NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020103

Metagenome / Metatranscriptome Family F020103

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020103
Family Type Metagenome / Metatranscriptome
Number of Sequences 226
Average Sequence Length 51 residues
Representative Sequence AIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEIPCTHDCV
Number of Associated Samples 189
Number of Associated Scaffolds 226

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.75 %
% of genes near scaffold ends (potentially truncated) 93.36 %
% of genes from short scaffolds (< 2000 bps) 87.17 %
Associated GOLD sequencing projects 176
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.708 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.681 % of family members)
Environment Ontology (ENVO) Unclassified
(25.664 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.035 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.26%    β-sheet: 10.26%    Coil/Unstructured: 79.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 226 Family Scaffolds
PF00171Aldedh 24.34
PF00535Glycos_transf_2 15.49
PF13489Methyltransf_23 4.87
PF00483NTP_transferase 1.77
PF00908dTDP_sugar_isom 1.33
PF16363GDP_Man_Dehyd 0.88
PF03551PadR 0.88
PF00400WD40 0.44
PF02780Transketolase_C 0.44
PF12502DUF3710 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 226 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 24.34
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 24.34
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 24.34
COG1898dTDP-4-dehydrorhamnose 3,5-epimerase or related enzymeCell wall/membrane/envelope biogenesis [M] 1.33
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.88
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.88
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.71 %
UnclassifiedrootN/A9.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig126521All Organisms → cellular organisms → Bacteria892Open in IMG/M
2166559005|cont_contig83713Not Available656Open in IMG/M
2166559006|FI_contig22484Not Available653Open in IMG/M
2170459010|GIO7OMY01BZP6SAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales534Open in IMG/M
2170459012|GOYVCMS01B3M9GAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
2170459024|GZRSKLJ01EPG3WNot Available517Open in IMG/M
2170459024|GZTSFBX01A56MVNot Available518Open in IMG/M
3300005163|Ga0066823_10061198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium703Open in IMG/M
3300005168|Ga0066809_10234183All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005172|Ga0066683_10632719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales644Open in IMG/M
3300005328|Ga0070676_10570729All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300005331|Ga0070670_100718915All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300005332|Ga0066388_103641036All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300005337|Ga0070682_101697301Not Available548Open in IMG/M
3300005343|Ga0070687_100281171All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300005363|Ga0008090_10125957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium1449Open in IMG/M
3300005434|Ga0070709_11277940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300005434|Ga0070709_11569857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300005435|Ga0070714_100307002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium1480Open in IMG/M
3300005435|Ga0070714_100790011Not Available919Open in IMG/M
3300005439|Ga0070711_100887310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300005451|Ga0066681_10925358All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005530|Ga0070679_100301006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1554Open in IMG/M
3300005553|Ga0066695_10212017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1217Open in IMG/M
3300005556|Ga0066707_10129166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1583Open in IMG/M
3300005564|Ga0070664_100133868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae2178Open in IMG/M
3300005566|Ga0066693_10396937All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005598|Ga0066706_11321514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales545Open in IMG/M
3300005616|Ga0068852_100092593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae2707Open in IMG/M
3300005764|Ga0066903_104243145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium767Open in IMG/M
3300005921|Ga0070766_11210731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium chlorophenolicum523Open in IMG/M
3300006028|Ga0070717_12084011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aliadipatigenens510Open in IMG/M
3300006034|Ga0066656_10322282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales998Open in IMG/M
3300006163|Ga0070715_10052391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1760Open in IMG/M
3300006173|Ga0070716_100909851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia689Open in IMG/M
3300006176|Ga0070765_100881842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola846Open in IMG/M
3300006572|Ga0074051_11779929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales898Open in IMG/M
3300006574|Ga0074056_11507068All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300006604|Ga0074060_11930285Not Available549Open in IMG/M
3300006797|Ga0066659_11572460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300006804|Ga0079221_10235679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1029Open in IMG/M
3300006806|Ga0079220_10046148All Organisms → cellular organisms → Bacteria2028Open in IMG/M
3300006806|Ga0079220_10053886All Organisms → cellular organisms → Bacteria1910Open in IMG/M
3300006806|Ga0079220_10620660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium chlorophenolicum774Open in IMG/M
