Basic Information | |
---|---|
Family ID | F019455 |
Family Type | Metagenome |
Number of Sequences | 229 |
Average Sequence Length | 42 residues |
Representative Sequence | MVSNAVKMDQKEVVAALKRLRAKHSDDPEYKKLRKDLPKEWPI |
Number of Associated Samples | 192 |
Number of Associated Scaffolds | 229 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 0.00 % |
% of genes from short scaffolds (< 2000 bps) | 0.00 % |
Associated GOLD sequencing projects | 181 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (98.253 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.790 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.004 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (32.751 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 229 Family Scaffolds |
---|---|---|
PF14518 | Haem_oxygenas_2 | 25.33 |
PF09084 | NMT1 | 4.80 |
PF13379 | NMT1_2 | 1.31 |
PF01569 | PAP2 | 1.31 |
PF00903 | Glyoxalase | 0.87 |
PF04214 | DUF411 | 0.87 |
PF10506 | MCC-bdg_PDZ | 0.44 |
PF02481 | DNA_processg_A | 0.44 |
PF01588 | tRNA_bind | 0.44 |
PF02954 | HTH_8 | 0.44 |
PF07995 | GSDH | 0.44 |
PF04909 | Amidohydro_2 | 0.44 |
PF01799 | Fer2_2 | 0.44 |
PF00753 | Lactamase_B | 0.44 |
PF02738 | MoCoBD_1 | 0.44 |
PF13676 | TIR_2 | 0.44 |
PF02894 | GFO_IDH_MocA_C | 0.44 |
PF01797 | Y1_Tnp | 0.44 |
PF04143 | Sulf_transp | 0.44 |
COG ID | Name | Functional Category | % Frequency in 229 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.80 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.80 |
COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 0.87 |
COG3019 | Uncharacterized metal-binding protein, DUF411 family | Function unknown [S] | 0.87 |
COG0073 | tRNA-binding EMAP/Myf domain | Translation, ribosomal structure and biogenesis [J] | 0.44 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.44 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.44 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.44 |
COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.44 |
COG2517 | Predicted RNA-binding protein, contains C-terminal EMAP domain | General function prediction only [R] | 0.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 98.25 % |
All Organisms | root | All Organisms | 1.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005529|Ga0070741_10000092 | All Organisms → cellular organisms → Bacteria | 336348 | Open in IMG/M |
3300006903|Ga0075426_10013267 | All Organisms → cellular organisms → Bacteria | 5874 | Open in IMG/M |
3300018031|Ga0184634_10006099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4070 | Open in IMG/M |
3300020193|Ga0194131_10000678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 57714 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.79% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.55% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.11% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.68% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.37% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.06% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.62% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.62% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.18% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.18% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.75% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.75% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.75% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.31% