Basic Information | |
---|---|
Family ID | F019123 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 231 |
Average Sequence Length | 46 residues |
Representative Sequence | MVDSKPLTQEEIIKAYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH |
Number of Associated Samples | 135 |
Number of Associated Scaffolds | 231 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 64.50 % |
% of genes near scaffold ends (potentially truncated) | 38.53 % |
% of genes from short scaffolds (< 2000 bps) | 83.12 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (70.130 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (18.182 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.680 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.680 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.06% β-sheet: 0.00% Coil/Unstructured: 64.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 231 Family Scaffolds |
---|---|---|
PF07486 | Hydrolase_2 | 32.90 |
PF11753 | DUF3310 | 27.27 |
PF09588 | YqaJ | 2.16 |
PF06378 | DUF1071 | 1.30 |
PF00959 | Phage_lysozyme | 0.87 |
PF02767 | DNA_pol3_beta_2 | 0.87 |
PF00436 | SSB | 0.43 |
PF00149 | Metallophos | 0.43 |
PF05050 | Methyltransf_21 | 0.43 |
PF08042 | PqqA | 0.43 |
PF04545 | Sigma70_r4 | 0.43 |
PF13385 | Laminin_G_3 | 0.43 |
PF13482 | RNase_H_2 | 0.43 |
PF01075 | Glyco_transf_9 | 0.43 |
COG ID | Name | Functional Category | % Frequency in 231 Family Scaffolds |
---|---|---|---|
COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 32.90 |
COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.87 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.43 |
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.21 % |
Unclassified | root | N/A | 7.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001836|RCM27_1060811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 839 | Open in IMG/M |
3300001839|RCM40_1061838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 595 | Open in IMG/M |
3300001842|RCM30_1052382 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
3300002476|metazooDRAFT_10875800 | Not Available | 846 | Open in IMG/M |
3300002835|B570J40625_101253132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300003277|JGI25908J49247_10018927 | All Organisms → Viruses → Predicted Viral | 2066 | Open in IMG/M |
3300003277|JGI25908J49247_10025345 | All Organisms → Viruses → Predicted Viral | 1728 | Open in IMG/M |
3300003277|JGI25908J49247_10047510 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
3300003277|JGI25908J49247_10104093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300003393|JGI25909J50240_1015679 | All Organisms → Viruses → Predicted Viral | 1795 | Open in IMG/M |
3300003393|JGI25909J50240_1064242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300003393|JGI25909J50240_1065800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300003393|JGI25909J50240_1127475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300003412|JGI25912J50252_10073197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300004126|Ga0066179_10116144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
3300004481|Ga0069718_15199720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300004481|Ga0069718_15203049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
3300004481|Ga0069718_15692563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300005527|Ga0068876_10008127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7054 | Open in IMG/M |
3300005527|Ga0068876_10040599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2870 | Open in IMG/M |
3300005527|Ga0068876_10059649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2314 | Open in IMG/M |
3300005527|Ga0068876_10202778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1150 | Open in IMG/M |
3300005527|Ga0068876_10321808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300005581|Ga0049081_10047455 | All Organisms → Viruses → Predicted Viral | 1628 | Open in IMG/M |
3300005581|Ga0049081_10098299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
3300005662|Ga0078894_11432921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300005805|Ga0079957_1060793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2245 | Open in IMG/M |
3300005805|Ga0079957_1075534 | All Organisms → Viruses → Predicted Viral | 1927 | Open in IMG/M |
3300005805|Ga0079957_1128230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1328 | Open in IMG/M |
3300005805|Ga0079957_1139175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
3300005805|Ga0079957_1188776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
3300005805|Ga0079957_1367474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300006641|Ga0075471_10153392 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
3300006802|Ga0070749_10036963 | All Organisms → Viruses → Predicted Viral | 3016 | Open in IMG/M |
3300006802|Ga0070749_10234028 | Not Available | 1044 | Open in IMG/M |
3300006802|Ga0070749_10235103 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
3300006802|Ga0070749_10459905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300006805|Ga0075464_10085183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1799 | Open in IMG/M |
3300006805|Ga0075464_10291754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
3300006805|Ga0075464_10344287 | Not Available | 901 | Open in IMG/M |
3300006805|Ga0075464_10756422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300006875|Ga0075473_10218247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300006917|Ga0075472_10117251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1300 | Open in IMG/M |
3300007363|Ga0075458_10099746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
3300007538|Ga0099851_1203267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300007734|Ga0104986_1579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18205 | Open in IMG/M |
3300007973|Ga0105746_1080080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
3300007973|Ga0105746_1347980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300007974|Ga0105747_1179015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300008107|Ga0114340_1023948 | All Organisms → Viruses → Predicted Viral | 2848 | Open in IMG/M |