3300006871|Ga0075434_100314077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium1587Open in IMG/M
3300006871|Ga0075434_100628426Not Available1092Open in IMG/M
3300006904|Ga0075424_102876285All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300006953|Ga0074063_13535368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales688Open in IMG/M
3300006954|Ga0079219_10431397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae889Open in IMG/M
3300009012|Ga0066710_102373986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia769Open in IMG/M
3300009101|Ga0105247_10971231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales661Open in IMG/M
3300009174|Ga0105241_10038698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3596Open in IMG/M
3300009174|Ga0105241_10112927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae2177Open in IMG/M
3300009545|Ga0105237_10338856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1508Open in IMG/M
3300009545|Ga0105237_12211360All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300010043|Ga0126380_10043962All Organisms → cellular organisms → Bacteria2365Open in IMG/M
3300010046|Ga0126384_10025266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3878Open in IMG/M
3300010147|Ga0126319_1577238Not Available689Open in IMG/M
3300010152|Ga0126318_11118901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia716Open in IMG/M
3300010154|Ga0127503_10075138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales618Open in IMG/M
3300010320|Ga0134109_10482570All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300010337|Ga0134062_10484968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300010360|Ga0126372_10455976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1187Open in IMG/M
3300010371|Ga0134125_10719473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1100Open in IMG/M
3300010375|Ga0105239_11616961Not Available749Open in IMG/M
3300010376|Ga0126381_101189638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1102Open in IMG/M
3300010396|Ga0134126_11263942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola819Open in IMG/M
3300010398|Ga0126383_10564490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1205Open in IMG/M
3300010398|Ga0126383_12294557All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300010401|Ga0134121_11939280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300011119|Ga0105246_10075089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium chlorophenolicum2392Open in IMG/M
3300011120|Ga0150983_14731171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales933Open in IMG/M
3300011120|Ga0150983_15406600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aliadipatigenens640Open in IMG/M
3300012198|Ga0137364_10190128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1501Open in IMG/M
3300012199|Ga0137383_10853181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia665Open in IMG/M
3300012200|Ga0137382_10432701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae930Open in IMG/M
3300012202|Ga0137363_10229871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1500Open in IMG/M
3300012211|Ga0137377_10127693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus2428Open in IMG/M
3300012211|Ga0137377_10271925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1626Open in IMG/M
3300012285|Ga0137370_10701695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300012359|Ga0137385_11653705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales504Open in IMG/M
3300012387|Ga0134030_1184762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium748Open in IMG/M
3300012482|Ga0157318_1000688All Organisms → cellular organisms → Bacteria1531Open in IMG/M
3300012515|Ga0157338_1024238All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300012683|Ga0137398_10072893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2099Open in IMG/M
3300012685|Ga0137397_10261387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1290Open in IMG/M
3300012685|Ga0137397_10692079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300012922|Ga0137394_10660682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae881Open in IMG/M
3300012929|Ga0137404_10324614All Organisms → cellular organisms → Bacteria1341Open in IMG/M
3300012960|Ga0164301_11544343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300012984|Ga0164309_11866896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales515Open in IMG/M
3300013104|Ga0157370_10472224All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300014325|Ga0163163_10114156All Organisms → cellular organisms → Bacteria2732Open in IMG/M
3300014968|Ga0157379_10145656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae2136Open in IMG/M
3300015371|Ga0132258_10682401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae2585Open in IMG/M
3300015371|Ga0132258_11128753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1982Open in IMG/M
3300015372|Ga0132256_100722798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1112Open in IMG/M
3300015372|Ga0132256_100731596All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300015372|Ga0132256_102015519All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300015373|Ga0132257_100142830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae2798Open in IMG/M
3300015373|Ga0132257_100708914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1251Open in IMG/M
3300015373|Ga0132257_100770799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1199Open in IMG/M
3300015373|Ga0132257_101800112All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300016294|Ga0182041_11274564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300016371|Ga0182034_10365013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1176Open in IMG/M
3300019890|Ga0193728_1199929All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300020012|Ga0193732_1076366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium548Open in IMG/M