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.31% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.31% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.31% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.87% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.87% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.87% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.87% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.87% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.44% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.44% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.44% |
Hot Spring Sediments | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments | 0.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.44% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.44% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.44% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.44% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.44% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.44% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.44% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.44% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.44% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003890 | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cm | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014264 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd | Environmental | Open in IMG/M |
3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025951 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026046 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026052 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_08011070 | 2170459024 | Grass Soil | DFEETTGMVSNTVKMDQKDVVAALKRLKANHSDDPEYQKLRKDLPREWPI |
N55_02812540 | 2189573000 | Grass Soil | SLKISQEEVVKALDRLRREKADDPEYKKLRKDLPTNWPV |
ICChiseqgaiiFebDRAFT_107217241 | 3300000363 | Soil | EETTGMVSNSVHQDQKQVVAALKRLCAQHSNDPEYKKLRKDLPKEWPI* |
F14TC_1003547112 | 3300000559 | Soil | MVSNAVKMDQKDVVAALKRLRANHRDDPEYKKLRKDLPKDWPI* |
F14TC_1020350862 | 3300000559 | Soil | SQEEVVKALNRLRREKADNPEYQKLRKDLPKSWPV* |
AF_2010_repII_A001DRAFT_100560931 | 3300000793 | Forest Soil | MVSNSLKISQEEVVNALNRLRREKADDPEYKKLRK |
AF_2010_repII_A001DRAFT_101021851 | 3300000793 | Forest Soil | SNSLKISQEEVVKALNRLRRERADDPEYKKLRKDLPKSWPV* |
JGI10216J12902_1022244921 | 3300000956 | Soil | MVSNAVKQSQKEVVAALKRLRAQHSDDVEYQKLRKDLPDEWPI* |
JGI10216J12902_1194472772 | 3300000956 | Soil | GVGFEETTGMVSNAVKQEQKEVVAALKRLRAQHSDDAEYKKLRKDLPKEWPC* |
JGI25613J43889_102173011 | 3300002907 | Grasslands Soil | MVSNAVKMSEQDVVAALKRLXANHSDDSEYKKLRKEXPKEWPI* |
soilL2_101343615 | 3300003319 | Sugarcane Root And Bulk Soil | MVSNAVGKSQEEVIAALKRLSANHSDDPDYQKLRKDLPKDWPI* |
Ga0063162_10952982 | 3300003890 | Hot Spring Sediments | MVSNSLKMDQGEVVAALKRLRANHSDDPEYQRLRKDLPRSWPI* |
Ga0055471_100463451 | 3300003987 | Natural And Restored Wetlands | MVSNAVKMDQKQVIAALKRLRARHRDDPEYKKLRKDLPADWPI* |
Ga0055438_101293201 | 3300003995 | Natural And Restored Wetlands | MVSNAVKQDQKTVVAALRRLRAQHSDDAEYKKIRKDLPKEWPI* |
Ga0055493_100723212 | 3300004049 | Natural And Restored Wetlands | MVSNAVHQSQKDVVAALKRLRAQHSDDAAYKTLRKELPKAWPI* |
Ga0055490_100162252 | 3300004052 | Natural And Restored Wetlands | MVSNAVKIPQKEVVAALKRLHAKHSDDPEYKKLRQDLPKEWPI* |
Ga0055490_100283583 | 3300004052 | Natural And Restored Wetlands | SNSLKISQEEVVKALKRLRREKTDDPEYQKLRKGLPKSWPV* |
