Basic Information | |
---|---|
Family ID | F017708 |
Family Type | Metagenome |
Number of Sequences | 239 |
Average Sequence Length | 39 residues |
Representative Sequence | MAKVIEFYIPKNFRKPLRTVAQPQLGKIIEFCPQTKRSA |
Number of Associated Samples | 166 |
Number of Associated Scaffolds | 238 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.26 % |
% of genes near scaffold ends (potentially truncated) | 23.85 % |
% of genes from short scaffolds (< 2000 bps) | 49.37 % |
Associated GOLD sequencing projects | 153 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.14 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.644 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.941 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.117 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.48% β-sheet: 0.00% Coil/Unstructured: 95.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 238 Family Scaffolds |
---|---|---|
PF00158 | Sigma54_activat | 23.95 |
PF02954 | HTH_8 | 20.59 |
PF00196 | GerE | 7.98 |
PF07730 | HisKA_3 | 4.20 |
PF00535 | Glycos_transf_2 | 2.10 |
PF02518 | HATPase_c | 1.68 |
PF10677 | DUF2490 | 1.26 |
PF09364 | XFP_N | 0.84 |
PF13620 | CarboxypepD_reg | 0.84 |
PF07676 | PD40 | 0.84 |
PF00069 | Pkinase | 0.84 |
PF13185 | GAF_2 | 0.84 |
PF12762 | DDE_Tnp_IS1595 | 0.42 |
PF01344 | Kelch_1 | 0.42 |
PF07883 | Cupin_2 | 0.42 |
PF03537 | Glyco_hydro_114 | 0.42 |
PF08240 | ADH_N | 0.42 |
PF08269 | dCache_2 | 0.42 |
PF13231 | PMT_2 | 0.42 |
PF08447 | PAS_3 | 0.42 |
PF13538 | UvrD_C_2 | 0.42 |
PF01370 | Epimerase | 0.42 |
PF13492 | GAF_3 | 0.42 |
PF00311 | PEPcase | 0.42 |
PF08808 | RES | 0.42 |
PF00072 | Response_reg | 0.42 |
PF00106 | adh_short | 0.42 |
PF13088 | BNR_2 | 0.42 |
PF00456 | Transketolase_N | 0.42 |
PF00149 | Metallophos | 0.42 |
PF00923 | TAL_FSA | 0.42 |
PF08220 | HTH_DeoR | 0.42 |
PF05717 | TnpB_IS66 | 0.42 |
PF13493 | DUF4118 | 0.42 |
PF11645 | PDDEXK_5 | 0.42 |
PF12833 | HTH_18 | 0.42 |
PF00561 | Abhydrolase_1 | 0.42 |
PF03886 | ABC_trans_aux | 0.42 |
PF09335 | SNARE_assoc | 0.42 |
PF01791 | DeoC | 0.42 |
PF13581 | HATPase_c_2 | 0.42 |
PF00393 | 6PGD | 0.42 |
PF02321 | OEP | 0.42 |
PF13424 | TPR_12 | 0.42 |
COG ID | Name | Functional Category | % Frequency in 238 Family Scaffolds |
---|---|---|---|
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 4.20 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 4.20 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 4.20 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 4.20 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.36 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.42 |
COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.42 |
COG0362 | 6-phosphogluconate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.42 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.42 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
COG1023 | 6-phosphogluconate dehydrogenase (decarboxylating) | Carbohydrate transport and metabolism [G] | 0.42 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.42 |
COG2342 | Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) | Carbohydrate transport and metabolism [G] | 0.42 |
COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 0.42 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.42 |
COG3868 | Alpha-1,4 polygalactosaminidase, glycosyl hydrolase family GH114 | Carbohydrate transport and metabolism [G] | 0.42 |
COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.42 |
COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10005110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 9228 | Open in IMG/M |
3300000567|JGI12270J11330_10009349 | All Organisms → cellular organisms → Bacteria | 6613 | Open in IMG/M |
3300000567|JGI12270J11330_10049985 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
3300001431|F14TB_101673075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
3300001661|JGI12053J15887_10014962 | All Organisms → cellular organisms → Bacteria | 4301 | Open in IMG/M |
3300003218|JGI26339J46600_10059607 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300003219|JGI26341J46601_10156985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10179799 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300004092|Ga0062389_104247758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300004114|Ga0062593_100929912 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300004114|Ga0062593_101545245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300004152|Ga0062386_100361512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1164 | Open in IMG/M |
3300004152|Ga0062386_100568321 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300005289|Ga0065704_10342687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
3300005290|Ga0065712_10172827 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300005329|Ga0070683_100723835 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300005329|Ga0070683_101342485 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300005329|Ga0070683_101538827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300005334|Ga0068869_101618660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300005335|Ga0070666_10321851 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300005343|Ga0070687_101195985 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300005436|Ga0070713_101578091 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300005437|Ga0070710_11224561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300005440|Ga0070705_100893855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
3300005445|Ga0070708_100022268 | All Organisms → cellular organisms → Bacteria | 5371 | Open in IMG/M |
3300005468|Ga0070707_100879009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 860 | Open in IMG/M |
3300005526|Ga0073909_10035549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1734 | Open in IMG/M |
3300005535|Ga0070684_100317403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1431 | Open in IMG/M |
3300005536|Ga0070697_100309190 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300005539|Ga0068853_102055474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300005542|Ga0070732_10033771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2920 | Open in IMG/M |
