NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020594

Metagenome / Metatranscriptome Family F020594

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020594
Family Type Metagenome / Metatranscriptome
Number of Sequences 223
Average Sequence Length 43 residues
Representative Sequence RQHINMAEILNEKNEVLARSRGIFIAIDPEKMFGKFVER
Number of Associated Samples 186
Number of Associated Scaffolds 223

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.45 %
% of genes near scaffold ends (potentially truncated) 97.76 %
% of genes from short scaffolds (< 2000 bps) 90.13 %
Associated GOLD sequencing projects 175
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.919 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.659 % of family members)
Environment Ontology (ENVO) Unclassified
(25.112 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.915 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 7.46%    β-sheet: 25.37%    Coil/Unstructured: 67.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 223 Family Scaffolds
PF01680SOR_SNZ 47.53
PF00155Aminotran_1_2 2.69
PF04237YjbR 2.24
PF00392GntR 1.35
PF14235DUF4337 1.35
PF00144Beta-lactamase 1.35
PF04366Ysc84 1.35
PF01797Y1_Tnp 1.35
PF030614HBT 1.35
PF03551PadR 0.90
PF00117GATase 0.90
PF01174SNO 0.90
PF12681Glyoxalase_2 0.90
PF08543Phos_pyr_kin 0.90
PF01381HTH_3 0.45
PF01885PTS_2-RNA 0.45
PF00691OmpA 0.45
PF14329DUF4386 0.45
PF13683rve_3 0.45
PF00069Pkinase 0.45
PF07883Cupin_2 0.45
PF07690MFS_1 0.45
PF04073tRNA_edit 0.45
PF02577BFN_dom 0.45
PF01541GIY-YIG 0.45
PF00912Transgly 0.45
PF06764DUF1223 0.45
PF03099BPL_LplA_LipB 0.45
PF00903Glyoxalase 0.45
PF069833-dmu-9_3-mt 0.45
PF14659Phage_int_SAM_3 0.45
PF06445GyrI-like 0.45
PF03544TonB_C 0.45
PF08308PEGA 0.45
PF00378ECH_1 0.45
PF02129Peptidase_S15 0.45
PF07110EthD 0.45

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 223 Family Scaffolds
COG0214Pyridoxal 5'-phosphate synthase subunit PdxSCoenzyme transport and metabolism [H] 47.53
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 2.24
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.79
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.35
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.35
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 1.35
COG2367Beta-lactamase class ADefense mechanisms [V] 1.35
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 1.35
COG0118Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisHAmino acid transport and metabolism [E] 0.90
COG0311Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase)Coenzyme transport and metabolism [H] 0.90
COG0351Hydroxymethylpyrimidine/phosphomethylpyrimidine kinaseCoenzyme transport and metabolism [H] 0.90
COG0524Sugar or nucleoside kinase, ribokinase familyCarbohydrate transport and metabolism [G] 0.90
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.90
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.90
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.90
COG2240Pyridoxal/pyridoxine/pyridoxamine kinaseCoenzyme transport and metabolism [H] 0.90
COG2870ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferaseCell wall/membrane/envelope biogenesis [M] 0.90
COG0095Lipoate-protein ligase ACoenzyme transport and metabolism [H] 0.45
COG0321Lipoate-protein ligase BCoenzyme transport and metabolism [H] 0.45
COG0340Biotin-protein ligaseCoenzyme transport and metabolism [H] 0.45
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.45
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.45
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 0.45
COG1859RNA:NAD 2'-phosphotransferase, TPT1/KptA familyTranslation, ribosomal structure and biogenesis [J] 0.45
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.45
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.45
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.45
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.45
COG5429Uncharacterized conserved protein, DUF1223 domainFunction unknown [S] 0.45


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.37 %
UnclassifiedrootN/A33.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573002|GZIGXIF02HV8OFAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300000955|JGI1027J12803_107883711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1227Open in IMG/M
3300000955|JGI1027J12803_108320380All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300001166|JGI12694J13545_1027913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae509Open in IMG/M
3300001174|JGI12679J13547_1009615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae594Open in IMG/M