3300008107|Ga0114340_1076824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1389 | Open in IMG/M |
3300008107|Ga0114340_1093571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 1215 | Open in IMG/M |
3300008107|Ga0114340_1242696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300008110|Ga0114343_1013359 | All Organisms → Viruses → Predicted Viral | 3872 | Open in IMG/M |
3300008110|Ga0114343_1126430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2051 | Open in IMG/M |
3300008110|Ga0114343_1210319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300008113|Ga0114346_1192970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300008266|Ga0114363_1002770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10951 | Open in IMG/M |
3300008266|Ga0114363_1010634 | All Organisms → Viruses → Predicted Viral | 4376 | Open in IMG/M |
3300008266|Ga0114363_1093613 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
3300008266|Ga0114363_1180557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300008266|Ga0114363_1225989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300008266|Ga0114363_1230471 | Not Available | 540 | Open in IMG/M |
3300008448|Ga0114876_1073746 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300008448|Ga0114876_1133974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
3300008448|Ga0114876_1164073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300008448|Ga0114876_1195108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300008450|Ga0114880_1063288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1523 | Open in IMG/M |
3300008509|Ga0110930_1112170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 772 | Open in IMG/M |
3300009081|Ga0105098_10157478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
3300009081|Ga0105098_10249855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300009081|Ga0105098_10462359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300009159|Ga0114978_10143044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1546 | Open in IMG/M |
3300009160|Ga0114981_10573734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300009165|Ga0105102_10088025 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
3300009165|Ga0105102_10897097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300009168|Ga0105104_10036800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2712 | Open in IMG/M |
3300009168|Ga0105104_10134350 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
3300009169|Ga0105097_10002524 | All Organisms → Viruses | 9008 | Open in IMG/M |
3300009183|Ga0114974_10779089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300009419|Ga0114982_1035826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1599 | Open in IMG/M |
3300010354|Ga0129333_10084868 | All Organisms → Viruses → Predicted Viral | 2932 | Open in IMG/M |
3300010354|Ga0129333_10271881 | All Organisms → Viruses → Predicted Viral | 1522 | Open in IMG/M |
3300010354|Ga0129333_10299325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1439 | Open in IMG/M |
3300010354|Ga0129333_10319780 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
3300010354|Ga0129333_10589626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 966 | Open in IMG/M |
3300010354|Ga0129333_11155031 | Not Available | 645 | Open in IMG/M |
3300010354|Ga0129333_11586935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300010370|Ga0129336_10014307 | All Organisms → Viruses → Predicted Viral | 4833 | Open in IMG/M |
3300010370|Ga0129336_10172081 | All Organisms → Viruses → Predicted Viral | 1243 | Open in IMG/M |
3300010370|Ga0129336_10177804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1220 | Open in IMG/M |
3300010370|Ga0129336_10663540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300011113|Ga0151517_1188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25592 | Open in IMG/M |
3300011116|Ga0151516_11004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12303 | Open in IMG/M |
3300011183|Ga0136713_1005827 | All Organisms → Viruses → Predicted Viral | 1537 | Open in IMG/M |
3300011184|Ga0136709_1049257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300013004|Ga0164293_10106228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2147 | Open in IMG/M |
3300013004|Ga0164293_10514507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300013005|Ga0164292_10590022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300013005|Ga0164292_10976233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
(restricted) 3300013125|Ga0172369_10361587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 743 | Open in IMG/M |
(restricted) 3300013125|Ga0172369_10463100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10071542 | All Organisms → Viruses → Predicted Viral | 2587 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10399387 | Not Available | 778 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10559288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
(restricted) 3300013136|Ga0172370_10109251 | All Organisms → Viruses → Predicted Viral | 1932 | Open in IMG/M |
3300014811|Ga0119960_1046484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300014962|Ga0134315_1002212 | All Organisms → Viruses → Predicted Viral | 3559 | Open in IMG/M |
3300017707|Ga0181363_1089353 | Not Available | 523 | Open in IMG/M |
3300017722|Ga0181347_1032988 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
3300017722|Ga0181347_1088810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 893 | Open in IMG/M |
3300017736|Ga0181365_1067886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 881 | Open in IMG/M |
3300017747|Ga0181352_1081395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
3300017766|Ga0181343_1096070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300017766|Ga0181343_1130418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300017774|Ga0181358_1042191 | All Organisms → Viruses → Predicted Viral | 1749 | Open in IMG/M |
3300017777|Ga0181357_1261880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300017778|Ga0181349_1151791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 832 | Open in IMG/M |