3300005542|Ga0070732_10059963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2209 | Open in IMG/M |
3300005542|Ga0070732_10227383 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300005602|Ga0070762_10410995 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300005602|Ga0070762_10604084 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300005618|Ga0068864_101356842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
3300005921|Ga0070766_10871802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300005995|Ga0066790_10087670 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
3300006052|Ga0075029_100000227 | All Organisms → cellular organisms → Bacteria | 30805 | Open in IMG/M |
3300006052|Ga0075029_100018198 | All Organisms → cellular organisms → Bacteria | 3912 | Open in IMG/M |
3300006052|Ga0075029_100637642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
3300006059|Ga0075017_100187174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1491 | Open in IMG/M |
3300006059|Ga0075017_100207418 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300006059|Ga0075017_100927013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300006086|Ga0075019_10003275 | All Organisms → cellular organisms → Bacteria | 9229 | Open in IMG/M |
3300006086|Ga0075019_10026790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3226 | Open in IMG/M |
3300006102|Ga0075015_100497505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300006162|Ga0075030_100171663 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
3300006172|Ga0075018_10779325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300006176|Ga0070765_100107220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2426 | Open in IMG/M |
3300006176|Ga0070765_100677738 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300006354|Ga0075021_10053800 | All Organisms → cellular organisms → Bacteria | 2330 | Open in IMG/M |
3300006358|Ga0068871_100295351 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300006893|Ga0073928_10000795 | All Organisms → cellular organisms → Bacteria | 67182 | Open in IMG/M |
3300009101|Ga0105247_10508610 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300009101|Ga0105247_10856287 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300009177|Ga0105248_10026741 | All Organisms → cellular organisms → Bacteria | 6416 | Open in IMG/M |
3300009519|Ga0116108_1126096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300009519|Ga0116108_1234114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300009522|Ga0116218_1001403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15316 | Open in IMG/M |
3300009623|Ga0116133_1005110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3332 | Open in IMG/M |
3300009623|Ga0116133_1054982 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300009630|Ga0116114_1162205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300009632|Ga0116102_1015160 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
3300009640|Ga0116126_1004338 | All Organisms → cellular organisms → Bacteria | 7483 | Open in IMG/M |
3300009644|Ga0116121_1000044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 61652 | Open in IMG/M |
3300009645|Ga0116106_1074190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
3300009700|Ga0116217_10769710 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300009824|Ga0116219_10035493 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
3300009839|Ga0116223_10031713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3582 | Open in IMG/M |
3300009839|Ga0116223_10470448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
3300010048|Ga0126373_10070957 | All Organisms → cellular organisms → Bacteria | 3147 | Open in IMG/M |
3300010339|Ga0074046_10005033 | All Organisms → cellular organisms → Bacteria | 10608 | Open in IMG/M |
3300010339|Ga0074046_10009174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7490 | Open in IMG/M |
3300010339|Ga0074046_10045872 | All Organisms → cellular organisms → Bacteria | 2918 | Open in IMG/M |
3300010339|Ga0074046_10095081 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
3300010339|Ga0074046_10148905 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
3300010341|Ga0074045_10001660 | All Organisms → cellular organisms → Bacteria | 21253 | Open in IMG/M |
3300010341|Ga0074045_10083955 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
3300010343|Ga0074044_10004661 | All Organisms → cellular organisms → Bacteria | 11292 | Open in IMG/M |
3300010343|Ga0074044_10394813 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300010379|Ga0136449_100048955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 9547 | Open in IMG/M |
3300010379|Ga0136449_104078546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300012202|Ga0137363_10001853 | All Organisms → cellular organisms → Bacteria | 12385 | Open in IMG/M |
3300012357|Ga0137384_11536527 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300012971|Ga0126369_10005149 | All Organisms → cellular organisms → Bacteria | 9631 | Open in IMG/M |
3300013296|Ga0157374_10023787 | All Organisms → cellular organisms → Bacteria | 5485 | Open in IMG/M |
3300014162|Ga0181538_10119850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1533 | Open in IMG/M |
3300014165|Ga0181523_10040628 | All Organisms → cellular organisms → Bacteria | 2936 | Open in IMG/M |
3300014165|Ga0181523_10101007 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
3300014200|Ga0181526_11092882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300014491|Ga0182014_10022897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5175 | Open in IMG/M |
3300014491|Ga0182014_10040617 | All Organisms → cellular organisms → Bacteria | 3376 | Open in IMG/M |
3300014638|Ga0181536_10002362 | All Organisms → cellular organisms → Bacteria | 21460 | Open in IMG/M |
3300015241|Ga0137418_11037602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300015371|Ga0132258_10053755 | All Organisms → cellular organisms → Bacteria | 9233 | Open in IMG/M |