3300001431|F14TB_100042728All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia911Open in IMG/M
3300001471|JGI12712J15308_10009142Not Available2698Open in IMG/M
3300001867|JGI12627J18819_10442530All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300003219|JGI26341J46601_10171587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae598Open in IMG/M
3300003505|JGIcombinedJ51221_10355600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae595Open in IMG/M
3300004092|Ga0062389_100870065All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300004152|Ga0062386_101001937All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300005330|Ga0070690_101679663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300005434|Ga0070709_10518063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae908Open in IMG/M
3300005437|Ga0070710_11031140All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae601Open in IMG/M
3300005468|Ga0070707_100743953All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae944Open in IMG/M
3300005471|Ga0070698_101078443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica751Open in IMG/M
3300005526|Ga0073909_10222581All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae826Open in IMG/M
3300005534|Ga0070735_10446813All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae772Open in IMG/M
3300005534|Ga0070735_10820348Not Available547Open in IMG/M
3300005542|Ga0070732_10575609All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300005576|Ga0066708_10180379All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300005602|Ga0070762_10452343All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300005610|Ga0070763_10163414All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1170Open in IMG/M
3300005617|Ga0068859_101407766All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300005764|Ga0066903_107481002All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005921|Ga0070766_10510624All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300006028|Ga0070717_10116798All Organisms → cellular organisms → Bacteria2282Open in IMG/M
3300006028|Ga0070717_11290294All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300006028|Ga0070717_11297642All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300006059|Ga0075017_101441890All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300006086|Ga0075019_10440795All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300006086|Ga0075019_10893430Not Available570Open in IMG/M
3300006162|Ga0075030_100394646All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300006172|Ga0075018_10456127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300006172|Ga0075018_10476450Not Available647Open in IMG/M
3300006173|Ga0070716_100912968All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300006176|Ga0070765_101571689Not Available619Open in IMG/M
3300006796|Ga0066665_10772146All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300006797|Ga0066659_10819998All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300006871|Ga0075434_101266381All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300009038|Ga0099829_11806825All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300009090|Ga0099827_10186092All Organisms → cellular organisms → Bacteria1720Open in IMG/M
3300009093|Ga0105240_11277035All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300009101|Ga0105247_11748051All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300009520|Ga0116214_1018643All Organisms → cellular organisms → Bacteria2470Open in IMG/M
3300009523|Ga0116221_1088597All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300009638|Ga0116113_1175378All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300009643|Ga0116110_1053511Not Available1444Open in IMG/M
3300009698|Ga0116216_10023042All Organisms → cellular organisms → Bacteria3898Open in IMG/M
3300009824|Ga0116219_10629587All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300010046|Ga0126384_11382657All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300010336|Ga0134071_10294269All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300010343|Ga0074044_10332864Not Available997Open in IMG/M
3300010359|Ga0126376_11723416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300010366|Ga0126379_10298334All Organisms → cellular organisms → Bacteria → Proteobacteria1616Open in IMG/M
3300010376|Ga0126381_101048676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1177Open in IMG/M