3300020140|Ga0179590_1148101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300020580|Ga0210403_10759217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia773Open in IMG/M
3300020582|Ga0210395_10534733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola881Open in IMG/M
3300021178|Ga0210408_10468206Not Available1003Open in IMG/M
3300021404|Ga0210389_11108377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300021405|Ga0210387_10605943All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300021405|Ga0210387_10611617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae968Open in IMG/M
3300021420|Ga0210394_11184284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium chlorophenolicum656Open in IMG/M
3300021474|Ga0210390_10251074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1498Open in IMG/M
3300021475|Ga0210392_10903375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia660Open in IMG/M
3300021475|Ga0210392_11048044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales611Open in IMG/M
3300021477|Ga0210398_10287543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1341Open in IMG/M
3300021479|Ga0210410_10051341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3593Open in IMG/M
3300021479|Ga0210410_10611201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium967Open in IMG/M
3300021560|Ga0126371_13353710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales541Open in IMG/M
3300021860|Ga0213851_1377652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium502Open in IMG/M
3300022529|Ga0242668_1033852All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300024222|Ga0247691_1015761All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300024232|Ga0247664_1014268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1837Open in IMG/M
3300024275|Ga0247674_1017933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia815Open in IMG/M
3300024288|Ga0179589_10177491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia921Open in IMG/M
3300024347|Ga0179591_1095754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4065Open in IMG/M
3300025898|Ga0207692_10325107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales942Open in IMG/M
3300025898|Ga0207692_11108838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300025900|Ga0207710_10032004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae2303Open in IMG/M
3300025905|Ga0207685_10147601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1061Open in IMG/M
3300025905|Ga0207685_10181386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola976Open in IMG/M
3300025906|Ga0207699_10312405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1100Open in IMG/M
3300025906|Ga0207699_10869990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300025907|Ga0207645_10435797Not Available884Open in IMG/M
3300025911|Ga0207654_10133752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1573Open in IMG/M
3300025915|Ga0207693_10801708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia726Open in IMG/M
3300025916|Ga0207663_10515863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae930Open in IMG/M
3300025928|Ga0207700_10785820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae851Open in IMG/M
3300025929|Ga0207664_10942962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300025939|Ga0207665_10004678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9094Open in IMG/M
3300025939|Ga0207665_10861447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia718Open in IMG/M
3300025942|Ga0207689_10783209Not Available805Open in IMG/M
3300025960|Ga0207651_10245661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1461Open in IMG/M
3300026911|Ga0209620_1000248All Organisms → cellular organisms → Bacteria2984Open in IMG/M
3300027050|Ga0209325_1000763All Organisms → cellular organisms → Bacteria2465Open in IMG/M
3300027371|Ga0209418_1031660All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300027605|Ga0209329_1116029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300027725|Ga0209178_1273567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aliadipatigenens616Open in IMG/M
3300027817|Ga0209112_10036958All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300027855|Ga0209693_10069127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1741Open in IMG/M
3300027855|Ga0209693_10203946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium973Open in IMG/M
3300027908|Ga0209006_10169741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1907Open in IMG/M
3300027915|Ga0209069_11022629Not Available508Open in IMG/M
3300028138|Ga0247684_1023739All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300028716|Ga0307311_10085528All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300028718|Ga0307307_10144349All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300028792|Ga0307504_10118656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales865Open in IMG/M
3300028799|Ga0307284_10323020All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300028828|Ga0307312_10148816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium1484Open in IMG/M
3300028876|Ga0307286_10215276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium chlorophenolicum699Open in IMG/M
3300028884|Ga0307308_10059145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1804Open in IMG/M
3300028885|Ga0307304_10599180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium510Open in IMG/M
3300028885|Ga0307304_10606559Not Available507Open in IMG/M
3300028906|Ga0308309_10348553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1262Open in IMG/M
3300028906|Ga0308309_11890519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales504Open in IMG/M
3300031543|Ga0318516_10049159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola2289Open in IMG/M