Ga0055485_101589302 | 3300004067 | Natural And Restored Wetlands | MVSNAVHQSQKDVVAALKRLRAQHSDDAAYKTLRKDLPKAWPI* |
Ga0062589_1002825753 | 3300004156 | Soil | MVSNAVKKGQKEVVAALKRLRAQHSDDPEYKKLRKDLPKEWPI* |
Ga0063356_1005322762 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVSNSVKQSQKEVVAALKRLRAQHRDDVEYQKLRKDLPDEWPI* |
Ga0063356_1046840641 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVSNAVHQDQREVVAALKRLRAQHSDDAEYKKLRKDLPEEWPI* |
Ga0062592_1001660662 | 3300004480 | Soil | MVSNSVHQDQKQVVAALKRLCAQHSNDPEYKKLRKDLPKEWPI* |
Ga0062383_102041402 | 3300004778 | Wetland Sediment | MVSNSLKISEAEVVTALKRLHAEHSGDADYRALRKDLPKEWPI* |
Ga0062380_103888512 | 3300004779 | Wetland Sediment | MVSNAIKQDQEAVIAALTRLRAQHSNDAEYQKLRKELPKEWPC* |
Ga0062381_102820721 | 3300004808 | Wetland Sediment | MVSNAVKQDEKEVIAALARIRAQYGDDAEYQKLRKELPEEWPC* |
Ga0066683_100488732 | 3300005172 | Soil | MVSNRVKMDQKDVIKALKRLRAHHSDDPEYKKLREDLPKDWPI* |
Ga0066680_103685272 | 3300005174 | Soil | MVSNRVKMDQKDVIKALKRLRSHHSDDPEYKKLRGDLPKDWPI* |
Ga0066690_106285642 | 3300005177 | Soil | MVSNAVKMDQKEVVAALKRLKANHSDDPEYKKLRKDLPKEWPI* |
Ga0065712_105754641 | 3300005290 | Miscanthus Rhizosphere | MVSNTLKISQEEVVAALKRLHETHADDPQYQKLRKDLPAEWPI* |
Ga0065705_101181952 | 3300005294 | Switchgrass Rhizosphere | MVSNAVKMSQQDVIAALKRLRDQHSDDPEYKRLRKDLPKAWPI* |
Ga0065707_105527162 | 3300005295 | Switchgrass Rhizosphere | MVSNTLKISQEEVVAALQRLRATQSDDPQYQKLRKDLPPEWPI* |
Ga0066388_1039817141 | 3300005332 | Tropical Forest Soil | MGFEETTGMVSNTLKMNQKEVGKALKRLKRESSDTAEYQKVRR |
Ga0070680_1014123881 | 3300005336 | Corn Rhizosphere | MVSNTVGMNDDQVVAALQRLKAQHSDDPEYKKLRKDLPKEWPI* |
Ga0070689_1005360493 | 3300005340 | Switchgrass Rhizosphere | MVSNTLKISQEEVVAALKRLHETHADDPQYQKLRKDLPAE |
Ga0070689_1017265862 | 3300005340 | Switchgrass Rhizosphere | MVSNAVKKGQKEVVAALKRLRAAHSDDPEYKKLRKDLPKEWPI* |
Ga0070668_1005249531 | 3300005347 | Switchgrass Rhizosphere | MVSNTVKMDQKDVVAALKRLKANHSDDPEYQKLRKDLPSEWPI* |
Ga0070694_1000782093 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNAVKMDQEKVVAALERLCAQRGDDPDYQALRKDLPKDWPI* |
Ga0070694_1002633062 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNAVKKGQKQVVAALKRLRAAHSDDPEYKKLRKDLPKDWPI* |
Ga0070662_1001435115 | 3300005457 | Corn Rhizosphere | MVSNTVKMDQKDVVAALKRLKANHSDDPEYQKLRKDLPREWPI* |
Ga0070741_1000009227 | 3300005529 | Surface Soil | MVSNAVGMDEDRVVAALQRLKAQHSEDPDYKKLRKDLPKDWPI* |
Ga0070704_1014482012 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNAVKKGQKEVVAALKRLRARHSDDPEYKKIRNDLPKEWPV* |
Ga0066698_104400842 | 3300005558 | Soil | MVSNAVKMDQKQVIAALKRLCAHHSDDPEYKKLRGDLPKDWPI* |
Ga0066703_104474462 | 3300005568 | Soil | MVSNAVKMDQKEVVAALKRLRAKHSDDPEYKKLRKDLPKEWPI* |
Ga0066905_1019002321 | 3300005713 | Tropical Forest Soil | MVSNSVKKDQKEVVAALKRLHDKYSDDPEYKQLRKDLPKTWPI* |
Ga0074479_104163932 | 3300005829 | Sediment (Intertidal) | MVSNAVKIDQHDVVAALKRLKAKHSDDPEYKKLRKELPKEWPI* |
Ga0074473_105826732 | 3300005830 | Sediment (Intertidal) | MVSNAVKMDQKTVIAALTRLRAEHSDDAEYKKLRKDLPKEWPC* |
Ga0074470_105494321 | 3300005836 | Sediment (Intertidal) | MVSNTVHLDQKEVVAALKRLRASHSDDLEYKKLRKDLPKEWPI* |
Ga0074470_105732358 | 3300005836 | Sediment (Intertidal) | MVSNSLKLTEEEVVAALKRLRLEHGNDADYQALRNALPKEWPI* |
Ga0068858_1003964483 | 3300005842 | Switchgrass Rhizosphere | MVSNTLKISQEEVVAGLKRLHETHADDPQYQKLRKDLPAEWPI* |
Ga0066656_101330982 | 3300006034 | Soil | MVSNRVKMEQKDVIKALKRLRAHHSDDPEYKKLRGDLPKDWPI* |
Ga0066665_100145791 | 3300006796 | Soil | MVSNRVKMNQKDVIKALKRLRAHHSDDPEYKKLREDLPKDWPI* |