3300010376|Ga0126381_102254411All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300010376|Ga0126381_103509413All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300010379|Ga0136449_101049646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hypericibacter1304Open in IMG/M
3300010398|Ga0126383_10787947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1033Open in IMG/M
3300010866|Ga0126344_1002566Not Available1761Open in IMG/M
3300010877|Ga0126356_10756902Not Available599Open in IMG/M
3300011120|Ga0150983_12318529All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300011120|Ga0150983_15164127Not Available611Open in IMG/M
3300011269|Ga0137392_10234356All Organisms → cellular organisms → Bacteria → Acidobacteria1508Open in IMG/M
3300012096|Ga0137389_10060020All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2906Open in IMG/M
3300012096|Ga0137389_10104283All Organisms → cellular organisms → Eukaryota2259Open in IMG/M
3300012189|Ga0137388_11715801Not Available562Open in IMG/M
3300012203|Ga0137399_10094919Not Available2294Open in IMG/M
3300012356|Ga0137371_10849010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300012363|Ga0137390_10885400Not Available848Open in IMG/M
3300012363|Ga0137390_11453456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300012927|Ga0137416_12155223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300012929|Ga0137404_10548139All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1036Open in IMG/M
3300014162|Ga0181538_10135561Not Available1422Open in IMG/M
3300014167|Ga0181528_10854450Not Available513Open in IMG/M
3300014325|Ga0163163_10040586All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4545Open in IMG/M
3300014501|Ga0182024_10303632All Organisms → cellular organisms → Bacteria → Acidobacteria2108Open in IMG/M
3300014501|Ga0182024_10335348All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300014501|Ga0182024_12179393All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300014654|Ga0181525_10152921Not Available1265Open in IMG/M
3300014654|Ga0181525_10889868Not Available505Open in IMG/M
3300014657|Ga0181522_10669429All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300014658|Ga0181519_10001579All Organisms → cellular organisms → Bacteria20035Open in IMG/M
3300015357|Ga0134072_10146015All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300015374|Ga0132255_103744985All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300017930|Ga0187825_10346059Not Available562Open in IMG/M
3300017933|Ga0187801_10177197All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300017936|Ga0187821_10207283All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300017943|Ga0187819_10261908All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300017943|Ga0187819_10339815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300017946|Ga0187879_10002720All Organisms → cellular organisms → Bacteria11923Open in IMG/M
3300017948|Ga0187847_10250627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium965Open in IMG/M
3300017948|Ga0187847_10768156Not Available544Open in IMG/M
3300017955|Ga0187817_10242338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1149Open in IMG/M
3300017961|Ga0187778_10001700All Organisms → cellular organisms → Bacteria → Acidobacteria15098Open in IMG/M
3300017974|Ga0187777_10753797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300017975|Ga0187782_10060375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2761Open in IMG/M
3300017995|Ga0187816_10155637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae989Open in IMG/M
3300018007|Ga0187805_10491388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300018017|Ga0187872_10156009Not Available1087Open in IMG/M
3300018022|Ga0187864_10208277Not Available922Open in IMG/M
3300018038|Ga0187855_10390482All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300018040|Ga0187862_10327533All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae959Open in IMG/M
3300018042|Ga0187871_10092409All Organisms → cellular organisms → Bacteria1752Open in IMG/M
3300018085|Ga0187772_11089274Not Available586Open in IMG/M
3300018088|Ga0187771_10291675Not Available1366Open in IMG/M
3300018088|Ga0187771_11140066Not Available661Open in IMG/M
3300018088|Ga0187771_11344738All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300018433|Ga0066667_12052238All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300020579|Ga0210407_10462362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae992Open in IMG/M
3300020580|Ga0210403_11054774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300020581|Ga0210399_10644476All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300020581|Ga0210399_10997318All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300020582|Ga0210395_10150801Not Available1735Open in IMG/M