3300017778|Ga0181349_1316034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300017784|Ga0181348_1200097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300017785|Ga0181355_1389320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300019784|Ga0181359_1019169 | All Organisms → Viruses → Predicted Viral | 2575 | Open in IMG/M |
3300019784|Ga0181359_1048144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1646 | Open in IMG/M |
3300019784|Ga0181359_1120191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
3300019784|Ga0181359_1142871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
3300019784|Ga0181359_1161839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300020151|Ga0211736_10145601 | All Organisms → Viruses → Predicted Viral | 3525 | Open in IMG/M |
3300020159|Ga0211734_10899367 | Not Available | 1910 | Open in IMG/M |
3300020160|Ga0211733_10662528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
3300020160|Ga0211733_10887860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300020160|Ga0211733_11068310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300020160|Ga0211733_11088956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
3300020160|Ga0211733_11150186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300020161|Ga0211726_10087197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1425 | Open in IMG/M |
3300020162|Ga0211735_10905869 | Not Available | 1175 | Open in IMG/M |
3300020162|Ga0211735_11615290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 949 | Open in IMG/M |
3300020172|Ga0211729_10631879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300020172|Ga0211729_11083137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
3300020205|Ga0211731_10594738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
3300020549|Ga0207942_1012797 | Not Available | 1104 | Open in IMG/M |
3300020551|Ga0208360_1002403 | All Organisms → Viruses → Predicted Viral | 3300 | Open in IMG/M |
3300020556|Ga0208486_1001851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3861 | Open in IMG/M |
3300020556|Ga0208486_1014132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
3300021952|Ga0213921_1041673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300021956|Ga0213922_1038458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1109 | Open in IMG/M |
3300021960|Ga0222715_10314798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 884 | Open in IMG/M |
3300021962|Ga0222713_10105534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2011 | Open in IMG/M |
3300021962|Ga0222713_10279727 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
3300021962|Ga0222713_10773585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300021963|Ga0222712_10057231 | All Organisms → Viruses → Predicted Viral | 2876 | Open in IMG/M |
3300021963|Ga0222712_10063157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2707 | Open in IMG/M |
3300021963|Ga0222712_10116128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1849 | Open in IMG/M |
3300021963|Ga0222712_10249673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1135 | Open in IMG/M |
3300021963|Ga0222712_10263908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1095 | Open in IMG/M |
3300021963|Ga0222712_10535889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300021963|Ga0222712_10647703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300021963|Ga0222712_10833979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300022190|Ga0181354_1100076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
3300022190|Ga0181354_1148022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 736 | Open in IMG/M |
3300023184|Ga0214919_10645911 | Not Available | 613 | Open in IMG/M |
3300024298|Ga0255178_1003828 | All Organisms → Viruses → Predicted Viral | 3398 | Open in IMG/M |
3300024490|Ga0255185_1006327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1715 | Open in IMG/M |
3300024557|Ga0255283_1101517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300025075|Ga0209615_103655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
3300025635|Ga0208147_1020327 | All Organisms → Viruses → Predicted Viral | 1783 | Open in IMG/M |
3300025732|Ga0208784_1055713 | All Organisms → Viruses → Predicted Viral | 1212 | Open in IMG/M |
3300025848|Ga0208005_1140729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300025889|Ga0208644_1003375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12447 | Open in IMG/M |
3300027160|Ga0255198_1030000 | Not Available | 1010 | Open in IMG/M |
3300027608|Ga0208974_1032450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1568 | Open in IMG/M |
3300027608|Ga0208974_1148676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300027693|Ga0209704_1082120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300027693|Ga0209704_1114110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300027721|Ga0209492_1001032 | All Organisms → Viruses | 8595 | Open in IMG/M |
3300027732|Ga0209442_1079651 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
3300027732|Ga0209442_1239800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 652 | Open in IMG/M |
3300027743|Ga0209593_10082775 | All Organisms → Viruses → Predicted Viral | 1196 | Open in IMG/M |
3300027785|Ga0209246_10068059 | All Organisms → Viruses → Predicted Viral | 1382 | Open in IMG/M |
3300027793|Ga0209972_10000517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 37955 | Open in IMG/M |
3300027798|Ga0209353_10308735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300027805|Ga0209229_10004601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5751 | Open in IMG/M |
3300027816|Ga0209990_10199135 | Not Available | 929 | Open in IMG/M |
3300027885|Ga0209450_11212253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300027900|Ga0209253_10353528 | Not Available | 1127 | Open in IMG/M |
3300027900|Ga0209253_10568473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300027900|Ga0209253_11099594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300027956|Ga0209820_1014173 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