Ga0066665_111924181 | 3300006796 | Soil | MVSNAVDKNQREVIAALKRLRAHYRNDREYKKLRGDLPKDWPI* |
Ga0066659_108549811 | 3300006797 | Soil | QKDVIKALKRLRAHHSDDPEYKKLRGDLPKDWPV* |
Ga0066659_115570041 | 3300006797 | Soil | MVSNTVKMDQKEVVAALKRLKANHSGDPEYKKLRKDLPKEWPI* |
Ga0075428_1006106992 | 3300006844 | Populus Rhizosphere | MVSNTVHMDQQDVIAALKRLKEKYSDDLEYKRLRKDLPKEWPI* |
Ga0075428_1012010511 | 3300006844 | Populus Rhizosphere | MVSNTVKMDQKDVVAALKRLKANHSDDPEYKKLRKDLPREWPI* |
Ga0075421_1004616263 | 3300006845 | Populus Rhizosphere | MVSNAVKKEQKEVVAALKRLRAKHSNDLEYKTLRKDLPKEWPI* |
Ga0075421_1008816392 | 3300006845 | Populus Rhizosphere | MVSNAVKMDQKDVIAALKRLRAQHSDDPEYKKLRKDLPKEWPI* |
Ga0075430_1011312351 | 3300006846 | Populus Rhizosphere | MVSNTLKISQEEVIAALKRLRASRGDDPEYKKLRKDLPP |
Ga0075431_1003030674 | 3300006847 | Populus Rhizosphere | FEETTGMVSNTVKMDQKDVVAALKRLKANHSDDPEYKKLRKDLPREWPI* |
Ga0075431_1011290381 | 3300006847 | Populus Rhizosphere | SNTLKISQEEVTAALKRLRASRGDDPEYKKLRKDLPPEWPI* |
Ga0075429_1001937391 | 3300006880 | Populus Rhizosphere | KISQEEVVKALNRLRREKADNPEYQKLRKDLPKSWPL* |
Ga0075426_100132675 | 3300006903 | Populus Rhizosphere | MVSNTVKMDQKDVVASLKRLKANYSDDPEYKKLRKDLPKEWPI* |
Ga0079219_100444303 | 3300006954 | Agricultural Soil | MVSNTLKISQEEVVAALKRLHDNRRDDPEYKKLRQDLPLEWPI* |
Ga0079218_117005541 | 3300007004 | Agricultural Soil | MVSNTLKMTQEEVIAALKRARREQSDAPEYKKLRKDLPK |
Ga0066710_1001005002 | 3300009012 | Grasslands Soil | MVSNRVKMDQKDVIKALKRLRSHHSDDPEYKKLRGDLPKDWPI |
Ga0102851_117791392 | 3300009091 | Freshwater Wetlands | MVSNAVKQDQKEVVAALKRLRAQHSDDAEYKKLRKDLPKEWPI* |
Ga0111539_113442861 | 3300009094 | Populus Rhizosphere | MVSNTLKISQEEVVAALKRLRDTHRDDPEYKKLRKDLPPEWPI* |
Ga0111539_123040002 | 3300009094 | Populus Rhizosphere | MVSNAVKKEQKEVVAALKRLRAKHSDDPEYKKIRNDLPKEWPV* |
Ga0105247_111090242 | 3300009101 | Switchgrass Rhizosphere | MVSNTLKIGEDELVKALKRLKREASDDPEYQKLRNDLPSEWPI* |
Ga0066709_1003103564 | 3300009137 | Grasslands Soil | MVSNAVDKNQMEVIAALKRLRAHYRNDREYKKLRGDLPKDWPI* |
Ga0066709_1017311732 | 3300009137 | Grasslands Soil | MVSNRVKMDQKDVIKALKRLRAHHSDDPEYKKLRGDLPKDWPI* |
Ga0099792_111965062 | 3300009143 | Vadose Zone Soil | GFEETTGMVSNTVKMDQKEVVAALKRLKANHSDDPEYKKLRKDLPKEWPI* |
Ga0105092_103019371 | 3300009157 | Freshwater Sediment | MAQKDVVAALKRLLAQHSDDPEYKKLRKDLPKDWPI* |
Ga0075423_108226071 | 3300009162 | Populus Rhizosphere | MDQQEVIAALKRLKANHSDDPEYKKLRKDLPKEWPI* |
Ga0113563_101466095 | 3300009167 | Freshwater Wetlands | MVSNAVKQDQKEVVAALKRLRAQHSDDAEYKKLRTDLPKEWPI* |
Ga0113563_105981501 | 3300009167 | Freshwater Wetlands | TGMVSNAVKQDQKEVVAALKRLRAQHSDDAEYKKLRKDLPKEWPI* |
Ga0113563_129670272 | 3300009167 | Freshwater Wetlands | MVSNAVKQDQKDVVAALKRLRAQHSDDAEYKKLRKDLPKEWPI* |
Ga0114945_107240282 | 3300009444 | Thermal Springs | MVSNAVKMDQKDVIATLKRLRADHHDDPEYKKLRADLPKRWPI* |
Ga0105249_114917871 | 3300009553 | Switchgrass Rhizosphere | MVSNTVKMDQKDVVAALKRLKANHSDDPEYKKLRKDLRREWPI* |
Ga0105249_122475381 | 3300009553 | Switchgrass Rhizosphere | MVSNAVKKGQKEVVAALKRLRAAHSDDPEYKKRRKDLPKEWPI* |
Ga0105347_10477573 | 3300009609 | Soil | MVSNAVKQDQKEVVAALKRLCAQHSDDAEYKKLRKDLPKEWPI* |
Ga0105347_13620732 | 3300009609 | Soil | MVSNAVKQDQKEVVAALKRLRAQHSDDAEYKKLRKELPKEWPI* |
Ga0126307_102623272 | 3300009789 | Serpentine Soil | MVSNTVKQSQKEVLAALKRLRAQHSDDAEYKKLRKDLPDEWPI* |
Ga0126308_109349212 | 3300010040 | Serpentine Soil | MVSNAVKQSQKEVVAALKRLRAQHSDDAEYKKLRKDLPDEWPI* |
Ga0126384_100015611 | 3300010046 | Tropical Forest Soil | MVSNSVKMSQDKVVEALKRLHASHNDDPEYKKLRKDLPKEWPI |