3300020582|Ga0210395_10647717Not Available792Open in IMG/M
3300020583|Ga0210401_11248649Not Available601Open in IMG/M
3300021170|Ga0210400_10049922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3257Open in IMG/M
3300021170|Ga0210400_10875930All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300021402|Ga0210385_10014892All Organisms → cellular organisms → Bacteria4818Open in IMG/M
3300021402|Ga0210385_10201870All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300021403|Ga0210397_11463498All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300021405|Ga0210387_11205369Not Available657Open in IMG/M
3300021407|Ga0210383_11153442All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300021420|Ga0210394_10502111Not Available1067Open in IMG/M
3300021420|Ga0210394_11743785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300021432|Ga0210384_10419164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1206Open in IMG/M
3300021433|Ga0210391_11538190All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300021475|Ga0210392_10881336Not Available669Open in IMG/M
3300021475|Ga0210392_10933935Not Available649Open in IMG/M
3300021477|Ga0210398_11111139Not Available627Open in IMG/M
3300021479|Ga0210410_10708894Not Available888Open in IMG/M
3300021479|Ga0210410_11261023Not Available631Open in IMG/M
3300021560|Ga0126371_12176098All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300022730|Ga0224570_105886Not Available748Open in IMG/M
3300022881|Ga0224545_1058807Not Available542Open in IMG/M
3300024271|Ga0224564_1110202Not Available561Open in IMG/M
3300025414|Ga0208935_1006172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1695Open in IMG/M
3300025459|Ga0208689_1006527Not Available4364Open in IMG/M
3300025500|Ga0208686_1116215Not Available558Open in IMG/M
3300025612|Ga0208691_1025863Not Available1372Open in IMG/M
3300025910|Ga0207684_10775131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium812Open in IMG/M
3300025929|Ga0207664_10915818All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300025931|Ga0207644_10784519All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300025939|Ga0207665_11027983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia656Open in IMG/M
3300025949|Ga0207667_11520622All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300026011|Ga0208532_1005974All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300026324|Ga0209470_1215036All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300026343|Ga0209159_1280792All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300026514|Ga0257168_1083834All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300026551|Ga0209648_10454850All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300027512|Ga0209179_1088340Not Available686Open in IMG/M
3300027559|Ga0209222_1012865All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300027570|Ga0208043_1131303Not Available662Open in IMG/M
3300027575|Ga0209525_1085421All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300027641|Ga0208827_1062938All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB601199Open in IMG/M
3300027643|Ga0209076_1133244All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium699Open in IMG/M
3300027748|Ga0209689_1167588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300027767|Ga0209655_10110748Not Available913Open in IMG/M
3300027821|Ga0209811_10165281All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300027842|Ga0209580_10326066Not Available765Open in IMG/M
3300027879|Ga0209169_10385766Not Available737Open in IMG/M
3300027882|Ga0209590_10748045All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300027884|Ga0209275_10347496All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae830Open in IMG/M
3300027884|Ga0209275_10461630All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300027889|Ga0209380_10044345All Organisms → cellular organisms → Bacteria → Acidobacteria2520Open in IMG/M
3300027889|Ga0209380_10158726All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300027905|Ga0209415_10789925Not Available663Open in IMG/M
3300028047|Ga0209526_10556516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300028574|Ga0302153_10269239Not Available583Open in IMG/M
3300028775|Ga0302231_10251889Not Available739Open in IMG/M
3300028828|Ga0307312_10104134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1762Open in IMG/M
3300028906|Ga0308309_10415344All Organisms → cellular organisms → Bacteria → Acidobacteria1155Open in IMG/M