3300031543|Ga0318516_10856061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300031546|Ga0318538_10015429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae3292Open in IMG/M
3300031572|Ga0318515_10262617Not Available926Open in IMG/M
3300031640|Ga0318555_10396939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium chlorophenolicum747Open in IMG/M
3300031640|Ga0318555_10613036All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300031715|Ga0307476_10052180Not Available2789Open in IMG/M
3300031715|Ga0307476_10248897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium1297Open in IMG/M
3300031718|Ga0307474_10922610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae691Open in IMG/M
3300031719|Ga0306917_11431219Not Available533Open in IMG/M
3300031720|Ga0307469_11593251All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300031723|Ga0318493_10015155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3285Open in IMG/M
3300031736|Ga0318501_10074363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1648Open in IMG/M
3300031740|Ga0307468_100356428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1094Open in IMG/M
3300031747|Ga0318502_10042950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae2349Open in IMG/M
3300031765|Ga0318554_10715962Not Available561Open in IMG/M
3300031770|Ga0318521_10097109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1615Open in IMG/M
3300031770|Ga0318521_10942863All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300031771|Ga0318546_10146463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1589Open in IMG/M
3300031781|Ga0318547_10288957All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300031782|Ga0318552_10397570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae702Open in IMG/M
3300031819|Ga0318568_10123172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1569Open in IMG/M
3300031831|Ga0318564_10184367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola930Open in IMG/M
3300031833|Ga0310917_10909855Not Available592Open in IMG/M
3300031845|Ga0318511_10016423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola2635Open in IMG/M
3300031858|Ga0310892_11086391All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300031859|Ga0318527_10259507All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300031860|Ga0318495_10100450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1302Open in IMG/M
3300031879|Ga0306919_11017006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola633Open in IMG/M
3300031890|Ga0306925_10546947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1228Open in IMG/M
3300031890|Ga0306925_10760188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1009Open in IMG/M
3300031893|Ga0318536_10601553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola550Open in IMG/M
3300031910|Ga0306923_10796334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1044Open in IMG/M
3300031942|Ga0310916_10237845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1532Open in IMG/M
3300032043|Ga0318556_10447145All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300032054|Ga0318570_10072187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1470Open in IMG/M
3300032059|Ga0318533_11021982All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300032063|Ga0318504_10517472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola572Open in IMG/M
3300032063|Ga0318504_10576351All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300032066|Ga0318514_10055015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1934Open in IMG/M
3300032066|Ga0318514_10136993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1264Open in IMG/M
3300032068|Ga0318553_10037877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae2340Open in IMG/M
3300032180|Ga0307471_100250924All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300032180|Ga0307471_100418532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus1472Open in IMG/M
3300032205|Ga0307472_100495450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1052Open in IMG/M
3300032770|Ga0335085_10256415All Organisms → cellular organisms → Bacteria2098Open in IMG/M
3300032770|Ga0335085_11613409All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300032782|Ga0335082_10777199All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300032828|Ga0335080_10964513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium870Open in IMG/M
3300032893|Ga0335069_10983659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium937Open in IMG/M
3300032895|Ga0335074_10568852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola1145Open in IMG/M
3300032896|Ga0335075_10233308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium2146Open in IMG/M
3300032897|Ga0335071_10309851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium1532Open in IMG/M
3300032898|Ga0335072_10946261All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300032954|Ga0335083_10188906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1898Open in IMG/M
3300033134|Ga0335073_10489499All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300033158|Ga0335077_11882008Not Available559Open in IMG/M
3300033412|Ga0310810_11320826All Organisms → cellular organisms → Bacteria565Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.19%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.54%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.54%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.65%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.33%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.33%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.44%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.44%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.44%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.44%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.44%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.44%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2170459012Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grassEnvironmentalOpen in IMG/M