Ga0126382_105734061 | 3300010047 | Tropical Forest Soil | KISQEEVVKALNRLRREKADDPEYQKLRKDLPKSWPV* |
Ga0126382_120313921 | 3300010047 | Tropical Forest Soil | MVSNSLKISQAQVVKALNRLQREQADDPDYKKLRKNL |
Ga0126370_105927812 | 3300010358 | Tropical Forest Soil | MVSNTLKISQDEVVAVLTRLLDKHADDPEYKKLRQDLPSEWPI* |
Ga0126378_106603481 | 3300010361 | Tropical Forest Soil | KISQDELVAVLTRLRDKHADDPEYKKLRQDLPSEWPI* |
Ga0126378_133156042 | 3300010361 | Tropical Forest Soil | MVSNTLKISQDEVVAVLTRLRDKQANDPEYKKLRQDLPPEWPI* |
Ga0134125_107451363 | 3300010371 | Terrestrial Soil | MVSNTLKISQEEVVAALKRLRETHADDPQYQKLRKDLPAEW |
Ga0126381_1027253411 | 3300010376 | Tropical Forest Soil | MVSNTLKISQDEVVAALTRLLDKHADDPEYKKLRQNLPSEWPI* |
Ga0134124_105556723 | 3300010397 | Terrestrial Soil | MVSNTLKISQEEVAAALERLRDTHADDSQYQKLRKDLPPDW |
Ga0126383_107104333 | 3300010398 | Tropical Forest Soil | LKISQEEVVKALNRLRREKADDPEYKKLRKDLPKSWPV* |
Ga0134127_102796012 | 3300010399 | Terrestrial Soil | MVSNAVKMSQQDVIAALQRLRDRHSEDPEYKKLRKELPKGWPI* |
Ga0134127_129076652 | 3300010399 | Terrestrial Soil | GFEETTGMVSNTVRMDQKDVVAALKRLKTNHSDDPEYKKLRKDLPREWPI* |
Ga0134122_107666431 | 3300010400 | Terrestrial Soil | MVSNAVHQDQKAVVAALKRLRAQHSDDAEYKKIRNELPKDWPI* |
Ga0134123_111469121 | 3300010403 | Terrestrial Soil | MVSNAVKMSQQDVIAALQRLHDRHGEDPEYKKLRKEL |
Ga0137312_10329033 | 3300011400 | Soil | MVSNAVKMDQEKVVAALQRLCAQRGNDPDYQALRKDLPKDWPI* |
Ga0137313_10080253 | 3300011403 | Soil | SLKISQEEVVKALDRLRREKADNPEYQKLRKDLPKNWPL* |
Ga0137448_12411712 | 3300011427 | Soil | MVSNAVKKGQKEVVAALKRLRAEQSADAEYKKLRKDLPKEWPI* |
Ga0137455_12306632 | 3300011429 | Soil | MVSNAVKQDQKEVVAALKRLRAQHSDDGEYKKLRKDLPKEWPI* |
Ga0137426_11350532 | 3300011435 | Soil | MVSNAVKQDQKEVVAALQRLRAQHRDDAEYKTLRKELPKEWPI* |
Ga0137437_11475761 | 3300011442 | Soil | NAVKKGQKEVVAALKRLRAEHSDDPEYKKLRKDLPKDWPI* |
Ga0137461_10048014 | 3300012040 | Soil | MVSNSVKQNQKEVVAALKRLRANHSDDPEYKSLRKELPKEWPI* |
Ga0137350_10589292 | 3300012166 | Soil | MVSNAVKQDQKEVVAALKRLRAQHSDDAEYKKLRKELPKEWPC* |
Ga0137327_10438722 | 3300012173 | Soil | MVSNSLKISQKEIAAALKRLHAEHSDDPEYKTLRKDLPKGWPC* |
Ga0137382_101807361 | 3300012200 | Vadose Zone Soil | MVSNTVRMDQKDVVAALKRLKTNHSDDPEYKKLRKDLPKEWPI* |
Ga0137382_101869633 | 3300012200 | Vadose Zone Soil | SLKISQEEVVKALNRLRRKKADDPEYQKLRKDLPKNWPL* |
Ga0137382_105232161 | 3300012200 | Vadose Zone Soil | MVSNTVKMDQKEVVAALKRLKANRSDDPEYKKLRKDLPKEWPI* |
Ga0137399_101619192 | 3300012203 | Vadose Zone Soil | MVSNTVRMDQKDVVAALKRLKTNHSDDPEYKKLRKDLPREWPI* |
Ga0137399_111692951 | 3300012203 | Vadose Zone Soil | MVSNAVKMDQKEVVAALKRLKANHSDDPEYKKLRKDLPK |
Ga0137374_105788923 | 3300012204 | Vadose Zone Soil | MVSNSVKMDQKDVVAALKRLRANHSDDPEYKKLRKDLPKGWPI* |
Ga0137376_106430931 | 3300012208 | Vadose Zone Soil | MVSNTVKMDQKEVVAALKRLKANHSDDPEYKKLRKDLPKEWPI* |
Ga0137459_11573632 | 3300012228 | Soil | GMVSNAVKISQDEVVAALGRLRAKHSDDAEYKKLRQDLPKEWPC* |
Ga0137370_109436342 | 3300012285 | Vadose Zone Soil | TGMVSNTVKMDQKEVVAALKRLKANHSGDPEYKKLRKDLPKEWPI* |
Ga0137385_103651301 | 3300012359 | Vadose Zone Soil | TTGMVSNRVKMDQKDVIKALKRLRAHHSDDPEYKKLREDLPKDWPI* |
Ga0157320_10282332 | 3300012481 | Arabidopsis Rhizosphere | MVSNTVKMDQKDVVAALKRLKTNHSDDPEYKKLRKDLPREWPI* |
Ga0157327_10088602 | 3300012512 | Arabidopsis Rhizosphere | MVSNTVRMDQKEVVAALKRLKTNHSDDPEYKKLRKELPREWPI* |
Ga0157330_10229691 | 3300012514 | Soil | MVSNTVKMDQKDVVAALKRLKTNHSDDPEYKKLRKELPREWPI* |
Ga0137358_101968283 | 3300012582 | Vadose Zone Soil | MVSNTVKMDQKDVVAALKRLKAHHSDAPEYKKLRKDLPREWPI* |