3300028906|Ga0308309_10628854All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium932Open in IMG/M
3300028906|Ga0308309_10795807All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300028906|Ga0308309_11188374Not Available658Open in IMG/M
3300028906|Ga0308309_11847915All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300029636|Ga0222749_10519605Not Available646Open in IMG/M
3300029907|Ga0311329_10457227Not Available878Open in IMG/M
3300029913|Ga0311362_10197909All Organisms → cellular organisms → Bacteria2310Open in IMG/M
3300029915|Ga0311358_10219214All Organisms → cellular organisms → Bacteria1704Open in IMG/M
3300029951|Ga0311371_11156891Not Available899Open in IMG/M
3300029952|Ga0311346_10370484Not Available1412Open in IMG/M
3300029955|Ga0311342_10274319Not Available1554Open in IMG/M
3300029956|Ga0302150_10211125Not Available733Open in IMG/M
3300029999|Ga0311339_10644433All Organisms → cellular organisms → Bacteria → Acidobacteria1046Open in IMG/M
3300030007|Ga0311338_10429885Not Available1407Open in IMG/M
3300030057|Ga0302176_10265957Not Available687Open in IMG/M
3300030294|Ga0311349_11959839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300030503|Ga0311370_12131034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300030509|Ga0302183_10203977All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300030518|Ga0302275_10190526Not Available1229Open in IMG/M
3300030520|Ga0311372_10845813Not Available1241Open in IMG/M
3300030618|Ga0311354_11482087Not Available601Open in IMG/M
3300030659|Ga0316363_10061664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1750Open in IMG/M
3300030737|Ga0302310_10645750Not Available555Open in IMG/M
3300030813|Ga0265750_1067170All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300031232|Ga0302323_103309704Not Available513Open in IMG/M
3300031241|Ga0265325_10035204Not Available2661Open in IMG/M
3300031258|Ga0302318_10650874Not Available531Open in IMG/M
3300031524|Ga0302320_10943258Not Available926Open in IMG/M
3300031715|Ga0307476_10156448Not Available1640Open in IMG/M
3300031715|Ga0307476_10186236Not Available1503Open in IMG/M
3300031715|Ga0307476_11163207Not Available565Open in IMG/M
3300031718|Ga0307474_11310232Not Available572Open in IMG/M
3300031753|Ga0307477_10256587Not Available1211Open in IMG/M
3300031754|Ga0307475_11578268Not Available502Open in IMG/M
3300031821|Ga0318567_10587236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300031823|Ga0307478_10839067Not Available769Open in IMG/M
3300032160|Ga0311301_11908845All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300032205|Ga0307472_100288171Not Available1312Open in IMG/M
3300032782|Ga0335082_10092368All Organisms → cellular organisms → Bacteria3015Open in IMG/M
3300032782|Ga0335082_10681691All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300032782|Ga0335082_11679490All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300032783|Ga0335079_10144936All Organisms → cellular organisms → Bacteria2668Open in IMG/M
3300032783|Ga0335079_10692883Not Available1065Open in IMG/M
3300032805|Ga0335078_12025357All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300032892|Ga0335081_10373552All Organisms → cellular organisms → Bacteria → Acidobacteria1846Open in IMG/M
3300032892|Ga0335081_11124037All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300032955|Ga0335076_10076367All Organisms → cellular organisms → Bacteria3292Open in IMG/M
3300033004|Ga0335084_10292854All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300033402|Ga0326728_10359673Not Available1275Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.66%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.28%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.48%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.48%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.48%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.59%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.59%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.14%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.69%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.69%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.69%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.69%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.35%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.90%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.90%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.90%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.45%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.45%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.45%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.45%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.45%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.45%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.45%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.45%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.45%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.45%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.45%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001166Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2EnvironmentalOpen in IMG/M