3300028025|Ga0247723_1008836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4104 | Open in IMG/M |
3300028025|Ga0247723_1017902 | All Organisms → Viruses → Predicted Viral | 2465 | Open in IMG/M |
3300028025|Ga0247723_1032428 | All Organisms → Viruses → Predicted Viral | 1630 | Open in IMG/M |
3300028025|Ga0247723_1076423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
3300028103|Ga0255172_1025684 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
3300029930|Ga0119944_1036171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300031707|Ga0315291_10464181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1185 | Open in IMG/M |
3300031758|Ga0315907_10083171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2759 | Open in IMG/M |
3300031787|Ga0315900_10023543 | Not Available | 7059 | Open in IMG/M |
3300031787|Ga0315900_10315154 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
3300031787|Ga0315900_10330735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1242 | Open in IMG/M |
3300031787|Ga0315900_10928126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300031857|Ga0315909_10766920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 615 | Open in IMG/M |
3300031951|Ga0315904_10207815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1915 | Open in IMG/M |
3300031951|Ga0315904_11280015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300031963|Ga0315901_10582866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300031963|Ga0315901_10888904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300032116|Ga0315903_11159300 | Not Available | 525 | Open in IMG/M |
3300033981|Ga0334982_0436672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300033993|Ga0334994_0304267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300033995|Ga0335003_0358154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 637 | Open in IMG/M |
3300033996|Ga0334979_0044526 | All Organisms → Viruses → Predicted Viral | 2901 | Open in IMG/M |
3300034012|Ga0334986_0262545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300034020|Ga0335002_0417136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300034022|Ga0335005_0169830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1373 | Open in IMG/M |
3300034061|Ga0334987_0148344 | All Organisms → Viruses → Predicted Viral | 1720 | Open in IMG/M |
3300034062|Ga0334995_0424958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300034062|Ga0334995_0687305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300034066|Ga0335019_0415878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 819 | Open in IMG/M |
3300034071|Ga0335028_0549913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300034092|Ga0335010_0519640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300034101|Ga0335027_0156375 | All Organisms → Viruses → Predicted Viral | 1667 | Open in IMG/M |
3300034101|Ga0335027_0855190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300034102|Ga0335029_0682719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300034104|Ga0335031_0607580 | Not Available | 644 | Open in IMG/M |
3300034106|Ga0335036_0712875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300034111|Ga0335063_0472224 | Not Available | 617 | Open in IMG/M |
3300034112|Ga0335066_0497755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300034116|Ga0335068_0104338 | All Organisms → Viruses → Predicted Viral | 1584 | Open in IMG/M |
3300034116|Ga0335068_0479222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300034122|Ga0335060_0208042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
3300034272|Ga0335049_0821412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300034283|Ga0335007_0155519 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
3300034356|Ga0335048_0505455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.18% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.02% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.36% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.93% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.06% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.63% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.19% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.19% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.76% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.60% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.16% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.16% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.73% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.73% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.73% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.30% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.30% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.30% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.30% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.30% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.30% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.87% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.43% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.43% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.43% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.43% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.43% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.43% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008509 | Freshwater microbial communities from catchments in Singapore - Site BB | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027160 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepC_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM27_10608114 | 3300001836 | Marine Plankton | MVDSKPLSQEEIIKAYKQAFGHGSQVLTLEKIFRFARLV |
RCM40_10618383 | 3300001839 | Marine Plankton | VDSKPLSQEEIIKAYKQAFGHGSQVLTLDKIFRFARIIEQLHGVKHDG* |
RCM30_10523826 | 3300001842 | Marine Plankton | MVDSKPLSQEEIIKAYKQAFGHGSQVLTLDKIFRFARIIEQLHGVKYDG* |
metazooDRAFT_108758003 | 3300002476 | Lake | MDSKPLTQEEIIKAYKEAFGNGNAVLTLDRLFRFARLIEQAHGVKDVY* |