Ga0157301_102049932 | 3300012911 | Soil | MVSNTLKISQEEVVAALKRLHETHADDPQYQKLRKDLPDEWPI* |
Ga0137396_105677032 | 3300012918 | Vadose Zone Soil | MVSNAVKMDQKEVGAALKRLKANHSDDPEYKKLRKDLPKEWPI* |
Ga0137404_102945463 | 3300012929 | Vadose Zone Soil | MVSNTVKMDQKDVVAALKRLKTNHGDVPDYKKLRKDLPREWPI* |
Ga0153915_100754396 | 3300012931 | Freshwater Wetlands | MVSNAVKMAEKQVVSALKRLRAHHSDDPEYKKLRKELPDDWPI* |
Ga0153915_113115402 | 3300012931 | Freshwater Wetlands | MVSNAVKMDEKKVVAALKRLRAHHSDDPEYKKLRKELPDDWPI* |
Ga0153915_123153842 | 3300012931 | Freshwater Wetlands | GFEETTGMVSNALKINQKEVIAALKRLRAHHSDDPEYKKLRKELPDDWPI* |
Ga0164300_101539793 | 3300012951 | Soil | GLAVEETTGMVSNTVKMDQKDVVAALKRLKANHSDDPEYQKLRKDLPREWPI* |
Ga0164299_109038672 | 3300012958 | Soil | MVSNTVKMDQKDLVAALKRLKANHSDDLEYQKLRKDLPREWPI* |
Ga0164304_104785892 | 3300012986 | Soil | ETTGMVSNTVKMDQKDVVAALKRLKANHSDDPEYKKLRKDLPREWPI* |
Ga0164304_112885271 | 3300012986 | Soil | QEEVVAALERLRDTHADDSQYQKLRKDLPPDWPI* |
Ga0157374_100584376 | 3300013296 | Miscanthus Rhizosphere | MVSNTLKSSEEEVVAALKRLHETHADDPQYQKVRKDLPAEWPI* |
Ga0157378_101127122 | 3300013297 | Miscanthus Rhizosphere | MVSNSVKMSQDEVVEALKRLCANHSDDPEYKKLRKDLPKEWPI* |
Ga0157378_112842631 | 3300013297 | Miscanthus Rhizosphere | TGMVSNTLKISQEEVVAALKRLHETHADDPQYQKLRKDLPAEWPI* |
Ga0075308_10775542 | 3300014264 | Natural And Restored Wetlands | MVSNAVKIPQKEVVAALKRLHAKHSDDPEYKKHRQDLPKEWPI* |
Ga0075314_10065151 | 3300014265 | Natural And Restored Wetlands | QKDVVAALKRLRSQHGDGPEYNKLRKDLPKDWPI* |
Ga0075321_10242421 | 3300014300 | Natural And Restored Wetlands | QKQVIAALKRLRARHRDDPEYKKLRKDLPADWPI* |
Ga0180082_11353431 | 3300014880 | Soil | VSNAVKKGQKEVVAALKRLRAAHSDDPEYKKLRKDLPKEWPI* |
Ga0180077_10518832 | 3300015255 | Soil | MVSNAVKQEQKEVVAALKRLRAQHSDDAEYKKLRKELPKEWPI* |
Ga0180093_10783262 | 3300015258 | Soil | MVSNSLKISQEEVVKALDRLRREKADNPEYQKLRKDLPK |
Ga0132258_121156103 | 3300015371 | Arabidopsis Rhizosphere | MVSNTLKISQEEVVAALERLRDNCRDDPEYLKLRKDLPPEWPI* |
Ga0132256_1001493831 | 3300015372 | Arabidopsis Rhizosphere | TGMVSNTVKMDQKDVVAALKRLKTNHSDDPEYKKLRKDLPREWPI* |
Ga0132256_1025506841 | 3300015372 | Arabidopsis Rhizosphere | MVSNTVKMDQKDVVAALKRLKTNHSDDPEYKKLRKD |
Ga0132257_1003334101 | 3300015373 | Arabidopsis Rhizosphere | MDQKDVVAALKRLKTNHSDDPEYKKLRKDLPREWLI* |
Ga0132257_1006107492 | 3300015373 | Arabidopsis Rhizosphere | MVSSAVKMEEKSVIAALKRLLTHHGDDPEYHKLRGDLPKDWPI* |
Ga0132257_1035906521 | 3300015373 | Arabidopsis Rhizosphere | MVSNAVKKGQKEVVAALKRLRAAHSDDPEYKKLRKDLPKQWPI* |
Ga0132255_1022816303 | 3300015374 | Arabidopsis Rhizosphere | MVSNTVKMDQKDVVAALKRLKTNHSDDPEYKKLRKDL |
Ga0182041_119552502 | 3300016294 | Soil | MVSNTLKISQDEVVAALTRLRNRHADDLEYNTLRQDLPSEW |
Ga0163161_119821332 | 3300017792 | Switchgrass Rhizosphere | MVSNTVKMDQKDVVAALKRLKANHSDDPEYKKLRKDLPREWPI |
Ga0184604_100957752 | 3300018000 | Groundwater Sediment | MVSNAVKMDQEKVVAALQRLCAQRGDDPDYQALRKDLPKDWPI |
Ga0184605_101676922 | 3300018027 | Groundwater Sediment | MVSNSVKMDQKDVVAALKRLRANHSDDPEYKKLRKDLPKEWPI |
Ga0184634_100060995 | 3300018031 | Groundwater Sediment | MVSNAVKMDQKDVVAALKRLRANHSDDPEYKRLRKDLPRDWPI |
Ga0184623_104345861 | 3300018056 | Groundwater Sediment | MVSNAVKMSQQEVIAALKRLRAAHSDDPEYKKLRKDLPKE |
Ga0184637_104087442 | 3300018063 | Groundwater Sediment | MVSNAVKMDQKDVVAALKRLRANHSDDPEYKRLRKDLPKDWPI |
Ga0184627_102476482 | 3300018079 | Groundwater Sediment | MVSNSLKISQEEIVAALKRLHAKHSDDPEYKTLRKELPKGWPV |