3300015371|Ga0132258_11021820 | All Organisms → cellular organisms → Bacteria | 2089 | Open in IMG/M |
3300015373|Ga0132257_100446843 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300015374|Ga0132255_100660585 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300017925|Ga0187856_1006388 | All Organisms → cellular organisms → Bacteria | 7407 | Open in IMG/M |
3300017927|Ga0187824_10032839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1567 | Open in IMG/M |
3300017935|Ga0187848_10023242 | All Organisms → cellular organisms → Bacteria | 3219 | Open in IMG/M |
3300017936|Ga0187821_10004927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4441 | Open in IMG/M |
3300017940|Ga0187853_10393691 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300017943|Ga0187819_10101128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1723 | Open in IMG/M |
3300017946|Ga0187879_10001194 | All Organisms → cellular organisms → Bacteria | 17782 | Open in IMG/M |
3300017946|Ga0187879_10062186 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
3300017948|Ga0187847_10002791 | All Organisms → cellular organisms → Bacteria | 13814 | Open in IMG/M |
3300017955|Ga0187817_10803280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300018001|Ga0187815_10007061 | All Organisms → cellular organisms → Bacteria | 5032 | Open in IMG/M |
3300018002|Ga0187868_1081629 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300018007|Ga0187805_10000696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11457 | Open in IMG/M |
3300018007|Ga0187805_10338718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300018014|Ga0187860_1252294 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300018016|Ga0187880_1013972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5085 | Open in IMG/M |
3300018016|Ga0187880_1015380 | All Organisms → cellular organisms → Bacteria | 4774 | Open in IMG/M |
3300018016|Ga0187880_1184395 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300018035|Ga0187875_10608934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300018037|Ga0187883_10294712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
3300018040|Ga0187862_10495884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300019882|Ga0193713_1132562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300020579|Ga0210407_10031446 | All Organisms → cellular organisms → Bacteria | 3946 | Open in IMG/M |
3300020579|Ga0210407_10149262 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
3300020580|Ga0210403_10179303 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300020581|Ga0210399_10048169 | All Organisms → cellular organisms → Bacteria | 3422 | Open in IMG/M |
3300020581|Ga0210399_10049059 | All Organisms → cellular organisms → Bacteria | 3390 | Open in IMG/M |
3300020581|Ga0210399_10105261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 2310 | Open in IMG/M |
3300020582|Ga0210395_10010651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6841 | Open in IMG/M |
3300020582|Ga0210395_10672723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
3300020583|Ga0210401_10002663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 19617 | Open in IMG/M |
3300020583|Ga0210401_10004771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14076 | Open in IMG/M |
3300020583|Ga0210401_10063829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3468 | Open in IMG/M |
3300020583|Ga0210401_10511937 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300021088|Ga0210404_10044200 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
3300021168|Ga0210406_10019970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6262 | Open in IMG/M |
3300021168|Ga0210406_10030451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4884 | Open in IMG/M |
3300021170|Ga0210400_10010797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7352 | Open in IMG/M |
3300021170|Ga0210400_11503571 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300021171|Ga0210405_10138663 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
3300021171|Ga0210405_10774375 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300021181|Ga0210388_10055355 | All Organisms → cellular organisms → Bacteria | 3312 | Open in IMG/M |
3300021401|Ga0210393_10042149 | All Organisms → cellular organisms → Bacteria | 3583 | Open in IMG/M |
3300021401|Ga0210393_10639551 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300021407|Ga0210383_10201565 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
3300021420|Ga0210394_10579731 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300021420|Ga0210394_11623647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300021432|Ga0210384_10002779 | All Organisms → cellular organisms → Bacteria | 21011 | Open in IMG/M |
3300021474|Ga0210390_10673891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
3300021475|Ga0210392_10051273 | All Organisms → cellular organisms → Bacteria | 2542 | Open in IMG/M |
3300021475|Ga0210392_10548804 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300021478|Ga0210402_10373580 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
3300021478|Ga0210402_10538969 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300021479|Ga0210410_10193992 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300021479|Ga0210410_10210466 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
3300021559|Ga0210409_10025534 | All Organisms → cellular organisms → Bacteria | 5716 | Open in IMG/M |
3300021559|Ga0210409_10203535 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
3300021560|Ga0126371_10080392 | All Organisms → cellular organisms → Bacteria | 3196 | Open in IMG/M |
3300022557|Ga0212123_10001328 | All Organisms → cellular organisms → Bacteria | 69942 | Open in IMG/M |
3300022881|Ga0224545_1000690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7167 | Open in IMG/M |
3300023090|Ga0224558_1003502 | All Organisms → cellular organisms → Bacteria | 13006 | Open in IMG/M |
3300023090|Ga0224558_1003502 | All Organisms → cellular organisms → Bacteria | 13006 | Open in IMG/M |
3300023090|Ga0224558_1007320 | All Organisms → cellular organisms → Bacteria | 7398 | Open in IMG/M |