B570J40625_1012531322 | 3300002835 | Freshwater | VDSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFKFARLIEQLHGVKDVH* |
JGI25908J49247_100189275 | 3300003277 | Freshwater Lake | MVDSKPLTQEEIIKAYKQAFGKGDQLVTLEKIFRFARLIEEIHGVKDVH* |
JGI25908J49247_100253453 | 3300003277 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH* |
JGI25908J49247_100475103 | 3300003277 | Freshwater Lake | VDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH* |
JGI25908J49247_101040933 | 3300003277 | Freshwater Lake | VDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH* |
JGI25909J50240_10156793 | 3300003393 | Freshwater Lake | MVDSKPLTQEEIIKAYKQAFGKGDQLVTLEKIFRFARXIEEIHGVKXCTLX* |
JGI25909J50240_10642422 | 3300003393 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH* |
JGI25909J50240_10658001 | 3300003393 | Freshwater Lake | MVDSKPLTQEEIIKAYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH* |
JGI25909J50240_11274752 | 3300003393 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSXVITIDKIFXFARLIEQLHGVKDVH* |
JGI25912J50252_100731973 | 3300003412 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQXHGVKDVH* |
Ga0066179_101161442 | 3300004126 | Freshwater Lake | VDSKPLTQEEIIKAYKQAFGKGDQLVTLEKIFRFARLIEEIHGVKDVH* |
Ga0069718_151997203 | 3300004481 | Sediment | MKPLTQEEIIKIYKASFGNGNAVLTLERIFKFARLLEEAHGVKDG |
Ga0069718_152030492 | 3300004481 | Sediment | MVDSKPLTQEEIIKAYKQAFGKGDQLVTLEKIFRFARLIEEIHGVK* |
Ga0069718_156925631 | 3300004481 | Sediment | MVDSKPLTQEEIIKIYKAAFGYGSQVVTIDRIFKFARLLEEAHGVKDVH* |
Ga0068876_1000812711 | 3300005527 | Freshwater Lake | MVDSKPLTQEEIIKIYKEAFGKGDQLVTIDRIFRFARLLEQTHGIKDVH* |
Ga0068876_100405999 | 3300005527 | Freshwater Lake | MVDSNPLTQEEIIKAYKEAFGSGNAVLTLDRIFRFARLIEQAHGIKNVH* |
Ga0068876_100596496 | 3300005527 | Freshwater Lake | MVDSKPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEKAHGVKDVH* |
Ga0068876_102027784 | 3300005527 | Freshwater Lake | MVDSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFKFARLIEQLHGVKDVH* |
Ga0068876_103218082 | 3300005527 | Freshwater Lake | MESKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH* |
Ga0049081_100474554 | 3300005581 | Freshwater Lentic | MVDSKPLTQEEIIKIYKEAFGKGDQLVTIDRIFRFARLLEQTHGIKDG* |
Ga0049081_100982991 | 3300005581 | Freshwater Lentic | YKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH* |
Ga0078894_114329212 | 3300005662 | Freshwater Lake | MDSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFRFARLIEQLHGVKDVH* |
Ga0079957_10607932 | 3300005805 | Lake | MDSKPLTQEEIIKIYKAAFGNGNAVLTLERIFKFARLLEQAHGVKDVH* |
Ga0079957_10755344 | 3300005805 | Lake | MVDSKPLTQEEIIKIYKAAFGNGNAVLTLERIFKFARLLEQTHGIKDG* |
Ga0079957_11282304 | 3300005805 | Lake | MVDSKPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQLHGIKNG* |
Ga0079957_11391754 | 3300005805 | Lake | MDSKALTQEQIIKAYKEAFGSGNAVLTLDRIFRFARLIEQLHGIKDVH* |
Ga0079957_11887762 | 3300005805 | Lake | MDSKALTQEEIIKIYKEAFGKGDQLVTIDRIFRFARLLEQAHGIKNASN* |
Ga0079957_13674741 | 3300005805 | Lake | YKEAFGSGNAVLTLDRIFRFARLIEQAHGIKNVH* |
Ga0075471_101533925 | 3300006641 | Aqueous | MVDYNPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNVH* |
Ga0070749_1003696310 | 3300006802 | Aqueous | MDSKPLTQEEIIKIYKTAFGYGSQVITLDKVFKFARLLEQAHGVKDVH* |
Ga0070749_102340284 | 3300006802 | Aqueous | MVDSKPLTQEEIIKIYKAAFGNGNAVLTLERIFKFARLLEQAHGVKDVH* |
Ga0070749_102351033 | 3300006802 | Aqueous | MKPLTQEEIIKAYKEAFGYGSQVVTIDKIFRFARLIEQLHGVKNG* |
Ga0070749_104599052 | 3300006802 | Aqueous | MVDSNPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNVH* |
Ga0075464_100851831 | 3300006805 | Aqueous | VDSRPLTQEQIIKAYKDAFGHGSQVLTLEKIFKFARIIEQLHGVKYET* |
Ga0075464_102917542 | 3300006805 | Aqueous | MDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLIEQLHGVKDVH* |
Ga0075464_103442872 | 3300006805 | Aqueous | MVDSKPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNG* |
Ga0075464_107564221 | 3300006805 | Aqueous | YKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH* |
Ga0075473_102182473 | 3300006875 | Aqueous | MDSKPLTQEEIIKIYKAAFGYGSQVITLDKVFKFARLLEQAHGVKDVH* |
Ga0075472_101172513 | 3300006917 | Aqueous | VDYNPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNVH* |
Ga0075458_100997461 | 3300007363 | Aqueous | MDSKPLTQEEIIKIYKASFGYGSQVVTIDKIFKFARLLEQAHGVKDVH* |
Ga0099851_12032672 | 3300007538 | Aqueous | MVDSKPLTQEDIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH* |
Ga0104986_15796 | 3300007734 | Freshwater | MDSKPLTQEEIIKIYKAAFGNGNAVLTLDRIFKFARLLEQAHGVKDVH* |
Ga0105746_10800801 | 3300007973 | Estuary Water | MVDSKPLTHEEIIKAYKQAFGKGDQLVTLEKIFRFARLIEEIHGVKDVH* |
Ga0105746_13479802 | 3300007973 | Estuary Water | VYKEAFGYGSQVITIDKIFKFARLIEQLHGVKNVH* |
Ga0105747_11790152 | 3300007974 | Estuary Water | MVDSKPLTQEEIIKIYKEAFGYGSQVITIDKIFRFARLIEQAHGVKDVI* |
Ga0114340_10239484 | 3300008107 | Freshwater, Plankton | MDSKPLTQEEIIKIYKAAFGYGSQVITLDKVFKFARLLEQAHGVKDVI* |
Ga0114340_10768245 | 3300008107 | Freshwater, Plankton | MVDSKPLTQEEIIKAYKESFGNGNAVLTIDKIFRFARLIEQAHGIKNG* |
Ga0114340_10935711 | 3300008107 | Freshwater, Plankton | MDYNPLTQEQIIKAYKDAFGYGSQVVTLDKIFKFARLIEQLHGIKYEA* |
Ga0114340_12426964 | 3300008107 | Freshwater, Plankton | QEEIIKIYKEAFGKGDQLVTLEKIFKFARLIEQLHGVKDVH* |
Ga0114343_10133595 | 3300008110 | Freshwater, Plankton | MDSKPLTQEEIIKIYKAAFGYGSQVVTIDRIFKFARLLEQAHGVKDVH* |
Ga0114343_11264306 | 3300008110 | Freshwater, Plankton | VYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH* |
Ga0114343_12103193 | 3300008110 | Freshwater, Plankton | MSKIYKQAFGKGDQLITLDKIFKFARLIEQLHGVKDVH* |
Ga0114346_11929704 | 3300008113 | Freshwater, Plankton | TQEEIIKAYKEAFGSGNAVLTLDRIFRFARLIEQAHGIKNVH* |
Ga0114363_100277013 | 3300008266 | Freshwater, Plankton | MVDSNPLTQEEIIKAYKEAFGYGSQVITIDKIFRFARLIEQLHGIKNG* |
Ga0114363_10106349 | 3300008266 | Freshwater, Plankton | MDSKPLSQEEIVKIYKEAFGKGDQLVTIDRIFRFARLIEQAHGVKDG* |
Ga0114363_10936135 | 3300008266 | Freshwater, Plankton | YKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNVH* |
Ga0114363_11805573 | 3300008266 | Freshwater, Plankton | LTQEEIIKAYKEAFGSGNAVLTLDRIFRFARLIEKAHGVKDVH* |
Ga0114363_12259892 | 3300008266 | Freshwater, Plankton | LTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNVH* |