Ga0184639_103599541 | 3300018082 | Groundwater Sediment | MGFEETTGMVSNSLKISQEEVVAALKRLRAERRDDDEYKTLRKELPKEWPV |
Ga0184628_100048076 | 3300018083 | Groundwater Sediment | MVSNAVKQDQKEVVAALKRLRAQHSDDAEYKKLRKELPKEWPI |
Ga0184628_100145796 | 3300018083 | Groundwater Sediment | MVSNAVKKGQKEVVAALKRLRAAHSDDPEYKKLRKDLPKEWPI |
Ga0190265_102522783 | 3300018422 | Soil | MVSNAVKQDPEEVVAALKRLRVRHGGDPEYKKLRKDLPKEWPV |
Ga0190272_112738052 | 3300018429 | Soil | MVSNAVKQDQKEVVAALKRLRAQHSDDAEYKKLRKELPKEWPC |
Ga0066655_100231214 | 3300018431 | Grasslands Soil | MGFEETTGMVSNRVKMDQKDVIKALKRLRAHHSDDPEYKKLREDLPKDWPI |
Ga0190275_100342256 | 3300018432 | Soil | MVSNAVKQDPGQVVAALKRLRARHGDDPEYKKLRKDLPKEWPI |
Ga0190268_123671452 | 3300018466 | Soil | MVSNAVKQSQKEVVAALKRLRAQHSDDVEYQKLRKDLPDEWPI |
Ga0190270_100531545 | 3300018469 | Soil | MVSNAVKKEQKEVVAALKRLRAKHSNDPEYEKLRK |
Ga0190270_101802542 | 3300018469 | Soil | MVSNAVKQDQKEVVAALKRLRAQHSDDAEYKKLRKDLPKEWPC |
Ga0190274_117583112 | 3300018476 | Soil | MVSNSVKQSQKEVVAALKRLRAQHRDDVEYQKLRKDLPDEWPI |
Ga0190271_116082692 | 3300018481 | Soil | MVSNAVKQDQKEVVAALKRLRAQHSDDVEYKKLRKELPKDWPC |
Ga0066669_123090411 | 3300018482 | Grasslands Soil | MVSNTVKIDQKEVVAALKRLKANHSDDPEYKKLRKDLPKEWPI |
Ga0173482_100226253 | 3300019361 | Soil | MVSNTLKISQEEVVAGLKRLHETHADDPQYQKLRKDLPAEWPI |
Ga0137408_11368711 | 3300019789 | Vadose Zone Soil | WSPIHSRFSQQEIVAALKRLRAHHSDDPEYKKLRKDLPKDWPI |
Ga0193715_10169942 | 3300019878 | Soil | MVSNAVKMDQKEVVAALKRLKANHSDDPEYKKLRKDLPKEWPI |
Ga0193713_10402122 | 3300019882 | Soil | MVSNTVKMDQKDVVAALKRLKANHSDDPEYQKLRKDLPREWPI |
Ga0193743_11105012 | 3300019889 | Soil | MVSNAVKMDQEEVVTALKRLRAQRGDDPDYQALRKDLPKDWPI |
Ga0193739_10675273 | 3300020003 | Soil | MVSNAVKMDQKDVVAALKRLRANHSDDPEYKRLRKDLPKNWPI |
Ga0193717_11035652 | 3300020060 | Soil | MVSSAVKMNQQEVIAALKRLRAEHSDDPEYKKLRKDLPKAWPI |
Ga0194131_1000067841 | 3300020193 | Freshwater Lake | MVSNAVRKSQDEVVAALKRLRANHSDDAEYKGLRRDLPKEWPI |
Ga0210378_100058738 | 3300021073 | Groundwater Sediment | MDQKDVVAALKRLRAKHSDDPEYKKLRKDLPKDWPI |
Ga0212128_109542672 | 3300022563 | Thermal Springs | MVSNAVKMDQKDVIATLKRLRADHHDDPEYKKLRADLPKRWPI |
Ga0209619_104224351 | 3300025159 | Soil | MVSNSLKISQEGVVAALKRLRAEHSADADYKKLRKDL |
Ga0207666_10539212 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNTLKISQEEVVAGLKRLHETHADDPQYQKLRKDLPAE |
Ga0210087_10015522 | 3300025559 | Natural And Restored Wetlands | MVSNAVKMDQKQVIAALKRLRARHRDDPEYKKLRKDLPADWPI |
Ga0210115_10081452 | 3300025791 | Natural And Restored Wetlands | MAQKDVVAALKRLRSQHGDDPEYNKLRKDLPKDWPI |
Ga0207707_100348572 | 3300025912 | Corn Rhizosphere | MVSNTVGMNDDQVVAALQRLKAQHSDDPEYKKLRKDLPKEWPI |
Ga0207663_111158232 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSNTVKMDQKDVVAALKRLKTNHSDDPEYQKLRKDLPREWPI |
Ga0207660_113899252 | 3300025917 | Corn Rhizosphere | MVSNAVKMDQEKVVAALERLCAQRGDDPDYQALRKDLPKDWPI |
Ga0210066_10663452 | 3300025951 | Natural And Restored Wetlands | MVSNAVHQSQKDVVAALKRLRAQHSDDAAYKTLRKDLPKAWPI |
Ga0210102_10012457 | 3300025971 | Natural And Restored Wetlands | MVSNAVHQSQKDVVAALQRLRAQHSDDAAYKTLRKDLPKAWPI |
Ga0207640_120924022 | 3300025981 | Corn Rhizosphere | SNTLKISQEEVVATLKRLHETHADDPQYQKLRKDLPAEWPI |
Ga0208780_10010401 | 3300026046 | Natural And Restored Wetlands | MVSNTLKMAQKDVVAALKRLRSQHGDDPEYNKLRK |
Ga0208289_10120992 | 3300026052 | Natural And Restored Wetlands | MDQKQVIAALKRLRARHRDDPEYKKLRKDLPADWPI |
Ga0207702_101819331 | 3300026078 | Corn Rhizosphere | ISQEEVVAALKRLHETHADDPQYQKLRKDLPAEWPI |