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012387Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012482Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510Host-AssociatedOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024275Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026911Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_002096402124908016YKTFTIMVWDHNLLEDLGSPPSTLPGEIPCYVKCV
cont_0713.000051602166559005SimulatedMIPGPAIAALHAGPPVHVYHYKTFTIMVWDHNLLEDLGSPPSTLPGEIPCYVKCV
FI_007505902166559006Grass SoilMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCIRLRV
F62_091289102170459010Grass SoilAFAGVPSIPRQAIAALHAGPPAHVYHYKRFTIMVWDHNLLDDLGSTPEILPGEIPCAHDC
N56_046171802170459012Grass SoilPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGDIPCTNDCV
FD1_032632502170459024Grass SoilNSADHLGMTGGANRLVSLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGDIPCTNDCV
FD1_030709302170459024Grass SoilMIPSAAIAALHAGPPAHVYHYKTFTIMVWDHNLLDNLGRPASTLPGEIPC
Ga0066823_1006119823300005163SoilMDGGPNRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCMHDCV*
Ga0066809_1023418323300005168SoilHVYHYKTFTIMVWDHNLLEDLGSPPSTLPGEIPCYVKCV*
Ga0066683_1063271923300005172SoilALHAGPPVHVYHYKRFTIMVWDHNLLDDLGSPPEILPGEIPCAHDCV*
Ga0070676_1057072923300005328Miscanthus RhizosphereHVYHYKTFTIMVWDHNLLDNLGSPASTLPGEIPCYVKCV*
Ga0070670_10071891513300005331Switchgrass RhizosphereLHAGPPVHVYRYKTFTIMVWNHNLLDNLGRPASTLPGEIPCYVKCV*
Ga0066388_10364103623300005332Tropical Forest SoilNRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGIQPGEIPCTHDCV
Ga0070682_10169730123300005337Corn RhizosphereTNSADHLGMTGGANRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTNDCALSSLS*
Ga0070687_10028117123300005343Switchgrass RhizosphereSSMIPSAAIAALHAGPPVHVYHYKTFTIMVWNHNLLDNLGSPASTLPGEIPCYVKCV*
Ga0008090_1012595723300005363Tropical Rainforest SoilAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCTHDCV*
Ga0070709_1127794013300005434Corn, Switchgrass And Miscanthus RhizosphereLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSTPSVLPGDVPCPRDCA*
Ga0070709_1156985713300005434Corn, Switchgrass And Miscanthus RhizosphereAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEIPCTDDCA*
Ga0070714_10030700223300005435Agricultural SoilGPPAHVYHYKTFTIMVWNHNLLDDLGSSPWTSLPGKIPCHVQCV*
Ga0070714_10079001113300005435Agricultural SoilAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSTPSILPGDVPCPRDCV*
Ga0070711_10088731013300005439Corn, Switchgrass And Miscanthus RhizospherePRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEIPCTDDCA*
Ga0066681_1092535813300005451SoilPPAHVYHYKTFTIMVWDHNLLDDLGRPPTTLPGEIPCYVKCV*
Ga0070679_10030100613300005530Corn RhizosphereIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS*
Ga0066695_1021201713300005553SoilAIAALHAGPPAHVYHYKTFTIMVWNHNLLDDLGSTPGILPGEIPCTHDCV*
Ga0066707_1012916613300005556SoilIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTNDCA*
Ga0070664_10013386813300005564Corn RhizosphereAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTHDCV*
Ga0066693_1039693713300005566SoilPPAHVYHYKTFTIMVWDHNLLDDLGRPPSVLPGEIPCYVKCV*
Ga0066706_1132151413300005598SoilALHAGPPVHVYHYKRFTIMVWDHNLLDDLGSPPEILPGEIPCTHDCV*
Ga0068852_10009259333300005616Corn RhizosphereVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTNDCVLSSLS*
Ga0066903_10424314513300005764Tropical Forest SoilLHAGPPAHVYHYKTFTIMVWNHNLLDNLDKHPPIQASTKPCKRDCV*
Ga0070766_1121073123300005921SoilVYHYKTFTIMVWNHNLLDDLGRTPSTLPGKIPCHVKCT*
Ga0070717_1208401123300006028Corn, Switchgrass And Miscanthus RhizosphereYKTFTIMVWNHNLLENLGKTPSVQPGQVPCTRDCV*
Ga0066656_1032228213300006034SoilYHYKRFTIMVWDHNLLDDLGSPPEILPGEIPCAHDCV*
Ga0070715_1005239113300006163Corn, Switchgrass And Miscanthus RhizosphereAIAALHAGPPVHVYHYKRFTIMVWDHNLLDDLGSPPEILPGEIPCAHDCV*
Ga0070716_10090985123300006173Corn, Switchgrass And Miscanthus RhizosphereSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTNDCA*
Ga0070765_10088184213300006176SoilALHAGPPAHVYHYKTFTIMVWNHNLLENLGKTPSVQPGQVPCTDNCA*
Ga0074051_1177992913300006572SoilMDGGPNRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSTPKTLPGEIPCTSDCV*
Ga0074056_1150706823300006574SoilIPRLAIAALHAGPPVHVYHYKTFTIMVWDHNLLEDLGSPPSTLPGEIPCYVKCV*
Ga0074060_1193028523300006604SoilIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCMHDCV*
Ga0066659_1157246013300006797SoilHYKTFTIMVWNHNLLDHLGSTPGILPGEIPCTHDCV*
Ga0079221_1023567913300006804Agricultural SoilNFILTNSADHLGMTGGANRLVSLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCTHDCV*
Ga0079220_1004614833300006806Agricultural SoilMIPSPAIAALHAGPPARVYHYKTFTIMVWDHNLLDNLGGPASTLPGEIPCYVKCV*
Ga0079220_1005388633300006806Agricultural SoilGPPAHVYHYKTFTIMVWNHNLLDNLGSTPGILPGEIPCTHDCV*
Ga0079220_1062066023300006806Agricultural SoilGPNRLVSMIPRSAIAAVHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCMHDCV*
Ga0075434_10031407723300006871Populus RhizosphereNRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCMHDCV
Ga0075434_10062842613300006871Populus RhizosphereRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS*
Ga0075424_10287628513300006904Populus RhizosphereLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCMHDCV*
Ga0074063_1353536813300006953SoilQAIAALHAGPPAHVYHYKRFTIMVWDHNLLDDLGSTPEILPGEIPCAHDCV*
Ga0079219_1043139723300006954Agricultural SoilRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS*
Ga0066710_10237398623300009012Grasslands SoilLHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTNDCV
Ga0105247_1097123123300009101Switchgrass RhizosphereGPPVHVYHYKRFTIMVWDHNLLDDLGSPPEILPGEIPCAHDCV*
Ga0105241_1003869853300009174Corn RhizosphereMIPSAAIAALHAGPPVHVYHYKTFTIMVWNHNLLDNLGSPASTLPGEIPCYVKCV*