Ga0114363_12304711 | 3300008266 | Freshwater, Plankton | MVDSKPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNVH* |
Ga0114876_10737461 | 3300008448 | Freshwater Lake | IKAYKDAFGYGSQVVTLDKIFKFARIIEQLHGVKYEA* |
Ga0114876_11339744 | 3300008448 | Freshwater Lake | QEEIIKAYKQAFGKGDQLVTLEKIFRFARLIEEIHGVK* |
Ga0114876_11640731 | 3300008448 | Freshwater Lake | MVDSKPLTQEEIIKAYKEAFGYGSQVITIDKIFKFARLIEQLHGVK |
Ga0114876_11951082 | 3300008448 | Freshwater Lake | MDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH* |
Ga0114880_10632884 | 3300008450 | Freshwater Lake | MVDSNPLTQEEIIKAYKEAFGSGNAVLTLDRIFRFARLIEKAHGVKDVH* |
Ga0110930_11121703 | 3300008509 | Freshwater | MVDSKPLTQEEIIKIYKAAFGNGNAVLTLDRIFKFARLLEQAHGVKDG* |
Ga0105098_101574783 | 3300009081 | Freshwater Sediment | MVDSNPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEKAHGVKDVH* |
Ga0105098_102498551 | 3300009081 | Freshwater Sediment | EIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH* |
Ga0105098_104623591 | 3300009081 | Freshwater Sediment | MVDSKPLTQEEIINVYKEAFGKGDQLVTLEKIFRFARLIEGRVKDVHETR* |
Ga0114978_101430444 | 3300009159 | Freshwater Lake | MDSKPLTQEEIIKAYKEAFGYGSQVVTLDRIFKFARLIEQLHGVKHVH* |
Ga0114981_105737344 | 3300009160 | Freshwater Lake | EEIIKAYKEAFGYGSQVVTLDRIFKFARLIEQLHGVKHVH* |
Ga0105102_100880251 | 3300009165 | Freshwater Sediment | RRHMVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH* |
Ga0105102_108970971 | 3300009165 | Freshwater Sediment | MVDSKPLTQEEIIKAYKEAFGYGSQVVTIDKIFRFARLIEQLHGVKNG* |
Ga0105104_100368004 | 3300009168 | Freshwater Sediment | MVDSNPLTQEEIIKAYKEAFGSGNAVLTLDKIFRFARLIEKAHGVKDVH* |
Ga0105104_101343502 | 3300009168 | Freshwater Sediment | MVDSKPLTQEEIIKVYKEAFGKGDQLVTLEKIFRFARLIEGKVKDVHETR* |
Ga0105097_100025244 | 3300009169 | Freshwater Sediment | MVDSNPLTQEEIIKAYKEAFGYGSQVVTLDRIFKFARLIEQAHGIKNG* |
Ga0114974_107790892 | 3300009183 | Freshwater Lake | MVDSKPLTQEEIMKIYKESFGTGSQLITIDKIFKFARLLEQAHGVKDVY* |
Ga0114982_10358263 | 3300009419 | Deep Subsurface | MDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH* |
Ga0129333_100848689 | 3300010354 | Freshwater To Marine Saline Gradient | MVDSNPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIE |
Ga0129333_102718815 | 3300010354 | Freshwater To Marine Saline Gradient | LMVDSNPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEKAHGVKDVH* |
Ga0129333_102993255 | 3300010354 | Freshwater To Marine Saline Gradient | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQAHGVKDAV* |
Ga0129333_103197802 | 3300010354 | Freshwater To Marine Saline Gradient | MVDSKPLTQEEIIKIYKAAFGYGSQVVTLDRIFKFARLLEQAHGVKDVH* |
Ga0129333_105896264 | 3300010354 | Freshwater To Marine Saline Gradient | SKPLTQEEIIKAYKEAFGSGNAVLTLDRIFRFARLIEQLHGIKNG* |
Ga0129333_111550311 | 3300010354 | Freshwater To Marine Saline Gradient | MVDSKPLTQEEIIKIYKAAFGKGDQLVTIDRIFRFARLLEQTHGIKDG* |
Ga0129333_115869352 | 3300010354 | Freshwater To Marine Saline Gradient | LMVDSNPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNVH* |
Ga0129336_100143076 | 3300010370 | Freshwater To Marine Saline Gradient | MVDSNPLTQEEIIKAYKEAFGNGNAVLTLDKIFRFARLIEKAHGVKDVH* |
Ga0129336_101720812 | 3300010370 | Freshwater To Marine Saline Gradient | MVDSKPLTQEEIIKIYKAAFGYGSQVVTIDKIFKFARLLEQAHGVKDVH* |
Ga0129336_101778043 | 3300010370 | Freshwater To Marine Saline Gradient | MDSKALTQEEIIKIYKEAFGKGDQLVTIDRIFRFARLLEQAHGIKNG* |
Ga0129336_106635401 | 3300010370 | Freshwater To Marine Saline Gradient | MVDSKPLTQEEIIKAYKEAFGSGNAVLTLDRIFRFARLIEQLHGIKNG* |
Ga0151517_118835 | 3300011113 | Freshwater | MDSKPLTQEEIIKIYKEAFGKGDQLVTIDRIFRFARLVEQAHGIKNASN* |
Ga0151516_1100431 | 3300011116 | Freshwater | MVDSKPLTQEEIIKIYKAAFGNGNAVLTLDRIFKFARLLEQSHGIKHEA* |
Ga0136713_10058271 | 3300011183 | Freshwater | IYKEAFGKGDQLVTLDKIFRFARLIEQLHGVKDVH* |
Ga0136709_10492571 | 3300011184 | Freshwater | MVDSKPLTQEEIIKIYKAAFGYGSQVITLDKIFKFARLLEQAHGVKDAL* |
Ga0164293_101062283 | 3300013004 | Freshwater | MDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLIEEIHGVKDAI* |
Ga0164293_105145073 | 3300013004 | Freshwater | MVDSKPLTQEEIIKIYKAAFGYGSQVITLDKIFKFARLLEQAHGVKDAV* |
Ga0164292_105900221 | 3300013005 | Freshwater | LTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH* |
Ga0164292_109762332 | 3300013005 | Freshwater | MVDSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFKFAKLIEQAHGVKDAV* |
(restricted) Ga0172369_103615871 | 3300013125 | Freshwater | IKIYKAAFGNGNAVLTLDRIFKFARLLEQAHGVKDG* |
(restricted) Ga0172369_104631003 | 3300013125 | Freshwater | MDSKPLTQEEIIKIYKAAFGNGNAVLTLDRIFKFARLLEQ |
(restricted) Ga0172367_100715426 | 3300013126 | Freshwater | MDSKPLSQEEIIKIYKEAFGKGDQLVTLDRIFKFARLIEEYVHKAR* |
(restricted) Ga0172367_103993871 | 3300013126 | Freshwater | MVDSKPLTQEEIIKIYKAAFGNGNAVLTLDRIFKFARLLEQA |
(restricted) Ga0172367_105592883 | 3300013126 | Freshwater | DSKPLTQEEIIKIYKAAFGNGNAVLTLDRIFKFARLLEQAHGVKDG* |
(restricted) Ga0172370_101092516 | 3300013136 | Freshwater | MDSKPLTQEEIIKIYKAAFGNGNAVLTLDRIFKFARLLEQAHGVKDG* |
Ga0119960_10464842 | 3300014811 | Aquatic | MVDSKPLTQEEIIKIYKTAFAYGSQVVTIDRIFKFARLLEQAHGVKDVH* |
Ga0134315_10022126 | 3300014962 | Surface Water | MVDSKPLTQEEIIKIYKAAFGYGSQVITLDRIFKFARLLEQAHGVKDVH* |
Ga0181363_10893532 | 3300017707 | Freshwater Lake | MESKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKD |
Ga0181347_10329884 | 3300017722 | Freshwater Lake | MVDSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFRFARLIEQLHGVKNVY |
Ga0181347_10888101 | 3300017722 | Freshwater Lake | MVDSKPLTQEEIIKAYKEAFGYGSQVITIDKIFRFARLIEQLHG |
Ga0181365_10678863 | 3300017736 | Freshwater Lake | VDSKPLTQEEIIKAYKEAFGYGSQVITIDKIFKFARLIEQLHGVK |
Ga0181352_10813951 | 3300017747 | Freshwater Lake | AYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH |
Ga0181343_10960704 | 3300017766 | Freshwater Lake | TQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQAHGVKDAV |
Ga0181343_11304183 | 3300017766 | Freshwater Lake | VDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQ |
Ga0181358_10421915 | 3300017774 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAYGYGSQVITIDKIFKFARLIEQLHGVKDVH |