Ga0207674_106242262 | 3300026116 | Corn Rhizosphere | MVSNSVHQDQKQVVAALKRLCAQHSNDPEYKKLRKDLPKEWPI |
Ga0209469_11205062 | 3300026307 | Soil | MVSNRVKMDQKDVIKALKRLRAHHSDDPEYKKLREDLPKDWPI |
Ga0209131_10285303 | 3300026320 | Grasslands Soil | MVSNAVKMSEQDVVAALKRLCANHSDDSEYKKLRKEMPKEWPI |
Ga0209266_12808551 | 3300026327 | Soil | LKISQEEVVKALDRLRRKKADDPEYQKLRKDLPKNWPL |
Ga0209967_10467801 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MVSNSLKIRQEEVVKALDRLRREKADDPDYKKLRKDLP |
Ga0210000_10137431 | 3300027462 | Arabidopsis Thaliana Rhizosphere | MVSNAVKMDQKQVIAALKRLRAHHSDDPEYKKLRKALPADWPI |
Ga0209073_101780812 | 3300027765 | Agricultural Soil | SNTLKISQEEVVAALERLRDNCRDDPEYRKLRKDLPPEWPI |
Ga0209706_102878142 | 3300027818 | Freshwater Sediment | MVSNAVKQDQKDVVAALKRLRARHSDDAAYKTLRKDLPKEWPI |
Ga0209683_100970433 | 3300027840 | Wetland Sediment | MVSNSLKISEAEVVTALKRLHAEHSGDADYKALRKDLPKEWPI |
Ga0209798_102266002 | 3300027843 | Wetland Sediment | MVSNSLKISEAEVVTALKRLHAEHSGDADYRALRKDLPKEWPI |
Ga0209798_105621542 | 3300027843 | Wetland Sediment | MVSNAVKQDQKEVIAALARIRAQYGDDAEYQKLRKELPEEWPC |
Ga0207428_102415562 | 3300027907 | Populus Rhizosphere | MVSNTLKISQEEVVAALKRLRDTHRDDPEYKKLRKDLPPEWPI |
Ga0307281_103098522 | 3300028803 | Soil | MVSNAVKITQKEVIAALKRLRAEHSDDPEYKTLRKDLPKGWPC |
Ga0299907_104312972 | 3300030006 | Soil | MVSNSLKMEQKDVVAALKRLRAQTSDEPEYRKLRKDLPKEWPI |
Ga0299907_104770643 | 3300030006 | Soil | MVSNAVKMSQQDVIAALKRLRAQHSDDPEYKKLRK |
Ga0302046_104870551 | 3300030620 | Soil | MVSNTLKMAQKDVIAALQRLRAQHSDDPEYQELRKGLPKKWPC |
Ga0307498_100319183 | 3300031170 | Soil | MVSNTVKMDQKDVVAALKRLKANHSDDPEYKKLRKDL |
(restricted) Ga0255310_101763142 | 3300031197 | Sandy Soil | MVSNAVKMSQQDVIAALKRLRDQHSDDPEYKRLRKDLPKAWPI |
Ga0307495_100923642 | 3300031199 | Soil | MVSNTVKMDQKDVVAALKRLKTNHSDDPEYKKLRKDLPREWPI |
Ga0299913_100194714 | 3300031229 | Soil | MVSNTLKMAQPDVIAALKRLRARQGDDPEYKKLRKDLPEEWPC |
Ga0307505_106374282 | 3300031455 | Soil | MVSNAVKMDQEKVVAALQRLCAQRGNDPDYQALRKDLPKDWPI |
Ga0307408_1014574792 | 3300031548 | Rhizosphere | MVSNAVKQSQKEVVAALKRLRAQHSDDVEYQKLRKDLPD |
Ga0307406_103119202 | 3300031901 | Rhizosphere | MVSNAVKQSQKEVVAALKRLRAQHSDDVEYQILRKDLPDEWPI |
Ga0307407_108061531 | 3300031903 | Rhizosphere | MVSNAVHQDQRAVVAALKRLRAQHSDDAEYKKLRKDLPEEWPI |
Ga0307409_1013558032 | 3300031995 | Rhizosphere | SNAVKQSQKEVVAALKRLRAQHSDDVEYQKLRKDLPDEWPI |
Ga0306922_114215332 | 3300032001 | Soil | MVSNTLKMDQEEVVKALKRLRREHSDDPEYQKLRRDL |
Ga0310890_114147312 | 3300032075 | Soil | KISQEEVAAALERLRDTHADDSQYQKLRKDLPPDWPI |
Ga0315281_111539012 | 3300032163 | Sediment | MVSNSVKQDQKAVVAALKRLRAEHSDDAEYKKLRKDLPKEWPI |
Ga0310889_106941832 | 3300032179 | Soil | MVSNAVKKEQKEVVAALKRLRAKHSNDPEYKTLRKDLPKEWPI |
Ga0307472_1000597693 | 3300032205 | Hardwood Forest Soil | MVSNTVKMDQKDVVAALKRLKANHSDDPEYQKLRKDLPSEWPI |
Ga0335070_100473953 | 3300032829 | Soil | MVSNAVKMDEQAVVAALKRLRAQHSDDPHYKQLRKDLPAEWPI |
Ga0316628_1000921783 | 3300033513 | Soil | MVSNAVKMDQKTVVAALKRLRAHYREDPEYKKLRKDLPDDWPV |
Ga0316628_1005587123 | 3300033513 | Soil | MVSNAVKMDQKEVLAALKRLKAKHSDDPEYKKLRKDLPKEWPI |
Ga0364930_0173020_204_335 | 3300033814 | Sediment | MVSNAVKITQKEVVAALKRLHAKHSDDPEYKTLRKDLPEGWPI |
Ga0364925_0399237_26_157 | 3300034147 | Sediment | MVSNAVKQDQKEVVAALKRLCAQHSDDAEYKKLRKDLPKEWPI |
Ga0364929_0123877_259_390 | 3300034149 | Sediment | MVSSAVNMEQKSVIAALKRLRTHHGDDPEYHKLRGDLPKDWPI |
Ga0370498_021833_192_323 | 3300034155 | Untreated Peat Soil | MVSNAVKQDQKEVVAALKRLRAQHSDYAEYKKLRKELPKEWPC |
⦗Top⦘ |