3300023259|Ga0224551_1001134 | All Organisms → cellular organisms → Bacteria | 4483 | Open in IMG/M |
3300025432|Ga0208821_1008429 | All Organisms → cellular organisms → Bacteria | 2680 | Open in IMG/M |
3300025500|Ga0208686_1041136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1109 | Open in IMG/M |
3300025907|Ga0207645_10007624 | All Organisms → cellular organisms → Bacteria | 7626 | Open in IMG/M |
3300025910|Ga0207684_11512438 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300025914|Ga0207671_10140915 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
3300025922|Ga0207646_10165419 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
3300025927|Ga0207687_10009095 | All Organisms → cellular organisms → Bacteria | 6495 | Open in IMG/M |
3300025945|Ga0207679_10047909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3108 | Open in IMG/M |
3300026078|Ga0207702_10165137 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300026078|Ga0207702_10432525 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300026078|Ga0207702_12101213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300026088|Ga0207641_10008627 | All Organisms → cellular organisms → Bacteria | 8414 | Open in IMG/M |
3300026088|Ga0207641_10013975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6583 | Open in IMG/M |
3300026294|Ga0209839_10035455 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
3300027070|Ga0208365_1004304 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
3300027073|Ga0208366_1001678 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
3300027117|Ga0209732_1000410 | All Organisms → cellular organisms → Bacteria | 5822 | Open in IMG/M |
3300027376|Ga0209004_1095270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300027502|Ga0209622_1000285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6394 | Open in IMG/M |
3300027548|Ga0209523_1003289 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
3300027587|Ga0209220_1028503 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300027625|Ga0208044_1004406 | All Organisms → cellular organisms → Bacteria | 6141 | Open in IMG/M |
3300027625|Ga0208044_1008217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4174 | Open in IMG/M |
3300027629|Ga0209422_1016120 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
3300027635|Ga0209625_1016751 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
3300027645|Ga0209117_1001141 | All Organisms → cellular organisms → Bacteria | 9675 | Open in IMG/M |
3300027696|Ga0208696_1258309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300027783|Ga0209448_10000524 | All Organisms → cellular organisms → Bacteria | 12720 | Open in IMG/M |
3300027812|Ga0209656_10028941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3306 | Open in IMG/M |
3300027824|Ga0209040_10000072 | All Organisms → cellular organisms → Bacteria | 59058 | Open in IMG/M |
3300027824|Ga0209040_10071706 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300027824|Ga0209040_10209566 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300027825|Ga0209039_10005588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8605 | Open in IMG/M |
3300027825|Ga0209039_10007371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7034 | Open in IMG/M |
3300027825|Ga0209039_10008900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6116 | Open in IMG/M |
3300027854|Ga0209517_10048543 | All Organisms → cellular organisms → Bacteria | 3237 | Open in IMG/M |
3300027894|Ga0209068_10038484 | All Organisms → cellular organisms → Bacteria | 2396 | Open in IMG/M |
3300027898|Ga0209067_10002582 | All Organisms → cellular organisms → Bacteria | 10652 | Open in IMG/M |
3300027898|Ga0209067_10005990 | All Organisms → cellular organisms → Bacteria | 6719 | Open in IMG/M |
3300027905|Ga0209415_10075296 | All Organisms → cellular organisms → Bacteria | 3955 | Open in IMG/M |
3300027905|Ga0209415_10190490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1959 | Open in IMG/M |
3300027911|Ga0209698_10030087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4979 | Open in IMG/M |
3300027911|Ga0209698_10033101 | All Organisms → cellular organisms → Bacteria | 4706 | Open in IMG/M |
3300027911|Ga0209698_10115385 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
3300027911|Ga0209698_10163516 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
3300028017|Ga0265356_1000749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5509 | Open in IMG/M |
3300028047|Ga0209526_10009857 | All Organisms → cellular organisms → Bacteria | 6578 | Open in IMG/M |
3300030659|Ga0316363_10010389 | All Organisms → cellular organisms → Bacteria | 5584 | Open in IMG/M |
3300031715|Ga0307476_10133625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1773 | Open in IMG/M |
3300031718|Ga0307474_10004056 | All Organisms → cellular organisms → Bacteria | 10550 | Open in IMG/M |
3300031720|Ga0307469_11759225 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300031740|Ga0307468_100021050 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
3300031753|Ga0307477_10169035 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300031823|Ga0307478_10051975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 3042 | Open in IMG/M |
3300032160|Ga0311301_10083286 | All Organisms → cellular organisms → Bacteria | 6518 | Open in IMG/M |
3300032160|Ga0311301_10148771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 4247 | Open in IMG/M |
3300032160|Ga0311301_10315233 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
3300032180|Ga0307471_100009375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6480 | Open in IMG/M |
3300032770|Ga0335085_10001575 | All Organisms → cellular organisms → Bacteria | 47115 | Open in IMG/M |
3300032770|Ga0335085_10036822 | All Organisms → cellular organisms → Bacteria | 6751 | Open in IMG/M |
3300032770|Ga0335085_10150010 | All Organisms → cellular organisms → Bacteria | 2926 | Open in IMG/M |
3300032770|Ga0335085_10338397 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
3300032782|Ga0335082_11343779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300032783|Ga0335079_10149341 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