Ga0105241_1011292733300009174Corn RhizosphereNRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS*
Ga0105237_1033885623300009545Corn RhizosphereSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTHDCV*
Ga0105237_1221136013300009545Corn RhizosphereAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEIPCTHDCV*
Ga0126380_1004396243300010043Tropical Forest SoilLDAGPPAHVYHYKTFTIMVWDHNLLDNLGSPASMLPGEIPCYVKCV*
Ga0126384_1002526613300010046Tropical Forest SoilAGPPAHVYHYKTFTIMVWNHNLLDDLGSPASILPGEIPCYVKCV*
Ga0126319_157723813300010147SoilMDGGPNRLVSMIPRDAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCMHDCV*
Ga0126318_1111890123300010152SoilVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEVPCTQDCS*
Ga0127503_1007513813300010154SoilTAIAALHAGPPAHVYHYKTFTIMVWNHNLLDDLGSTQETLPGEIPCTSDCV*
Ga0134109_1048257023300010320Grasslands SoilYKTFTIMVWDQPLLGNLGSPPTTLPGEIPCYVKCV*
Ga0134062_1048496823300010337Grasslands SoilVYRYKTFTIMVWNHNLLENLGSTPEILPGEVPCTHDCV*
Ga0126372_1045597613300010360Tropical Forest SoilPAHVYHYKTFTIMVWNHNLLDNLDSPPSVQPGEVPCTHDCV*
Ga0134125_1071947313300010371Terrestrial SoilIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEVPCTHDCVLSSLS*
Ga0105239_1161696123300010375Corn RhizosphereMTGGANRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS*
Ga0126381_10118963813300010376Tropical Forest SoilHVYHYKTFTIMVWNHNLLDNLGKNPSIKPDKRPCTPESDCV*
Ga0134126_1126394213300010396Terrestrial SoilRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLANLGKTPSVQPGQVPCTRDCA*
Ga0126383_1056449013300010398Tropical Forest SoilIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGKTPSVQPGQVPCTRDCA*
Ga0126383_1229455713300010398Tropical Forest SoilVYHYKTFTIMVWNHNLLDDLGSPASMLPGEIPCYVKCV*
Ga0134121_1193928013300010401Terrestrial SoilTIMVWNHNLLDNLGSAPGIEPGEVPCTHDCVLSSLS*
Ga0105246_1007508933300011119Miscanthus RhizosphereHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTNDCA*
Ga0150983_1473117113300011120Forest SoilMIPRAAIAALHAGPPAHVYHYKKFTIMVWDHNLLDDLGSTPEILPGEIPCTHDCV*
Ga0150983_1540660023300011120Forest SoilQIGQIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGKTPSVQPGQVPCTDNCA*
Ga0137364_1019012813300012198Vadose Zone SoilIAALHAGPPAHVYHYKTFTIMVWNHNLLDHLGSTPGILPGEIPCTHDCV*
Ga0137383_1085318113300012199Vadose Zone SoilLASMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDDLGSAPGILPGEIPCTNDCV*
Ga0137382_1043270113300012200Vadose Zone SoilTNGADHLVMTGVANRLVSMIPRIAIAALHAGPPAHVYHYKTFTIMVWNHNLLDDLGSAPGIQPGEIPCTHDCV*
Ga0137363_1022987123300012202Vadose Zone SoilFILTNSADHWGMDGGPNRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEIPCMHDCV*
Ga0137377_1012769313300012211Vadose Zone SoilSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDHLGSTPGILPGEIPCTHDCV*
Ga0137377_1027192523300012211Vadose Zone SoilRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDDLGSAPGILPGDIPCTHDCV*
Ga0137370_1070169513300012285Vadose Zone SoilPRIAIAALHAGPPAHVYHYKTFTIMVWNHNLLDHLGSTPGILPGEIPCTNDCV*
Ga0137385_1165370513300012359Vadose Zone SoilMIPRPAIAALHAGPPAHVYHYKRFTIMVWDHNLLNDLGSTPDILPGEIPCTHDCV*
Ga0134030_118476213300012387Grasslands SoilHYKTFTIMVWNHNLLENLGSAPGILPGEIPCMHDCV*
Ga0157318_100068833300012482Arabidopsis RhizosphereLHAGPPVRVYHYKTFTILVWDHNLLEDLGSPPTTLPGEIPCYVKCV*
Ga0157338_102423813300012515Arabidopsis RhizosphereKTFTIMVWDHNLLDNLGRPASTLPGEIPCYVKCV*
Ga0137398_1007289333300012683Vadose Zone SoilALHAGPPVHVYHYKRFTIMVWNHNLLDDLGSTPEILPGEIPCAHDCV*
Ga0137397_1026138723300012685Vadose Zone SoilVYHYKTFTIMVWNHNLLDNLGSTPGILPGEIPCTHDCV*
Ga0137397_1069207923300012685Vadose Zone SoilGADHLGMTGGANRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSTPGILPGEIPCTHDCV*
Ga0137394_1066068223300012922Vadose Zone SoilLGMTGGANRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDDLGSAPGIQPGEIPCTHNCV*
Ga0137404_1032461423300012929Vadose Zone SoilAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGTAPGILPGEIPCMHDCV*
Ga0164301_1154434313300012960SoilAIAALHAGPPAHVYHYTTFTIMVWNHNLLDNLGSAQGITPGEIPCTNDCA*
Ga0164309_1186689623300012984SoilHAGPPAHVYHYKTFTIMVWDHNLLDDLGSTPEILPGEIPCAHDCV*
Ga0157370_1047222413300013104Corn RhizosphereMIPSAAIAALHAGPPVHVYRYKTFTIMVWNHNLLDNLGRPASTLPGEIPCYVKCV*
Ga0163163_1011415613300014325Switchgrass RhizosphereYKTFTIMVWNHNLLDNLGSPASTLPGEIPCYVKCV*
Ga0157379_1014565633300014968Switchgrass RhizosphereTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS*
Ga0132258_1068240133300015371Arabidopsis RhizospherePRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS*
Ga0132258_1112875313300015371Arabidopsis RhizospherePRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEIPCTQDCALSSLS*
Ga0132256_10072279823300015372Arabidopsis RhizosphereLHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS*
Ga0132256_10073159623300015372Arabidopsis RhizosphereAHVYHYKTFTIMVWNHNLLENLGRAPGILPGEIPCMHDCV*
Ga0132256_10201551913300015372Arabidopsis RhizosphereMIPGPAIAALHAGPPAHVYHYKTFTIMVWDHNLLDNLGGPPTTLPGEIPCYVKCV*
Ga0132257_10014283033300015373Arabidopsis RhizosphereAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS*
Ga0132257_10070891413300015373Arabidopsis RhizosphereGPPAHVYHYKTFTIMVWNHNLLDNLGSTPSVQPGEIPCTQDCV*
Ga0132257_10077079913300015373Arabidopsis RhizosphereIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEIPCTQDCALSSLS*
Ga0132257_10180011213300015373Arabidopsis RhizosphereHYKTFTIMVWNHNLLNNLGSPASTLPGEIPCYVKCV*
Ga0182041_1127456423300016294SoilAHVYHYKTFTIMVWDHNLLDDLGSGSSTLPGEIPCSVKCV
Ga0182034_1036501313300016371SoilGPGVPASMIPLPAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLDSPPSVQPGEIPCTHDCV
Ga0193728_119992913300019890SoilPVHVYHYKTFTIMVWDHNLLEDLGSPPSTLPGEIPCYVKCV
Ga0193732_107636623300020012SoilWGMDGGPNRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCMHDCV
Ga0179590_114810123300020140Vadose Zone SoilGGPHRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSTPGILPGEIPCTHDCV
Ga0210403_1075921723300020580SoilLHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGDIPCIDDCV
Ga0210395_1053473323300020582SoilSASAIAALHAGPPAHVYHYKTFTIMVWNHNLFDNLEKQPSVTSQRPCTHDCV
Ga0210408_1046820613300021178SoilSMIPRPAIAALHAGPPAHVYHYKAFTIMVWDHNLLDDLGSHSSTSPGEVPCYVKCV
Ga0210389_1110837723300021404SoilHLGMTGGANRLVSLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCIDDCA
Ga0210387_1060594323300021405SoilAALHAGPPVHVYHYKTFTIMVWNHNLLDNLGRPASTLPGEIPCYVKCV
Ga0210387_1061161723300021405SoilAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGDIPCINDCV
Ga0210394_1118428423300021420SoilVYHYKTFTIMVWNHNLLDDLGRTPSTLPGRIPCYVKCT
Ga0210390_1025107423300021474SoilRLIGLISGSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLDKPPSVTSQRPCTHDCL
Ga0210392_1090337513300021475SoilADHLGMTGGANRLVSLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGDIPCIDDCV
Ga0210392_1104804423300021475SoilRPAIAALHAGPPAHVYHYQRFTIMVWDHNLLDDLGSTPDILPGEIPCAHDCV
Ga0210398_1028754323300021477SoilYHYKTFTIMVWNHNLLENLGKTPSVQPGQVPCTRDCA
Ga0210410_1005134153300021479SoilPPAHVYHYKKFTIMVWDHNLLDDLGSTPDILPGEIPCAHDCV
Ga0210410_1061120123300021479SoilGTPRRNSQIPLPAIAALHAGPPAHVYHYKTFTIMVWNHNLLDDLGKTPSSLPGRIPCYVQCT
Ga0126371_1335371023300021560Tropical Forest SoilALHAGPPAHVYHYKTFTIMVWNHNLLDDLGSPPEILPGEIPCTQECV
Ga0213851_137765213300021860WatershedsLIPLPAIAALHAGPPAHVYHYKTFTIMVWNHNLLDDLGRTPSTLPGKIPCHVKCT
Ga0242668_103385213300022529SoilADQWSMDGGGPDRPASLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDDLGRTPSTLPGRIPCYVQCT
Ga0247691_101576113300024222SoilIAALHAGPPVHVYHYKTFTIMVWNHNLLDNLGSPASTLPGEIPCYVKCV
Ga0247664_101426813300024232SoilVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS
Ga0247674_101793323300024275SoilLGMTGGANRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS
Ga0179589_1017749113300024288Vadose Zone SoilAHGDMDGGPHRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSTPGILPGEIPCTHDCV
Ga0179591_109575413300024347Vadose Zone SoilMIPSAAIAALHAGPPVHVYHYEKFTIMVWDHNLLDNLGGPASTLPGEIPCYVKCV
Ga0207692_1032510713300025898Corn, Switchgrass And Miscanthus RhizosphereAIAALHAGPPVHVYHYKRFTIMVWDHNLLDDLGSPPEILPGEIPCAHDCV
Ga0207692_1110883813300025898Corn, Switchgrass And Miscanthus RhizosphereAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEIPCTDDCA
Ga0207710_1003200433300025900Switchgrass RhizosphereLHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTHDCV
Ga0207685_1014760123300025905Corn, Switchgrass And Miscanthus RhizosphereALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCAHDCV
Ga0207685_1018138623300025905Corn, Switchgrass And Miscanthus RhizosphereAEHWGMDGGFGRQIGQIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGKTPSVQPGQVPCTRDCA
Ga0207699_1031240513300025906Corn, Switchgrass And Miscanthus RhizosphereIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS
Ga0207699_1086999023300025906Corn, Switchgrass And Miscanthus RhizosphereAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEIPCTDDCA
Ga0207645_1043579713300025907Miscanthus RhizosphereALHAGPPVHVYHYKTFTIMVWDHNLLDNLGSPASTLPGEIPCYVKCV
Ga0207654_1013375223300025911Corn RhizosphereTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS
Ga0207693_1080170813300025915Corn, Switchgrass And Miscanthus RhizosphereYHYKTFTIMVWNHNLLDNLGSAPGIQPGDIPCTDDCA
Ga0207663_1051586323300025916Corn, Switchgrass And Miscanthus RhizosphereGMTGGANRLVSLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEIPCTDDCA
Ga0207700_1078582013300025928Corn, Switchgrass And Miscanthus RhizosphereRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEIPCTDDCA
Ga0207664_1094296213300025929Agricultural SoilIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTNDCA
Ga0207665_1000467813300025939Corn, Switchgrass And Miscanthus RhizosphereSAEHWGMDGGFGRQIGQIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGKTPSVQPGQVPCTRDCA
Ga0207665_1086144713300025939Corn, Switchgrass And Miscanthus RhizosphereAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTNDCA
Ga0207689_1078320923300025942Miscanthus RhizosphereGGPNRLVSMIPRDAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEIPCTHDCV
Ga0207651_1024566123300025960Switchgrass RhizosphereAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS
Ga0209620_100024813300026911Forest SoilANRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEVPCTHDCVLSSLS
Ga0209325_100076313300027050Forest SoilAGPPVHVYHYKTFTIMVWNHNLLDNLGRPASTLPGEIPCYVKCV
Ga0209418_103166023300027371Forest SoilYHYKTFTIMVWNHNLLDNLGRPASTLPGEIPCYVKCV
Ga0209329_111602913300027605Forest SoilHVYHYKTFTIMVWNHNLLDDLGSAPGIQPGDIPCTNDCV
Ga0209178_127356723300027725Agricultural SoilMTGGANRLVSLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSTPSVQPGEIPCTQDCV
Ga0209112_1003695833300027817Forest SoilVHVYHYKTFTIMVWNHNLLDNLGRPASTLPGEIPCYVKCV
Ga0209693_1006912713300027855SoilNENGTIRRNSMIPLPAIEALHAGPPAHVYHYKTFTIMVWNHNLLDDLGRHPSTTPGQIPCSDECV
Ga0209693_1020394613300027855SoilGGGPGRLSSMIPRSAIAALHAGPLAHVYHYKTFTIMVWNHNLLDNLDSKPSVQPGEVPCPRDCA
Ga0209006_1016974123300027908Forest SoilGMDGGPNRLIGLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLNDLGKNPSIDPGEVPCTHACA
Ga0209069_1102262923300027915WatershedsYKTFTIMVWNHNLLDNLGSAPGIQPGDIPCTNDCV
Ga0247684_102373913300028138SoilALHAGPPVHVYHYKTFTIMVWNHNLLDNLGSPASTLPGEIPCYVKCV
Ga0307311_1008552813300028716SoilRSSIIPAAAIAALHAGPPAHVYHYKTFTVMVWDHNLLDNLGGPASTLPGEIPCYVKCV
Ga0307307_1014434913300028718SoilLHAGPPVHVYHYKTFTIMVWDHNLLDNLGSPPSTLPGEIPCYVKCV
Ga0307504_1011865613300028792SoilPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEIPCTHDCV
Ga0307284_1032302013300028799SoilPAHVYHYKTFTVMVWDHNLLDNLGGPASTLPGEIPCYVKCV
Ga0307312_1014881613300028828SoilHWGMDGGPNRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCMHDCV
Ga0307286_1021527613300028876SoilSADHWGMDGGPNRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEIPCTHDCV
Ga0307308_1005914513300028884SoilYHYKTFTIMVWNHNLLDNLGSAPGILPGEIPCTHDCV
Ga0307304_1059918013300028885SoilAALHAGPPAHVYHYKTFTIMVWNHNLLENLGSAPGILPGEIPCMHDCV