Ga0181357_12618801 | 3300017777 | Freshwater Lake | QEEIIKIYKEAFGKGDQLVTLEKIFRFARLIEQLHGVKDVH |
Ga0181349_11517913 | 3300017778 | Freshwater Lake | MVDSKPLTQEEIIKAYKEAFGYGSQVITIDKIFKF |
Ga0181349_13160343 | 3300017778 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGV |
Ga0181348_12000973 | 3300017784 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHG |
Ga0181355_13893203 | 3300017785 | Freshwater Lake | MVDSRPLTQEEIIKIYKEAFGKGDQLVTLEKIFRFARLIEQ |
Ga0181359_10191694 | 3300019784 | Freshwater Lake | MVDSKPLTQEEIIKAYKQAFGKGDQLVTLEKIFRFARLIEEIHGVKDVH |
Ga0181359_10481442 | 3300019784 | Freshwater Lake | MDSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFRFARLIEQLHGVKDVH |
Ga0181359_11201913 | 3300019784 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH |
Ga0181359_11428713 | 3300019784 | Freshwater Lake | MESKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGV |
Ga0181359_11618392 | 3300019784 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH |
Ga0211736_101456018 | 3300020151 | Freshwater | MDSKPLTQEEIIKIYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH |
Ga0211734_108993673 | 3300020159 | Freshwater | MDSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFKFARLIEEIHGVKDAV |
Ga0211733_106625285 | 3300020160 | Freshwater | DSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH |
Ga0211733_108878602 | 3300020160 | Freshwater | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQAHGVKDAS |
Ga0211733_110683102 | 3300020160 | Freshwater | DSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKCARLIEQLHGVKDVH |
Ga0211733_110889562 | 3300020160 | Freshwater | MDSKPLTQEEIIKIYKQAFGKGDQLITLDKIFKFARLIEQLHGVKDVH |
Ga0211733_111501863 | 3300020160 | Freshwater | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQ |
Ga0211726_100871974 | 3300020161 | Freshwater | MDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLIEKIHGVKDAV |
Ga0211735_109058695 | 3300020162 | Freshwater | VDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQAHGVKDAS |
Ga0211735_116152901 | 3300020162 | Freshwater | MDFKPLTQEEIIKIYKEAYGKGDQLVTLEKILIFAKLIEKKIKDVYKIR |
Ga0211729_106318792 | 3300020172 | Freshwater | MDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLIEEIHGVKDAV |
Ga0211729_110831373 | 3300020172 | Freshwater | MVDSKPLTQEEIIKAYKQAFGKGDQLIALEKIFRFARL |
Ga0211731_105947381 | 3300020205 | Freshwater | MVDSKPLTQEEIIKAYKQAFGKGDQLITLEKIFRFARLIEEIHGVK |
Ga0207942_10127971 | 3300020549 | Freshwater | IIKIYKQAFGKGDQLVTLEKIFKFARLIEEIHGVKDAV |
Ga0208360_10024034 | 3300020551 | Freshwater | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQAHGVKDVI |
Ga0208486_10018511 | 3300020556 | Freshwater | EEIIKIYKEAFGKGDQLVTLEKIFRFARLIEEIHGVK |
Ga0208486_10141322 | 3300020556 | Freshwater | MVDSKPLTQEEIIKIYKAAFGYGSQVITLDKIFKFARLLEQAHGVKDAV |
Ga0213921_10416733 | 3300021952 | Freshwater | MVDSKPLTQEEIIKAYKSAFGTGSQVLTLDKIFRFARLIEQLHGVKHEA |
Ga0213922_10384582 | 3300021956 | Freshwater | MVDSKPLTQEEIIKAYKEAFGNGNAVLTIDRIFRFARLIEQAHGIKNVH |
Ga0222715_103147983 | 3300021960 | Estuarine Water | MDSKALTQEEIIKIYKEAFGKGDQLVTIDRIFRFARLLEQAHGIKDG |
Ga0222713_101055347 | 3300021962 | Estuarine Water | MVDSKPLTQEEIIKIYKEAFGKGDQLVTIDRIFRFARLVEQAHGIKNASN |
Ga0222713_102797271 | 3300021962 | Estuarine Water | MVDSKPLTQEEIVKIYKEAFGKGDQLVTIDRIFRFARLLEQAHGIKNASN |
Ga0222713_107735853 | 3300021962 | Estuarine Water | IKIYKQAFGKGDQLVTLEKIFRFAKLIEEIHGVKDAV |
Ga0222712_100572319 | 3300021963 | Estuarine Water | KLTMDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLIEQLHGVKDVH |
Ga0222712_100631574 | 3300021963 | Estuarine Water | MDYNPLTQEQIIKAYKDAFGYGSQVVTLDKIFKFARLIEQLHGIKHEA |
Ga0222712_101161286 | 3300021963 | Estuarine Water | MDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH |
Ga0222712_102496733 | 3300021963 | Estuarine Water | MDSKPLTQQEIIKAYKEAFGYGSQVVTLDRIFKFARLIEQLHGVKHVH |
Ga0222712_102639082 | 3300021963 | Estuarine Water | MVDSKPLTQEEIIKIYKAAFGYGSQVVTIDRIFKFARLLEQAHGVKDVH |
Ga0222712_105358893 | 3300021963 | Estuarine Water | MVDSKPLTQEEIIKIYKAAFGNGNAVLTLERIFKFARLLEQAHGVKDVH |
Ga0222712_106477032 | 3300021963 | Estuarine Water | MVDSKPLTQEEIVKIYKEAFGKGDQLVTIDRIFKFARLVEQAHGIKNASNXRTINRHNK |
Ga0222712_108339792 | 3300021963 | Estuarine Water | EIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH |
Ga0181354_11000761 | 3300022190 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDV |
Ga0181354_11480223 | 3300022190 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARL |
Ga0214919_106459113 | 3300023184 | Freshwater | VDSRPLTQEQIIKAYKDAFGHGSQVLTLEKIFKFARIIEQLHGVKYET |
Ga0255178_10038285 | 3300024298 | Freshwater | MVDSKPLTQEEIIKIYKAAFGNGNAVLTLDRIFKFARLLEQAHGVKDVH |
Ga0255185_10063273 | 3300024490 | Freshwater | MVDSKPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNVH |
Ga0255283_11015173 | 3300024557 | Freshwater | MVDSKPLTQEEIIKIYKAAFGNGNAVLTLDRIFKFARLLEQAHGVKDV |
Ga0209615_1036552 | 3300025075 | Freshwater | MVDSKPLTQEEIIKAYKQAFGKGDQLVTLEKIFRFARLIEQAHGVKDAV |
Ga0208147_10203273 | 3300025635 | Aqueous | MDSKPLTQEEIIKIYKASFGYGSQVVTIDKIFKFARLLEQAHGVKDVH |
Ga0208784_10557132 | 3300025732 | Aqueous | MVDYNPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNVH |
Ga0208005_11407293 | 3300025848 | Aqueous | QEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNVH |
Ga0208644_10033752 | 3300025889 | Aqueous | MDSKPLTQEEIIKIYKTAFGYGSQVITLDKVFKFARLLEQAHGVKDVH |
Ga0255198_10300003 | 3300027160 | Freshwater | MVDSKPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEQAHGIKNG |
Ga0208974_10324506 | 3300027608 | Freshwater Lentic | MVDSNPLTQEEIIKIYKAAFGYGSQVITLDKIFKFARLLEQAHGVKDAV |
Ga0208974_11486761 | 3300027608 | Freshwater Lentic | LTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH |
Ga0209704_10821201 | 3300027693 | Freshwater Sediment | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQ |
Ga0209704_11141103 | 3300027693 | Freshwater Sediment | PLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH |
Ga0209492_100103219 | 3300027721 | Freshwater Sediment | MVDSNPLTQEEIIKAYKEAFGYGSQVVTLDRIFKFARLIEQAHGIKNG |
Ga0209442_10796514 | 3300027732 | Freshwater Lake | MESKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIE |
Ga0209442_12398003 | 3300027732 | Freshwater Lake | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGV |
Ga0209593_100827752 | 3300027743 | Freshwater Sediment | MVDSNPLTQEEIIKAYKEAFGSGNAVLTLDKIFRFARLIEKAHGVKDVH |
Ga0209246_100680596 | 3300027785 | Freshwater Lake | KIYKEAFGKGDQLVTLEKIFKFARLIEQLHGVKDVH |
Ga0209972_1000051726 | 3300027793 | Freshwater Lake | MVDSKPLTQEEIIKIYKEAFGKGDQLVTIDRIFRFARLLEQTHGIKDVH |
Ga0209353_103087352 | 3300027798 | Freshwater Lake | MVDSKPLTQEEIIKAYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH |
Ga0209229_1000460114 | 3300027805 | Freshwater And Sediment | MVDSKPLTQEEIIKAYKEAFGSGNAVLTLDRIFRFARLIEKAHGVKDVH |
Ga0209990_101991353 | 3300027816 | Freshwater Lake | MVDSKPLTQEEIIKAYKQAFGKGDQLVTLEKIFRFARLIEEIH |
Ga0209450_112122531 | 3300027885 | Freshwater Lake Sediment | LTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKNVH |
Ga0209253_103535285 | 3300027900 | Freshwater Lake Sediment | QEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQAHGVKDAV |
Ga0209253_105684731 | 3300027900 | Freshwater Lake Sediment | QEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH |
Ga0209253_110995941 | 3300027900 | Freshwater Lake Sediment | RRHMVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH |
Ga0209820_10141731 | 3300027956 | Freshwater Sediment | VDSNPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEKAHGVKDVH |
Ga0247723_10088365 | 3300028025 | Deep Subsurface Sediment | MDSKPLTQEEIIKIYKAAFGYGSQVVTLDRIFKFARLLEQAHGVKDVY |
Ga0247723_10179024 | 3300028025 | Deep Subsurface Sediment | MESKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFARLIEQLHGVKDVH |
Ga0247723_10324282 | 3300028025 | Deep Subsurface Sediment | MVDSKPLTQEEIIKAYKEAFGYGSQVITIEKIFKFARLIEQLHGVKDVH |
Ga0247723_10764234 | 3300028025 | Deep Subsurface Sediment | KPLTQEEIIKAYKQAFGKGDQLVTLEKIFRFARLIEEIHGVKDVH |
Ga0255172_10256845 | 3300028103 | Freshwater | IKIYKAAFGNGNAVLTLDRIFKFARLLEQAHGVKDVH |
Ga0119944_10361712 | 3300029930 | Aquatic | MVDSKPLSQEEIIKIYKAAFGNGNAVLTLERIFKFARLLEQAHGVKDVH |
Ga0315291_104641814 | 3300031707 | Sediment | MDSKPLTQEEIIKAYKQAFGNGNAVLTIDKIFRFARLIEQAHGVKDAV |
Ga0315907_100831712 | 3300031758 | Freshwater | MVDSNPLTQEEIIKAYKEAFGYGSQVITIDKIFRFARLIEQLHGIKNG |
Ga0315900_1002354316 | 3300031787 | Freshwater | MDSKPLSQEEIVKIYKEAFGKGDQLVTIDRIFRFARLIEQAHGVKDG |
Ga0315900_103151541 | 3300031787 | Freshwater | MESKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHG |
Ga0315900_103307351 | 3300031787 | Freshwater | LTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEKAHGVKDVH |
Ga0315900_109281262 | 3300031787 | Freshwater | RRLMVDSNPLTQEEIIKAYKEAFGSGNAVLTLDRIFRFARLIEQAHGIKNVH |
Ga0315909_107669203 | 3300031857 | Freshwater | MVDSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFKFARLIEQLHGVKD |
Ga0315904_102078157 | 3300031951 | Freshwater | MVDSKPLTQEEIIKAYKESFGNGNAVLTIDKIFRFARLIEQAHGIKNG |
Ga0315904_112800152 | 3300031951 | Freshwater | MDSKLTQEEIIKLYKEAFGKGDQLVTLDRIFKFARLIEEYVHKAR |
Ga0315901_105828664 | 3300031963 | Freshwater | LMVDSNPLTQEEIIKAYKEAFGSGNAVLTLDRIFRFARLIEQAHGIKNVH |
Ga0315901_108889041 | 3300031963 | Freshwater | MDSKPLTQEEIIKIYKAAFGYGSQVITLDKVFKFARLLEQAHGVK |
Ga0315903_111593003 | 3300032116 | Freshwater | MVDSKPLTQEEIIKAYKEAFGNGNAVLTLDRIFRFARLIEKAHGVKDVY |
Ga0334982_0436672_395_544 | 3300033981 | Freshwater | MVDSKPLTQEEIIKVYKQAFGKGDQLVTLEKIFRFARLIEQLHGVKDVH |
Ga0334994_0304267_73_210 | 3300033993 | Freshwater | MDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLIEEIHGVK |
Ga0335003_0358154_523_636 | 3300033995 | Freshwater | MDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLI |
Ga0334979_0044526_580_726 | 3300033996 | Freshwater | MDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLIEEIHGVKDAI |
Ga0334986_0262545_1_114 | 3300034012 | Freshwater | MVDSKPLTQEEIIKAYKEAFGYGSQVITIDKIFRFARL |
Ga0335002_0417136_363_512 | 3300034020 | Freshwater | MVDSRPLTQEEIIKIYKEAFGKGDQLVTLEKIFRFARLIEQLHGVKDVH |
Ga0335005_0169830_469_618 | 3300034022 | Freshwater | MVDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLIEEIHGVKDAV |
Ga0334987_0148344_1482_1628 | 3300034061 | Freshwater | MDSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFKFARLIEQLHGVKDVH |
Ga0334995_0424958_684_821 | 3300034062 | Freshwater | KPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQAHGVKDAV |
Ga0334995_0687305_194_331 | 3300034062 | Freshwater | MDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFRFARLIEEIHGVK |
Ga0335019_0415878_705_818 | 3300034066 | Freshwater | MVDSKPLTQEEIIKAYKQAFGKGDQLVTLEKIFRFARL |
Ga0335028_0549913_314_472 | 3300034071 | Freshwater | MVDSKPLTQEEIIKAYKQAFGKGDQLVTLEKIFKFARLIEEIHGVKDVHQTR |
Ga0335010_0519640_3_113 | 3300034092 | Freshwater | EIIKAYKQAFGKGDQLVTLEKIFRFARLIEEIHGVK |
Ga0335027_0156375_2_112 | 3300034101 | Freshwater | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFKFAR |
Ga0335027_0855190_377_520 | 3300034101 | Freshwater | DSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFKFARLIEQLHGVKDVH |
Ga0335029_0682719_2_139 | 3300034102 | Freshwater | KPLTQEEIIKIYKEAFGKGDQLVTLEKIFRFARLIEQLHGVKDVH |
Ga0335031_0607580_524_643 | 3300034104 | Freshwater | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIE |
Ga0335036_0712875_1_141 | 3300034106 | Freshwater | MVDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLIEEIHGVKD |
Ga0335063_0472224_1_126 | 3300034111 | Freshwater | MVDSKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQL |
Ga0335066_0497755_504_647 | 3300034112 | Freshwater | DSKPLTQEEIIKAYKQAFGKGDQLVTLEKIFRFARLIEEIHGVKDVH |
Ga0335068_0104338_152_301 | 3300034116 | Freshwater | MVDSKPLTQEEIIKVYKEAFGYGSQIITIDKIFRFARLIEQLHGVKDVH |
Ga0335068_0479222_440_580 | 3300034116 | Freshwater | SKPLTQEEIIKVYKEAFGYGSQVITIDKIFRFARLIEQLHGVKDVH |
Ga0335060_0208042_179_325 | 3300034122 | Freshwater | MDSKPLTQEEIIKIYKQAFGKGDQLVTLEKIFKFARLIEQLHGVKDVH |
Ga0335049_0821412_409_546 | 3300034272 | Freshwater | KPLTQEEIIKVYKEAFGKGDQLVTLEKIFRFARLIEEIHGVKDVH |
Ga0335007_0155519_1314_1460 | 3300034283 | Freshwater | MDSKSLTQEEIIKIYKEAFGKGDQLVTLEKIFRFARLIEQLHGVKDVH |
Ga0335048_0505455_443_577 | 3300034356 | Freshwater | MDSKPLTQEEIIKIYKEAFGKGDQLVTLEKIFRFARLIEQLHGVK |
⦗Top⦘ |