3300032828|Ga0335080_10235249 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
3300032829|Ga0335070_10064305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3967 | Open in IMG/M |
3300032829|Ga0335070_11727053 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300032892|Ga0335081_10098264 | All Organisms → cellular organisms → Bacteria | 4361 | Open in IMG/M |
3300032892|Ga0335081_10431423 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300033158|Ga0335077_10255291 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
3300033158|Ga0335077_11715255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300033402|Ga0326728_10000012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 850090 | Open in IMG/M |
3300033402|Ga0326728_10125444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2925 | Open in IMG/M |
3300033405|Ga0326727_10343858 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300033412|Ga0310810_10197933 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
3300033433|Ga0326726_10234364 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.64% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.37% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.95% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.86% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.44% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.44% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.44% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.60% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 3.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.35% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.93% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.09% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.09% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.09% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.67% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.67% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.26% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.26% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.84% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.42% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100051102 | 3300000567 | Peatlands Soil | MAKVIEFYIPKSFRKQLRPVAQPQLGKIIEFWQPTKRSA* |
JGI12270J11330_100093493 | 3300000567 | Peatlands Soil | MAKVIEFYIPKNFRKPLMTAAQPQLGKIIEFCPQTKKSA* |
JGI12270J11330_100499852 | 3300000567 | Peatlands Soil | MAKVIEFYIPKNFRKPFRVVAQPQLGKIIEFCPQTKRSA* |
F14TB_1016730751 | 3300001431 | Soil | MAKVIEFYVPKNVRKPLRTVAQPQLGKIIEFCPRTKRLA* |
JGI12053J15887_100149621 | 3300001661 | Forest Soil | MAKVIEFYIPKRFRKPLRAAPQXEFGKVVEFHPQTKKSA* |
JGI26339J46600_100596071 | 3300003218 | Bog Forest Soil | MAKVIEFYVPKNFRKPLRTVAQPQLGRIVEFCPPTKRSA* |
JGI26341J46601_101569851 | 3300003219 | Bog Forest Soil | MAKVIEFYMPKNFRKPLRTVAQPQLGKIIEFCPQTKRSA* |
JGIcombinedJ51221_101797993 | 3300003505 | Forest Soil | MAKVIEFYIPKNFRKPLRAVAQPQLGKIIEFCPQTKRSA* |
Ga0062389_1042477581 | 3300004092 | Bog Forest Soil | MAKVIEFYIPKNFRKPLRTVAQPQVGKIIEFCPQTKRSA* |
Ga0062593_1009299121 | 3300004114 | Soil | MAKAIEFYIPKNFRKPLRTVAEPQLGKIIEFAPQTKRSA* |
Ga0062593_1015452451 | 3300004114 | Soil | MAKVIEFYIPKNFRKTLRTVAQPQLAKIIEFCQQTKRSA* |
Ga0062386_1003615122 | 3300004152 | Bog Forest Soil | MAKVIEFYIPKNFRKPLRTAAEPQLGKIIEFCTQTKRSA* |
Ga0062386_1005683212 | 3300004152 | Bog Forest Soil | MAKVIEFYTPKNFRKPLRTVAQTQLAKVIEFCPQTKRSA* |
Ga0065704_103426872 | 3300005289 | Switchgrass Rhizosphere | MAKVIEFYIPKNFRKPLRTVAQPQLGKIIEFCPQTKRSA* |
Ga0065712_101728272 | 3300005290 | Miscanthus Rhizosphere | MAKVIEFYIPKSFRKQSRTVAQPQLGKIVEFCPPTKRSA* |
Ga0070683_1007238352 | 3300005329 | Corn Rhizosphere | MAKVIEFYIPKNFHKSFRTVAQAQLGKLIEFYPQTKKPA* |
Ga0070683_1013424851 | 3300005329 | Corn Rhizosphere | MAKVIEFYIPKNFRKTSRTVAQPQLAKIIEFCQQTKRSA* |
Ga0070683_1015388271 | 3300005329 | Corn Rhizosphere | MAKVIEFYIPKNVRKPLRTVAQPQLGKIIEFCPRTKRLA* |
Ga0068869_1016186602 | 3300005334 | Miscanthus Rhizosphere | MAKVIEFYIPKNFRKTFRTVAPPQLGKIIEFCQQTKRSA* |
Ga0070666_103218512 | 3300005335 | Switchgrass Rhizosphere | MAKVIEFYIPKNFRKSLRTVAQAQLGKLIEFYPQTKKPA* |
Ga0070687_1011959853 | 3300005343 | Switchgrass Rhizosphere | EIVMAKVIEFYIPKNFRKSLRTVAQAQLGKLIEFYPQTKKPA* |
Ga0070713_1015780912 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RFNRLQEIVMAKVIEFYIPQSFRKPFRTAAQPQLGKIIEFCAQTKRSA* |
Ga0070710_112245612 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA* |
Ga0070705_1008938552 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFCIPKNFRKPFKAMAQAQLGKIIEFCPQTKRSA* |
Ga0070708_1000222683 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYIPKNFRKPFKAMAQAQLGKIIEFCPQTKRSA* |
Ga0070707_1008790091 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYIPTNFRKPLRTPPQPQLGKIIEFCPQTKRSA* |
Ga0073909_100355493 | 3300005526 | Surface Soil | MAKVIEFYIPKNFRKPFRAVAQAQLGKIIEFCSQTKRSA* |
Ga0070684_1003174031 | 3300005535 | Corn Rhizosphere | MAKVIEFYIPKNFRKSLRTVAQVQLGKLIEFYPQTKKPA* |
Ga0070697_1003091902 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIDFYIPKNFRKPFRAVAQAQLGKIIEFCPQTKRSA* |
Ga0068853_1020554743 | 3300005539 | Corn Rhizosphere | VMAKVIEFYIPKNFRKTFRTVAPAQLGKIIEFCQQTKRSA* |
Ga0070732_100337714 | 3300005542 | Surface Soil | MAKIIEFYVPTNFRKRLRTAAQPQLGKLIEFCSQTKRSA* |
Ga0070732_100599633 | 3300005542 | Surface Soil | VAKVIEFYIPNSFRKTLKWVPELQRGKIIEFCPQTKKSA* |
Ga0070732_102273833 | 3300005542 | Surface Soil | MAKVIEFYIPKNFRKPLRTAAQPQLGKVIEFCPQAKRSA* |
Ga0070762_104109952 | 3300005602 | Soil | MAKVIEFYIPKNFRKPLRTAAHPRFGKIIEFCPQTKRSA* |
Ga0070762_106040843 | 3300005602 | Soil | MAKVIEFYIPKDFRKALRTAAQPRFGKIIEFCPQSKRSA* |
Ga0068864_1013568421 | 3300005618 | Switchgrass Rhizosphere | MAKVIEFYVPKNVRKPLRTVAQPQLGKIVEFCPKTKKSA* |
Ga0070766_108718021 | 3300005921 | Soil | MAKVIEFYVPKNFRKPLRTAAQPQLGKIIEFDPQTKRSA* |
Ga0066790_100876702 | 3300005995 | Soil | MAQVIEFYMPKNFQKPLRTVAQPQLGKIIEFCPQTKRSA* |
Ga0075029_10000022725 | 3300006052 | Watersheds | MAKVIEFYIPKNFRTPLRAAAQPQLGKIIEFCPPTKRSA* |
Ga0075029_1000181988 | 3300006052 | Watersheds | MAKVIEFYIPKSFRKPSRTLAQPLLGKIIEFCPQTKRSA* |
Ga0075029_1006376422 | 3300006052 | Watersheds | MAKVIEFYIPQSFRKPFKTAAQPQLGKIIEFCAQTKRSA* |