Ga0307304_1060655913300028885SoilALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGILPGEIPCSHDCV
Ga0308309_1034855313300028906SoilSMIPVSAIAALHAGPPAHVYHYKTFTILVWNHNLLNDLTGTPTSQSGKICASDCV
Ga0308309_1189051913300028906SoilSSMIPRPAIAALHAGPPAHVYHYKAFTIMVWDHNLLDDLGSPPEILPGEIPCTHDCV
Ga0318516_1004915923300031543SoilVRSSPGSAIATLRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPCTHDRV
Ga0318516_1085606113300031543SoilYHYKTFTIMVWDHNLLDDLGSGSSTLPGEIPCSVKCV
Ga0318538_1001542923300031546SoilVRSSPGSAIAALRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPCTHDRV
Ga0318515_1026261723300031572SoilAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSNPAIEPGEIPCIQDCL
Ga0318555_1039693923300031640SoilLIGLIPGSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSNPAIEPGEIPCIQDCL
Ga0318555_1061303623300031640SoilYHYQAFTIMVWNHNLLDDLGSPPSTSPGEIPCSVQCV
Ga0307476_1005218043300031715Hardwood Forest SoilAHVYRYKTFTIMVWNHNLLDNLGKTPSVLPGDVPCPRDCV
Ga0307476_1024889713300031715Hardwood Forest SoilLPAIAALHAGPPAHVYHYKTFTIMVWNHNLLDDLGRTPSTLPGRIPCYVQCT
Ga0307474_1092261013300031718Hardwood Forest SoilAIAALHAGPPAHVYHYKTFTIMVWNHNLLENLGTTPSVQPGQVPCTRDCA
Ga0306917_1143121923300031719SoilGGFHRLIGLIPGSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSNPAIEPGEIPCIQDCL
Ga0307469_1159325123300031720Hardwood Forest SoilPPVHVYHYKTFTIMVWDHNLLDNLGSPASTLPGEIPCYVKCV
Ga0318493_1001515513300031723SoilVRSSPGSAIATLRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPG
Ga0318501_1007436323300031736SoilATLRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPCTHDRV
Ga0307468_10035642813300031740Hardwood Forest SoilLHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEVPCTHDCVLSHLS
Ga0318502_1004295033300031747SoilPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPCTHDRV
Ga0318554_1071596223300031765SoilPASMIPLPANAALHAGPPAHVYHYKTFTIMVWNHNLLDNLDSPPSVQPGEVPCTHDCV
Ga0318521_1009710923300031770SoilAALRAGAPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPCTHDRV
Ga0318521_1094286323300031770SoilVYHYKTFTIMVWNHNLLDNLGSNPAIEPGEIPCTQDCL
Ga0318546_1014646323300031771SoilVRSSPGSAIATLRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTLSVLPGDVPCTHDRV
Ga0318547_1028895713300031781SoilGLIPGSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSNPAIEPGEIPCIQDCL
Ga0318552_1039757023300031782SoilLRNCVRSSPGSAIATLRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPCTHDR
Ga0318568_1012317223300031819SoilYKTFTIMVWNHNLLDNLDSPPSVQPGEVPCTHDCV
Ga0318564_1018436723300031831SoilGPPAHVYHYKTFTIMVWNHNLLDNLDSTPSVQPGEVPCTHDCV
Ga0310917_1090985513300031833SoilSLIPVRAIEALHAGPPVHVYYYKTFTIMVYDHNLLINLGVHPTVQAGQVPCKGACE
Ga0318511_1001642313300031845SoilTTLLRNCVRSSPGSAIAALRAGAPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPCTHDRV
Ga0310892_1108639113300031858SoilIAALHAGPPARVYHYKTFTIMVWDHNLLDNLGGPASTLPGEIPCYVKCV
Ga0318527_1025950723300031859SoilPSSALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSNPAIEPGEIPCIQDCL
Ga0318495_1010045023300031860SoilHYKTFTIMVWNHNLLDNLDSPPSVQPGEVPCTHDCV
Ga0306919_1101700613300031879SoilSAIAALRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTLSVLPGDVPCTHDRV
Ga0306925_1054694723300031890SoilPASMIPLPAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLDSPPSVQPGEVPCTHDCV
Ga0306925_1076018823300031890SoilGGGPNTLASLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLDSHPSIPPGMTCLRPRDCV
Ga0318536_1060155323300031893SoilRGAIAALHAGPPAHVYYYKSFTIMVWDHNLLGNLNKTPSVEPGQVPCTHDCV
Ga0306923_1079633413300031910SoilVRSSPGSAIAALRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPC
Ga0310916_1023784513300031942SoilSSPGSAIATLRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPCTHDRV
Ga0318556_1044714513300032043SoilLIGLIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSSPGIEPGEIPCTHDCL
Ga0318570_1007218723300032054SoilVRSSPGSAIAALRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTLS
Ga0318533_1102198213300032059SoilYKTFTIMVWDHNLLDDLGSRPSTLPGKIPCYVQCV
Ga0318504_1051747213300032063SoilGSAIATLRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPCTHDRV
Ga0318504_1057635123300032063SoilAALHAGPPAHVYHYKTFTIMVWDHNLLDDLGSRPSTLPGKIPCYVQCV
Ga0318514_1005501513300032066SoilVRSSPGSAIAALRAGAPAHVCHYEAFTIMVWNHNLLDNLDSTPSVLPGDVPCTHDRV
Ga0318514_1013699313300032066SoilPGSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLDSPPSVQPGEVPCTHDCV
Ga0318553_1003787723300032068SoilVRSSPGSAIAALRAGPPAHVCHYEAFTIMVWNHNLLDNLDSTLSVLPGDVPCTHDRV
Ga0307471_10025092413300032180Hardwood Forest SoilYHYKTFTIMVWDHNLLDNLGSPASTLPGEIPCYVKCV
Ga0307471_10041853213300032180Hardwood Forest SoilSADHLGMTGGANRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIQPGEIPCTNDCALSSLS
Ga0307472_10049545013300032205Hardwood Forest SoilALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSTPSVLPGDVPCPRDCA
Ga0335085_1025641513300032770SoilPAHVYHYKTFTIMVWNHNLLDDLGGPPTTLPGEIPCYVKCV
Ga0335085_1161340913300032770SoilAHVYHYKTFTIMVWNHNLLDNLGGPPSVQPGEVPCTHDCV
Ga0335082_1077719913300032782SoilRSAIAALHAGPPVHVYHYKTFTIMVWNHNLLDDLDGNPSIQPGEVPCTEDCV
Ga0335080_1096451313300032828SoilAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLDGPPSVQPGEVPCTHDCV
Ga0335069_1098365923300032893SoilAGPPAHVYHYQTFTIMVWNHNLLDNLDRSPAIDPGEIPCTQDCL
Ga0335074_1056885213300032895SoilPPAHVYHYKTFTIMVWNHNLLDNLGKNPSTDPGDVPCTHACA
Ga0335075_1023330833300032896SoilIAALHAGPPAHVYHYKTFTIMVWDHNLLDDLGSHSSTLPGDIPCSVKCV
Ga0335071_1030985113300032897SoilASAIAALHAGPPAHVYHYQTFTIMVWNHNLLDNLDRSPAIDPGEIPCTQDCL
Ga0335072_1094626113300032898SoilGMTGGANRLVSMIPRSAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGSAPGIEPGEIPCTQGCA
Ga0335083_1018890623300032954SoilAIAALHAGPPAHVYHYKTFTIMVWNHNLLDNLGKNPSIEPGEIPCKHDCV
Ga0335073_1048949913300033134SoilIPRSAIEALHAGPPAHVYHYKTFTIMVWNHNLLDNLDGNPSIQPGEVPCTEDCV
Ga0335077_1188200823300033158SoilVYHYKTFTIMVWNHNLLDNLGKNPSIEPGEIPCKHDCV
Ga0310810_1132082623300033412SoilAGPPAHVYHYKTFTIMVWNHNLLENLGTAPGILPGEIPCMHDCV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.