 3300031681 | Soil | LRPQGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLRVY |
Ga0318560_107146211 | 3300031682 | Soil | LRPQGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVML |
Ga0306917_106614332 | 3300031719 | Soil | MSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVVVPA |
Ga0318500_103271791 | 3300031724 | Soil | MSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVP |
Ga0318500_104066632 | 3300031724 | Soil | LRPQGEPAMSEQAVEERRGWGSDIVWVVVYSILVLLVMLLWVYVPA |
Ga0318500_104429601 | 3300031724 | Soil | LRPQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA |
Ga0306918_105639321 | 3300031744 | Soil | MSEQAVEERRGWSSDIVWVVLYSILVLLVMLLLIDIPA |
Ga0306918_109403042 | 3300031744 | Soil | PRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA |
Ga0318502_106910722 | 3300031747 | Soil | RRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0318537_102868192 | 3300031763 | Soil | LTRSSTMSEQAVEERRGWASDIVGVVVYSILVLLVMLLLIDVPA |
Ga0318535_100299543 | 3300031764 | Soil | QREFAMSEQAVEERRGWASDIVWVVVYSILVILVMLLWV |
Ga0318526_101788233 | 3300031769 | Soil | REFAMSEQAVEERRGWASDIVWVVVYSILVILVMLLWV |
Ga0318521_107349251 | 3300031770 | Soil | PFAPLRRSAMNEQVVAERRHSASDIVGVVLCSIVVLLVLLLWVYVPA |
Ga0318546_112877182 | 3300031771 | Soil | LRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA |
Ga0318543_103935231 | 3300031777 | Soil | PQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA |
Ga0318529_102457271 | 3300031792 | Soil | MSEQAIEERPGWASDIVWVVVYSILVLLVMILWVY |
Ga0318529_104582041 | 3300031792 | Soil | LRPQGESTMSERAVEERRGWASDVMWVVVYSILVLLVLLLWVYVPA |
Ga0318529_105606632 | 3300031792 | Soil | SMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA |
Ga0318548_102830201 | 3300031793 | Soil | LSLLHCDRKEYPTMSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA |
Ga0318557_102870761 | 3300031795 | Soil | MSEQAVEERRGWASDIVWVAVYSILVLLVILLWAY |
Ga0318576_102076812 | 3300031796 | Soil | EQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA |
Ga0318568_103521751 | 3300031819 | Soil | ALRPRGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWI |
Ga0318567_102505961 | 3300031821 | Soil | MSEQAIEERRGWASDIVWVVVCSILVLLVMLLWVYVPA |
Ga0318567_105422521 | 3300031821 | Soil | RRTSMSEQAIEERPGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0318567_106901741 | 3300031821 | Soil | WAPRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0310917_104623912 | 3300031833 | Soil | MSEQAIEERWGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0306919_102895101 | 3300031879 | Soil | LGPKEKSAMSEQAIEERWGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0306919_104856872 | 3300031879 | Soil | MHLRPEGEPAMSEQAVEERRGWASDIVWVVVYSILVLRVML |
Ga0306919_106130622 | 3300031879 | Soil | MNEQVVAERRHSASDIVGVVLCSIVVLLVMLLWVYVPA |
Ga0306925_100839667 | 3300031890 | Soil | MSEQAVGERRGWASEIVWVVLYSIVILLIMLLWVEVPG |
Ga0306925_102428592 | 3300031890 | Soil | MNEQVVAERRHSASDIVGVVLCSIVVLLVLLLWVYVPA |
Ga0306925_106764123 | 3300031890 | Soil | LRPQGESTMSERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA |
Ga0306925_112389502 | 3300031890 | Soil | MSEQAVEERRGWASDIVWVVVYSILVFLVMLLLIDIPA |
Ga0318520_100192713 | 3300031897 | Soil | MSEQAVEERRGWASDIVWVVVYSILVLLVMLLRVYVPA |
Ga0306923_100988233 | 3300031910 | Soil | MSEQAIEERRDWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0306923_111479761 | 3300031910 | Soil | MSGQAVEEKRGWASDILWVVLYSILVLLVMVLWAYAPA |
Ga0306923_119992492 | 3300031910 | Soil | MSEQAVEERRGWASDIQWVVLYSILVLLVMLLWIYVPA |
Ga0306921_101057786 | 3300031912 | Soil | ERAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA |
Ga0306921_108013751 | 3300031912 | Soil | MSEQAVEERRGWASDIVWVVLYSILVLLAMLLWVLPA |
Ga0310912_109709082 | 3300031941 | Soil | PRRTSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0310916_102068081 | 3300031942 | Soil | MSEQAVEERRGWASDTVWVVVYSILVLLVMLLWVYVPA |
Ga0310916_110061161 | 3300031942 | Soil | TSMSEQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0310916_116339312 | 3300031942 | Soil | PAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA |
Ga0310913_106746471 | 3300031945 | Soil | MSEQAIEERWGWASDIVWVVVYSILVLLVMLLWVYV |
Ga0310910_110030062 | 3300031946 | Soil | CVRFAPLRRSAMNEQVVAERRHSASDIVGVVLYSIVVLLVMLLWVYVPA |
Ga0310909_102917392 | 3300031947 | Soil | STMSEQAVEERRGWASDIVWVLLYSIVVLLVMLLWVYVPA |
Ga0310909_104460071 | 3300031947 | Soil | MSEQAVEERRGWGSDIVWVVVYSILVLLVMLLWVYVPA |
Ga0306926_105322441 | 3300031954 | Soil | QGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA |
Ga0306926_117221561 | 3300031954 | Soil | EPAMSEQAIEERRGWASDIVWVVVYSILVLLVMLPWVYVPA |
Ga0318531_100635693 | 3300031981 | Soil | GLRPQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVILLWAYVPA |
Ga0306922_104022071 | 3300032001 | Soil | RPQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVMLLAYVPA |
Ga0318507_104783051 | 3300032025 | Soil | QVVAERRHSASDIVGVVLCSIVVLLVMLLWVYVPA |
Ga0310911_100311202 | 3300032035 | Soil | EQAIEERRGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0310911_100685133 | 3300032035 | Soil | LRPQGEPAMSEQAVEERRGWASDIVWVAVYSILVLLVILLWAYVPA |
Ga0318533_113371761 | 3300032059 | Soil | RPSMREQAIEERRGWASDIVWVVVYSILVLLVMLLWVSVPA |
Ga0318553_100489843 | 3300032068 | Soil | MSEQAVEERRGWASDIVWVLLYSIVVLLVMLLWVY |
Ga0306924_105813552 | 3300032076 | Soil | MHLRPEGEPAMSEQAVEERRGWASDIVWVVVYSIVVLLVMLLWVYVPA |
Ga0306924_106944571 | 3300032076 | Soil | PEGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVVVPA |
Ga0306924_122300231 | 3300032076 | Soil | MSEQAAEERRGWASDIVWVVLYSMVVLLIMVLSVHVPA |
Ga0307471_1009963961 | 3300032180 | Hardwood Forest Soil | EQAVEERRGWASDIVWVVVYSILVLLVMLLWVYVPA |
Ga0306920_1011882631 | 3300032261 | Soil | MHLRPEGEPAMSEQAVEERRGWASDIVWVVVYSILVLLVMLLWVVVPA |
Ga0310914_103418283 | 3300033289 | Soil | RAVEERRGWASDVMWVVVYSILVLLVMLLWVYVPA |
Ga0318519_101720563 | 3300033290 | Soil | LRPQREFAMSEQAVEERRGWASDIVWVVVYSILVILVMLLWV |
⦗Top⦘ |