Ga0075017_1001871744 | 3300006059 | Watersheds | MAKVIEFYIPKNFRKTLRTVAEPQLGKIIEFRPQTKRSA* |
Ga0075017_1002074182 | 3300006059 | Watersheds | MAKVIEFYVPKNFRQPLRTAPQPQLGKIIEFCPQTKRSA* |
Ga0075017_1009270131 | 3300006059 | Watersheds | EIVMAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCSQTKRSA* |
Ga0075019_100032753 | 3300006086 | Watersheds | MAKVIEFYIPNNFRKPLRTSPQPQLGKIIEFCPQTKRLA* |
Ga0075019_100267902 | 3300006086 | Watersheds | MAKVIEFYIPKNFRKPLRTVAQPQLGKIIEFCPQVKRSA* |
Ga0075015_1004975051 | 3300006102 | Watersheds | MAKVIEFYIPKNFRKPFRTAAQPQLGKIIEFCSQTKRS |
Ga0075030_1001716633 | 3300006162 | Watersheds | MTKVIEFYMPKNFRKSLRTVAQPQLGKIIEFCPQTKRSA* |
Ga0075018_107793251 | 3300006172 | Watersheds | EIVMAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA* |
Ga0070765_1001072201 | 3300006176 | Soil | QEIVMAKVIEFYIPKNFRKSLRMAAQPQLGKIIEFCRTRGD* |
Ga0070765_1006777382 | 3300006176 | Soil | SRRNVMAKVIEFYIPKNFRKALRTAASPQLGKIIEFCPQTKRSA* |
Ga0075021_100538003 | 3300006354 | Watersheds | MAKVIEFYVPKNFRKTLRTVAQPQLGKIIEFRPQNKRSA* |
Ga0068871_1002953512 | 3300006358 | Miscanthus Rhizosphere | MAKVIEFYIPKNVRKPLRTVAQPQLGKIVEFCPKTKKSA* |
Ga0073928_1000079542 | 3300006893 | Iron-Sulfur Acid Spring | MAKVIEFYIPKNFRKPLRAEAQPQLGKIIEFCPQTKRSA* |
Ga0105247_105086102 | 3300009101 | Switchgrass Rhizosphere | AKAIEFYIPKNFRKPLRTVAEPQLGKIIEFAPQTKRSA* |
Ga0105247_108562871 | 3300009101 | Switchgrass Rhizosphere | LTRSHEIVMAKVIEFYIPKNFRKSLRTVAQAQLGKLIEFYPQTKKPA* |
Ga0105248_100267412 | 3300009177 | Switchgrass Rhizosphere | MAKVIEFYIPKNFRKSLRTVAQAQLGKLIEFYPRRRNPLN* |
Ga0116108_11260961 | 3300009519 | Peatland | MAKVIEFYIPQNFRKPVRTVAQPQLGKIIEFCPQTKR |
Ga0116108_12341141 | 3300009519 | Peatland | RFNRPQEIVMAKVIEFYIPKNFRKPLRAVAQPQLGKIIEFCPQTKRSA* |
Ga0116218_10014034 | 3300009522 | Peatlands Soil | MAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCSQTKRSA* |
Ga0116133_10051105 | 3300009623 | Peatland | MAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCLQTKRSA* |
Ga0116133_10549822 | 3300009623 | Peatland | MAKVIEFYIPKNFQKPLRTVAQPQLGEIIEFCPQTKRSA* |
Ga0116114_11622051 | 3300009630 | Peatland | EIVMVKVIEFYIPKNFLKPLRTAAQPQLGKIIEFCPQTKRSA* |
Ga0116102_10151601 | 3300009632 | Peatland | MAKVIEFYIPKNFRKPLSTAAQPQLGKIIEFCPQTKRSA* |
Ga0116126_10043384 | 3300009640 | Peatland | MANVIEFYIPKNFRKPLRTAPQPLGKIIEFCPQAKKSA* |
Ga0116121_100004429 | 3300009644 | Peatland | MPKVIEFYMPKNFRKPLRTVAQPQPGKVIEFCPRTKRSA* |
Ga0116106_10741901 | 3300009645 | Peatland | VMAKVIEFYIPKNFQKPLRTVAQPQLGEIIEFCPQTKRSA* |
Ga0116217_107697101 | 3300009700 | Peatlands Soil | RLQEIVMAKVIEFYIPKNFRKLLRTAAQPQLGKIIEFCPPTKRSA* |
Ga0116219_100354932 | 3300009824 | Peatlands Soil | MTRVIEFYIPKNFRKPLRAAAQRQLGKIIEFCPPTKRSA* |
Ga0116223_100317134 | 3300009839 | Peatlands Soil | MAKVIEFYMPQKFRKPLRTVAQPQLGKIIEFCPQTKRSA* |
Ga0116223_104704481 | 3300009839 | Peatlands Soil | MTKVIEFYIPKNFRKSLRTAAQPQLGKIIEFCPQTKR |
Ga0126373_100709573 | 3300010048 | Tropical Forest Soil | MAKVIEFYIPKNFRKPLRTAIQPQLGKIIEFCPQTKRSA* |
Ga0074046_1000503312 | 3300010339 | Bog Forest Soil | MAKVIEFYMPKNFRKPLRTVDQPQLGKIIEFCPQTKRSA* |
Ga0074046_100091744 | 3300010339 | Bog Forest Soil | MAKVIEFYVPKNFRKPLRAMAQPQLGKIIEFCPQTKRSA* |
Ga0074046_100458723 | 3300010339 | Bog Forest Soil | MAKVIEFYIPKNFRKPLRTAAQPQLGKIIEICPQARRSA* |
Ga0074046_100950813 | 3300010339 | Bog Forest Soil | MAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQAKRSA* |
Ga0074046_101489053 | 3300010339 | Bog Forest Soil | MAKVIEFYMPKNFRKPLRTVAQPQLGKIIEFCPQT |
Ga0074045_100016608 | 3300010341 | Bog Forest Soil | MTKIIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA* |
Ga0074045_100839553 | 3300010341 | Bog Forest Soil | MAKVIEFYIPKNFRKPLRTVAQSQLGKIIEFCPQTKKSA* |
Ga0074044_100046616 | 3300010343 | Bog Forest Soil | MAKVIEFYIPKNLRKPLRTVAQPQLGKIIEFCPQTKRSA* |
Ga0074044_103948132 | 3300010343 | Bog Forest Soil | QEIVMAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQAKRSA* |
Ga0136449_10004895517 | 3300010379 | Peatlands Soil | MAKVIEFYIPKNFRKPLRTVAQPQLGKIIEFCPQTRRSA* |
Ga0136449_1040785461 | 3300010379 | Peatlands Soil | IVMAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA* |
Ga0137363_1000185310 | 3300012202 | Vadose Zone Soil | MAKVIEFYMPKNFQKPLRTAAQPQLGKIIEFCPQTKRSA* |
Ga0137384_115365271 | 3300012357 | Vadose Zone Soil | LQEIVMAKVIEIYMPKNFQKPLRTAAQPQLGKIIEFCPQTKRSA* |
Ga0126369_1000514915 | 3300012971 | Tropical Forest Soil | MAKVIEFYIPKNFRKPLTNVSQSQLGKIIEFRAQTKRSA* |
Ga0157374_1002378710 | 3300013296 | Miscanthus Rhizosphere | MAKVIEFYIPKNFRKSFRTVAQAQLGKLIEFYPQTKRPA* |
Ga0181538_101198503 | 3300014162 | Bog | MAKVIEFYIPKNFRKPLRAVASPQLGKIIEFCPQT |
Ga0181523_100406285 | 3300014165 | Bog | MAKVIEFYIPKNFQKPLRTVAQPQLGKIIEFCPQTKRSA* |
Ga0181523_101010073 | 3300014165 | Bog | MAKVIEFYIPKNFRKALRTVAQPQLGKIIEFCPQTKKSA* |
Ga0181526_110928821 | 3300014200 | Bog | MAKVIEFYIPKDFRKPLRTAAQPQLGKIIEFCPQTK |
Ga0182014_100228974 | 3300014491 | Bog | MAKVIEFCIPKNFRKPLRAEAQPQLGKIIEFCPQTKRSA* |
Ga0182014_100406173 | 3300014491 | Bog | MARVIEFYIPKNFRKPLRAEAQPQFGKIIEFCPQTKRSA* |
Ga0181536_1000236211 | 3300014638 | Bog | MAKVIEFYIPKNFRKPLRTPAQPQLGKIIEFCPQTKRSA* |
Ga0137418_110376021 | 3300015241 | Vadose Zone Soil | MAKVIAFYTPKNFRKPLKSAPKVQNGKIIEFCPQTKKSA* |
Ga0132258_100537558 | 3300015371 | Arabidopsis Rhizosphere | MAKVIEFYTPKNSRKPLSTVAQPQLGKIIEFPPQTKRSA* |
Ga0132258_110218204 | 3300015371 | Arabidopsis Rhizosphere | MAKVIEFYVPKNFRKLLRTLPQPQLGKIVEFCPPTKRSA* |
Ga0132257_1004468432 | 3300015373 | Arabidopsis Rhizosphere | MAKVIEFYIPQSFRKPFRTAAQPQLGQIIEFCAQTKRSA* |
Ga0132255_1006605854 | 3300015374 | Arabidopsis Rhizosphere | MAKVSEFYVPKNFRKLLRTLPQPQLGKIVEFCPPTKRSA* |
Ga0187856_10063886 | 3300017925 | Peatland | MAKVIEFYIPKNFRKPLSTAAQPQLGKIIEFCPQTKRSA |
Ga0187824_100328394 | 3300017927 | Freshwater Sediment | MAKLIEFHIPKNFRKPLRTVALPQLGKILEFCPRTK |
Ga0187848_100232426 | 3300017935 | Peatland | MAKVIEFYIPKNFQKPLRTVAQPQLGEIIEFCPQTKRSA |
Ga0187821_100049273 | 3300017936 | Freshwater Sediment | MAKVIEFYIPKNFRKPLRTVARPQLGKIIEFCLRTKRSA |
Ga0187853_103936911 | 3300017940 | Peatland | EIVMAKVIEFYIPKNFRKPLRTPAQPQLGKIIEFCPQTKRSA |
Ga0187819_101011281 | 3300017943 | Freshwater Sediment | MAKVIEFYIPKNFRKPLRTVAQPQLGKIIEFCPQAKRSA |
Ga0187879_1000119414 | 3300017946 | Peatland | MAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCLQTKRSA |
Ga0187879_100621863 | 3300017946 | Peatland | MAKVIEFYIPKNFRKPLRAVAQLQLGKIIEFCPQTKRSA |
Ga0187847_100027915 | 3300017948 | Peatland | MPKVIEFYMPKNFRKPLRTVAQPQPGKVIEFCPRTKRSA |
Ga0187817_108032802 | 3300017955 | Freshwater Sediment | MAKVIEFYIPKNFRKPLRAVAQPQLGKIIEFFPQTRRSA |
Ga0187815_100070616 | 3300018001 | Freshwater Sediment | MTKVIEFYIPKNFRKSLRTVAQPQLGKIIEFCPQTKRSA |
Ga0187868_10816291 | 3300018002 | Peatland | IVMAKVIEFYIPKNFRKPLRAVAQPQLGKIIEFCPQTKRSA |
Ga0187805_100006963 | 3300018007 | Freshwater Sediment | MAKVIEFYIPKNFRKPLRTAVQPQLGKIIEFCPQTRRSA |
Ga0187805_103387181 | 3300018007 | Freshwater Sediment | PTEVKEMVMAKVIEFYIPKNFRKPLRTVAQPQLGRIIEFCPQTKRSA |
Ga0187860_12522942 | 3300018014 | Peatland | MAKVIEFYIPQNFRKPVRTVAQPQLGKIIEFCPQTKRS |
Ga0187880_10139726 | 3300018016 | Peatland | MAKVIEFYIPKNFLKPLRTAAQPQLGKIIEFCPQTKRSA |
Ga0187880_10153804 | 3300018016 | Peatland | MANVIEFYIPKNFRKPLRTAPQPLGKIIEFCPQAKKSA |
Ga0187880_11843952 | 3300018016 | Peatland | QEIVMAKVIEFYIPKNFRKPLRAVAQPQLGKIIEFCPQTKRSA |
Ga0187875_106089341 | 3300018035 | Peatland | MAKVIEFYIPKNFRKPLSTGAQPQLGKIIEFGPQTK |
Ga0187883_102947122 | 3300018037 | Peatland | MAKVIEFYIPKNFLKPLRTAAQPQLGKIIEFCPQTKR |
Ga0187862_104958841 | 3300018040 | Peatland | EIVMAKVIEFYIPKNFRKPLRAVAQPQLGKIIEFCPQTKRSA |
Ga0193713_11325623 | 3300019882 | Soil | EVKEIVMAKVIEFYIPKNFRKPLGTVALPQLGKIIEFCPQTKRSA |
Ga0210407_100314465 | 3300020579 | Soil | MAKVIEFYMPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA |
Ga0210407_101492621 | 3300020579 | Soil | AKVIEFYIPKNFRKPLRTAAQLQLGKIIEFCPQTKRSA |
Ga0210403_101793032 | 3300020580 | Soil | MTKVIEFYVPKNFRKPLRMAAQPQLGKIIEFYPQTKKSA |
Ga0210399_100481694 | 3300020581 | Soil | MAKVIEFYIPKNFRKPLRAVAQPQLGKIIEFCPQRKEI |
Ga0210399_100490593 | 3300020581 | Soil | MAKVIEFYVLKNFRKPQRAAAQPQLGKIIEFCPQTKRSA |
Ga0210399_101052611 | 3300020581 | Soil | MAKVIEFYMPKNFRKPLRTAAQPQLGKIIEFCPQMKRSA |
Ga0210395_1001065110 | 3300020582 | Soil | MAKVIEFHIPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA |
Ga0210395_106727231 | 3300020582 | Soil | KVIEFYIPKDFRKALRTAAQPRFGKIIEFCPQSKRSA |
Ga0210401_100026633 | 3300020583 | Soil | MAKVIEFYIPKNFRQPLRTAVQPQLGKIIEFCPQTKRSA |
Ga0210401_1000477112 | 3300020583 | Soil | MAKVIEFYIPKNFRKPLRAMAQPQLGKIIEFCPQTKRSA |
Ga0210401_100638295 | 3300020583 | Soil | MARVIEIYIPKNFRKPFRTVAQPQLGKIIEFRPETKRPA |
Ga0210401_105119371 | 3300020583 | Soil | AKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA |
Ga0210404_100442002 | 3300021088 | Soil | MAKIIEFYVPTNFRKPLRTADQPQLGKLIEFCSQTKRSA |
Ga0210406_100199706 | 3300021168 | Soil | MAKVIEFYMPKNFRKTLRTAAQPQLGKIIEFCPQTKRTA |
Ga0210406_100304513 | 3300021168 | Soil | MAKVIEFYIPKNFRKALRTAAQPRFGKIIEFCPQSKRSA |
Ga0210400_100107972 | 3300021170 | Soil | MAKVIAFYVPKNFRKPLRPAAQLKVGKIIEFCPQTKRSA |
Ga0210400_115035711 | 3300021170 | Soil | SRRNDMAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA |
Ga0210405_101386632 | 3300021171 | Soil | MAKVIEFYIPKNFRKALRTAAPLQPGKIIEFCPQTKRSA |
Ga0210405_107743752 | 3300021171 | Soil | MAKVIEFYIPKNFRKALRTAAQPRFGKIIEFCPQT |
Ga0210388_100553553 | 3300021181 | Soil | MAKVIEFYVPKNFRKALRTAAQPRFGKIIEFCPQTKRSA |
Ga0210393_100421493 | 3300021401 | Soil | MAKVIEFYIPKNFRKALRTAAQPRFGKIIEFCPQTRRSA |
Ga0210393_106395513 | 3300021401 | Soil | MAKVIEFYIPKNFRKALRTAAPLQFGKIIEFCPQTNRSA |
Ga0210383_102015651 | 3300021407 | Soil | IVMAKVIEFYIPKNFRKPLRTAAQPQLGKIIKFCPQTKRSA |
Ga0210394_105797312 | 3300021420 | Soil | MARVIEFYVPKNFRKPLKTAAQPQLGQIIEFHPQTKRSA |
Ga0210394_116236473 | 3300021420 | Soil | LQEIVMAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA |
Ga0210384_1000277914 | 3300021432 | Soil | MAKVIEFYIPKNFRRPLSPAAQPQLGKIIEFCAQTKRSA |
Ga0210390_106738912 | 3300021474 | Soil | RRNVMAKVIEFYIPKDFRKALRTAAQPRFGKIIEFCPQSKRSA |
Ga0210392_100512735 | 3300021475 | Soil | MAKIIEFYTPKSFRKPLRTIAQPQLGKTIEFCPQTKRSA |
Ga0210392_105488042 | 3300021475 | Soil | IKEIVMARVIEIYIPKNFRKPFRTVAQPQLGKIIEFRPETKRSA |
Ga0210402_103735803 | 3300021478 | Soil | NRLQEIVMAKVIEFYIPKNFRKPLRAVAQPQLGKIIEFCPQRKEI |
Ga0210402_105389692 | 3300021478 | Soil | MAKVIEFYIPKNFRKVLRAAAQAQFGKIIEFCPQTKRSA |
Ga0210410_101939922 | 3300021479 | Soil | MAKVIEFYVLKNFRKPQSTAAQLQLGKIIEFCPQTKRSA |
Ga0210410_102104664 | 3300021479 | Soil | MARVIEFYVPKNFRKPLRTAAQPQLGQIIEFYPQTKRSA |
Ga0210409_100255342 | 3300021559 | Soil | MAKVIEFYIPKNFRKALRTADQPQFGKIIEFCPPTKRPA |
Ga0210409_102035351 | 3300021559 | Soil | EIVMAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA |
Ga0126371_100803925 | 3300021560 | Tropical Forest Soil | MAKVIEFYIPKNFRKPLTNVSQSQLGKIIEFRAQTKRSA |
Ga0212123_1000132840 | 3300022557 | Iron-Sulfur Acid Spring | MAKVIEFYIPKNFRKPLRAEAQPQLGKIIEFCPQTKRSA |
Ga0224545_10006905 | 3300022881 | Soil | MAKVIEFYRPKNFRKPLTTVAQPQLGKIIEFCAQTRKSA |
Ga0224558_100350215 | 3300023090 | Soil | MARVIEFYIPKNFRKPLRAEAQPQFGKIIEFCPQTKRSA |
Ga0224558_10035024 | 3300023090 | Soil | MAKVIEFCIPKNFRKPLRAEAQPQLGKIIEFCPQTKRSA |
Ga0224558_10073205 | 3300023090 | Soil | MANVIEFYIPKNFRKLLRTAPQPQLGKIIEFCPQTKKSA |
Ga0224551_10011342 | 3300023259 | Soil | MAKVIEFYIPKNFRKALRTAVPPQLGKIIEFCPQTKKSA |
Ga0208821_10084294 | 3300025432 | Peatland | MAKVIEFYIPKNFRKPLRAVAQPQLGKIIEFCPQTKRSA |
Ga0208686_10411361 | 3300025500 | Peatland | AKVIEFYIPKNFQKPLRTVAQPQLGEIIEFCPQTKRSA |
Ga0207645_100076245 | 3300025907 | Miscanthus Rhizosphere | MAKVIEFYIPKNFRKTFRTVAPPQLGKIIEFCQQTKRSA |
Ga0207684_115124381 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IVMAKVIEFYMPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA |
Ga0207671_101409151 | 3300025914 | Corn Rhizosphere | MAKVIEFYIPKNFRKSLRTVAQAQLGKLIEFYPRRRNPLN |
Ga0207646_101654192 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYIPTNFRKPLRTPPQPQLGKIIEFCPQTKRSA |
Ga0207687_100090952 | 3300025927 | Miscanthus Rhizosphere | MAKVIEFYIPKNFRKSLRTVAQAQLGKLIEFYPQTKKPA |
Ga0207679_100479091 | 3300025945 | Corn Rhizosphere | MAKAIEFYIPKNFRKPLRTVAEPQLGKIIEFAPQTKRSA |
Ga0207702_101651375 | 3300026078 | Corn Rhizosphere | MAKVIEFYIPKNFRKSLRTVAQAQLGKLIEFYPRRRNPL |
Ga0207702_104325253 | 3300026078 | Corn Rhizosphere | RLTRSQEIVMAKVIEFYIPKNFRKSLRTVAQAQLGKLIEFYPQTKKPA |
Ga0207702_121012131 | 3300026078 | Corn Rhizosphere | MAKVIEFYIPKNFRKPSRTAAEPQLGEVITFCPTD |
Ga0207641_100086276 | 3300026088 | Switchgrass Rhizosphere | MAKVIEFYIPKNFRKTSRTVAQPQLAKIIEFCQQTKRSA |
Ga0207641_100139756 | 3300026088 | Switchgrass Rhizosphere | MAKVIEFYIPKNVRKPLRTVAQPQLGKIIEFCPRTKRLA |
Ga0209839_100354552 | 3300026294 | Soil | MAQVIEFYMPKNFQKPLRTVAQPQLGKIIEFCPQTKRSA |
Ga0208365_10043042 | 3300027070 | Forest Soil | MAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQTKRSA |
Ga0208366_10016782 | 3300027073 | Forest Soil | MAKVIEFYIPKNFRQPLRTAAQPQLGKIIEFCPQTKRSA |
Ga0209732_10004107 | 3300027117 | Forest Soil | MAKVIEFYIPKDFRKALRTAAQPRFGKIIEFCPQSKRSA |
Ga0209004_10952701 | 3300027376 | Forest Soil | MARVIEFYIPKSFRKPLRTAAQGQLGKIIEFCPHTK |
Ga0209622_10002856 | 3300027502 | Forest Soil | MARVIEFYIPKSFRKPLRTAAQAQLGKIIEFCPRTKKSA |
Ga0209523_10032894 | 3300027548 | Forest Soil | MARVIEFYIPKSFRKPLRTAAQGQLAKIIEFCPHTKKSA |
Ga0209220_10285032 | 3300027587 | Forest Soil | MAKVIEFYIPKNFRKPLSRAAQPQLGKIIEFCPQTKRSA |
Ga0208044_10044063 | 3300027625 | Peatlands Soil | MAKVIEFYIPKSFRKQLRPVAQPQLGKIIEFWQPTKRSA |
Ga0208044_10082175 | 3300027625 | Peatlands Soil | MAKVIEFYIPKNFRKPLMTAAQPQLGKIIEFCPQTKKSA |
Ga0209422_10161202 | 3300027629 | Forest Soil | MAKVIEFYIPKNFRKPLSRAAQPQLGKIIEFCVQTKRSA |
Ga0209625_10167512 | 3300027635 | Forest Soil | MAKVIEFYIPKNFRKPLRTAAQPQLGTIIEFCPQTKRSA |
Ga0209117_100114115 | 3300027645 | Forest Soil | MAKVIEFYIPKNFRKPLRTAAQPQLGKIIELCPQTRRSA |
Ga0208696_12583091 | 3300027696 | Peatlands Soil | MAKVIEFYIPQNFRKPLRTVAQPQLGKIIEFCPQT |
Ga0209448_100005245 | 3300027783 | Bog Forest Soil | MAKVIEFYIPKNFRKPLRTAAQPQLGRIIEFCPQTKRSA |
Ga0209656_100289417 | 3300027812 | Bog Forest Soil | MAKVIEFYIPKNFRKLLRTAAQPQLGKIIEFCPQTKRSA |
Ga0209040_1000007223 | 3300027824 | Bog Forest Soil | MAKVIEFYIPKNFRKPLRTVAQPQLGKIIEFCPQTKRSA |
Ga0209040_100717063 | 3300027824 | Bog Forest Soil | MAKVIEFYIPKNFRKPLRTVAQPQLGKIIEFCPQTRRSA |
Ga0209040_102095662 | 3300027824 | Bog Forest Soil | MAKVIEFYIPKNFRKQLRAVAQPQLGKIIEFCPQTKRSA |
Ga0209039_100055885 | 3300027825 | Bog Forest Soil | MAKVIEFYIPKNFRKPLRTAAQPQLGKIIEICPQARRSA |
Ga0209039_100073715 | 3300027825 | Bog Forest Soil | MAKVIEFYVPKNFRKPLRAMAQPQLGKIIEFCPQTKRSA |
Ga0209039_100089005 | 3300027825 | Bog Forest Soil | MAKVIEFYVPKNFRKPLRTVAQPQLGRIVEFCPPTKRSA |
Ga0209517_100485433 | 3300027854 | Peatlands Soil | MAKVIEFYIPKNFRKPFRVVAQPQLGKIIEFCPQTKRSA |
Ga0209068_100384843 | 3300027894 | Watersheds | MAKVIEFYVPKNFRKTLRTVAQPQLGKIIEFRPQNKRSA |
Ga0209067_1000258211 | 3300027898 | Watersheds | MAKVIEFYIPNNFRKPLRTSPQPQLGKIIEFCPQTKRLA |
Ga0209067_1000599014 | 3300027898 | Watersheds | LQEIVMAKVIEFYIPQSFRKPFKTAAQPQLGKIIEFCAQTKRSA |
Ga0209415_100752964 | 3300027905 | Peatlands Soil | MAKVIEFYMPQKFRKPLRTVAQPQLGKIIEFCPQTKRSA |
Ga0209415_101904902 | 3300027905 | Peatlands Soil | MAKVIEFYIPKNFRKQLRAVAQPQLGKIIEFCSQTKRSA |
Ga0209698_100300875 | 3300027911 | Watersheds | MAKVIEFYIPKNFRKPLRTVAQPQLGKIIEFCPQVKRSA |
Ga0209698_100331014 | 3300027911 | Watersheds | MAKVIEFYIPKSFRKPSRTLAQPLLGKIIEFCPQTKRSA |
Ga0209698_101153854 | 3300027911 | Watersheds | MAKVIEFYIPQSFRKPFKTAAQPQLGKIIEFCAQTKRSA |
Ga0209698_101635163 | 3300027911 | Watersheds | MTKVIEFYMPKNFRKSLRTVAQPQLGKIIEFCPQTKRSA |
Ga0265356_10007495 | 3300028017 | Rhizosphere | MAKVIEFYVPKNFRKPQSTAAQLQLGKIIEFCPQTKRSA |
Ga0209526_1000985710 | 3300028047 | Forest Soil | MAKIIEFYIPKNFRKPLRTTAQPQLGKIIEFCPQTKRSA |
Ga0316363_100103896 | 3300030659 | Peatlands Soil | MAKVIEFHIPKNFRKPLRTAAQPQLGKIIEFCSQTKRSA |
Ga0307476_101336251 | 3300031715 | Hardwood Forest Soil | MAKVIEFYIPMNFRKPLRTSPQPQLGKIIEFCPQTKR |
Ga0307474_1000405611 | 3300031718 | Hardwood Forest Soil | MAKVIEFYIPKTFRKALRTAAQPRFGKIIEFCPQTK |
Ga0307469_117592251 | 3300031720 | Hardwood Forest Soil | MAKVIEFYIPKNFRKPFKAMAQAQLGKIIEFCPQTKRSA |
Ga0307468_1000210503 | 3300031740 | Hardwood Forest Soil | MAKVIEFYIPTNFRKPLRTSSQPQLGKIIEFCPQTKRSA |
Ga0307477_101690352 | 3300031753 | Hardwood Forest Soil | MAKVIEFYIPKNFRKALRTAAPSQFGKIIEFCPQTKRSA |
Ga0307478_100519752 | 3300031823 | Hardwood Forest Soil | MAKVIEFYIPKNFRKPFSQAAQPQLGKIIEFCAQTKRSA |
Ga0311301_100832868 | 3300032160 | Peatlands Soil | MTKIIEFYIPKNFRKPLRTVAQPQLGKIIEFCPQTKRSA |
Ga0311301_101487715 | 3300032160 | Peatlands Soil | MAKVIEFYIPKSFRKPLRTAAQPQLGKIIEFCSQTKRSA |
Ga0311301_103152333 | 3300032160 | Peatlands Soil | MAKVIEFYIPKNFRKPLRTAAQPQLGKIIEFCPQTERSA |
Ga0307471_1000093752 | 3300032180 | Hardwood Forest Soil | MAKVIEFYIPTNFRKPLRRSPQPQLGKIIEFCSQTKRSA |
Ga0335085_100015755 | 3300032770 | Soil | MAKVIEFYVPKNFRKSFKTVAQAQLGKLIEFCPQTKRPA |
Ga0335085_100368224 | 3300032770 | Soil | MAKVIEFYIPKNFRKPFRAVAQAQLGKIIEFCAHTKRSA |
Ga0335085_101500103 | 3300032770 | Soil | MAKVIEFYIPKNFRKPLRTGAQFQLGKIIEFCPQTKRSA |
Ga0335085_103383973 | 3300032770 | Soil | MAKVIEFYIPKTFCKPFKSMTQSQLGKIIEFCPQKKRSA |
Ga0335082_113437792 | 3300032782 | Soil | MAKVIEFYIPKNFRKPFKSMAQSQLGKIIEFCPQTKKSA |
Ga0335079_101493413 | 3300032783 | Soil | MAKVMEFYIPKNFRKPFRTVAQPQLGKIIEFCPQAKRSA |
Ga0335080_102352493 | 3300032828 | Soil | MAKVIEFYIPKNFRKPLSTVPQQQLGKIIEFCPQTKRSA |
Ga0335070_100643054 | 3300032829 | Soil | MAKVIELYIPKNFRKPLRTLAQPQLGKVIAFCPQTRRSA |
Ga0335070_117270531 | 3300032829 | Soil | IVMAKVIEFYIPKNSRKPLRTVAQPQLGKIIEFCAQTKRSA |
Ga0335081_100982644 | 3300032892 | Soil | MAKVIEFYMPKNFRKPLRTVAQQQLGKIIEFCPQTRRSA |
Ga0335081_104314232 | 3300032892 | Soil | MAKVIEFYIPKNFRKPLTTAAQPQLGKIIEFCPQTKRSA |
Ga0335077_102552916 | 3300033158 | Soil | MAKVIEFYIPKTFCKPFKSMAQSQLGKIIEFCPQKKRSA |
Ga0335077_117152553 | 3300033158 | Soil | QEIVMAKVIEFYIPKNFRKQLRAVAQPQLGKIIEFCPQTKRSA |
Ga0326728_10000012483 | 3300033402 | Peat Soil | MAKVIEFYIPKNFRKPLRAVAPPQLGKIIEFCQQTKRSA |
Ga0326728_101254443 | 3300033402 | Peat Soil | MANVIEFYIPKNFRNPLRTAAQPQLGKIIEFCPRTKKSA |
Ga0326727_103438581 | 3300033405 | Peat Soil | MAKVIEFYTPKNFRKPLRAVAQPQLGKIIEFCPQTKRSA |
Ga0310810_101979333 | 3300033412 | Soil | MAKVIEFYIPKNFRKSLRTVAQAQLGKLIDFYPRRRNPLN |
Ga0326726_102343641 | 3300033433 | Peat Soil | MAKVIEFYIPKNFRKPFRTAAQAQLGKIIEFCAQTKRSA |
⦗Top⦘ |