3300001174Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022730Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2Host-AssociatedOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026011Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FE1_004721202189573002Grass SoilLRLEILNQKGEVLARSRGLFVAIDPHRMFAKFVDR
JGI1027J12803_10788371133300000955SoilHINAAEILNAEGEVLARGRGVFVAIDPEKMFGKFVER*
JGI1027J12803_10832038023300000955SoilVNMAEIVNERDEVLARSRGVFIAIDPEKMFRKFAER*
JGI12694J13545_102791313300001166Forest SoilEGREVEVRGRIHINTAQILNEKDEVLARSRGIFITIDPEKMFKKYVKR*
JGI12679J13547_100961513300001174Forest SoilAGRIHINAAEILNEKDEVLARSKGTFIAIDPEKMFAKFVER*
F14TB_10004272813300001431SoilVRGRKHINTAEILNQKGDVLARGRGLFIAIDPHRMFAKFVEK*
JGI12712J15308_1000914253300001471Forest SoilRVEGREVEVEGRKHINSAEILNEKNEVLARSRGTFIAIDPEKMFAKYVQK*
JGI12627J18819_1044253013300001867Forest SoilVPLHKPLRVEGREVSVQGRIHINTAEILNEKDEVLARSKGTFIAIDPEKMFAKFVER*
JGI26341J46601_1017158723300003219Bog Forest SoilLHKPLRVEGREIKVEGRTHINAAEILNDKNEVLARSRGTFIAIDPAKMFAKYVER*
JGIcombinedJ51221_1035560013300003505Forest SoilRVEGREVKVEGRTHINAAQILNEKNEVLARSRGTFIAIDPAKMFAKYVER*
Ga0062389_10087006523300004092Bog Forest SoilRTHINTAEILNDQNEVLARSRGVFIAIDPEKMFRKYVKR*
Ga0062386_10100193723300004152Bog Forest SoilLRVEGHEIEVRGTKHINAAEILNDKNEVLARSRGIFIAIDPEKMFAKYVER*
Ga0070690_10167966313300005330Switchgrass RhizosphereVRGREHINMAEIVNQKGEVLARGQGLFIAIDPHKMFAKFVDR*
Ga0070709_1051806323300005434Corn, Switchgrass And Miscanthus RhizosphereGRKHINMAEILNQKGEPLARSKGLFIAIDPKKMFAKYVDK*
Ga0070710_1103114023300005437Corn, Switchgrass And Miscanthus RhizosphereVHGRQHVNMAEIVNKEGEVLARGKGTFIAIDPEKMFGKFVER*
Ga0070707_10074395313300005468Corn, Switchgrass And Miscanthus RhizosphereVKGRRHINMAEILNQKREVLARGRGLFIAIDAHKMFQKFVER*
Ga0070698_10107844313300005471Corn, Switchgrass And Miscanthus RhizosphereLNKPLRVVGSETKVRGRTHVNTAEILNDKNEVLARSTGIFIAIDPAQMFAKYVDR*
Ga0073909_1022258123300005526Surface SoilLRVEGREISVRGTQHINEAWIMNEKEEVLARSRGVFIAIDPEKMFGKFVER*
Ga0070735_1044681313300005534Surface SoilNAAEILNRRGEVLARSRGTFVAIDPHRMFAKFVER*
Ga0070735_1082034813300005534Surface SoilRHLNAAAILTSKGEVLASSEGVFIAIDPEKMFKKHLKK*
Ga0070732_1057560923300005542Surface SoilLRVEGKEVSVEGRIHINAAEILNEENEVLARSKGTFIAIDPEKMFAKFVER*
Ga0066708_1018037923300005576SoilVRGKRHVNVAEICNQKNEVLARGRGVFIAIDPLKMFAKHIR*
Ga0070762_1045234313300005602SoilQKKGRTHVNAAEILNDKDEVLARSRGIFIAIDPAKMFAKFAER*
Ga0070763_1016341433300005610SoilRQHINMAEILNPTGEVLARSRGLFIAIDPHKMFAKFVDR*
Ga0068859_10140776623300005617Switchgrass RhizosphereMAEIVNQKGEVLARGQGLFIAIDPHKMFAKFVDR*
Ga0066903_10748100223300005764Tropical Forest SoilREISVRGTQHINEACILNEKNEILARSRGVFIAIDPEKMFGKFVER*
Ga0070766_1051062413300005921SoilRAEGREIEKRGRTHVNSAEILNEHNEVLARSRGIFIAIDPEKMFAKYVER*
Ga0070717_1011679813300006028Corn, Switchgrass And Miscanthus RhizosphereGRETKVRGRTHVNTAEILNDKNEVLARSTGIFIAIDPAQMFAKYVDR*
Ga0070717_1129029413300006028Corn, Switchgrass And Miscanthus RhizospherePLRVEGREIEVRGNKHINAAEILNEKDEVLARSRGIFIAIDPEQMFAKYVER*
Ga0070717_1129764213300006028Corn, Switchgrass And Miscanthus RhizosphereLYKPLHVEGREVSVHGRQHINVAEILNEKNEVLARSKGIFIAIDPEKMFAKFVER*
Ga0075017_10144189023300006059WatershedsRVEGRRHTNRGEILNAKGEVLAHSEGIFIAIDPHKMFAKQIES*
Ga0075019_1044079523300006086WatershedsGRRHTNRGEILNAKGEVLARSEGIFIAIDPHKMFAKQIES*
Ga0075019_1089343023300006086WatershedsINMAEILDEKDEVLARSRGTFIAIDPEKMFGKFVER*
Ga0075030_10039464633300006162WatershedsLRVEGREVSVHGRQHINMAEILNENNEVLARSRGTFIAIDPEKMFGKFVER*
Ga0075018_1045612713300006172WatershedsHGRQHINMAEILNENNEVLARSRGTFIAIDPEKMFAKFVIR*
Ga0075018_1047645013300006172WatershedsVEGRKHTNRGEILNAKGEVLASAEALFIAIDPDRMFAKTK*
Ga0070716_10091296813300006173Corn, Switchgrass And Miscanthus RhizosphereEGREVSVEGRQHINAAEILNEKCEILARSRGVFIAIDPEKMFGKFVERG*
Ga0070765_10157168913300006176SoilAAEILNENNEVLARSRGTFIAIDPEKMFAKFVER*
Ga0066665_1077214613300006796SoilINMAEILNEKGEVLARSEGLFIAIDPHRMFAKFVDR*
Ga0066659_1081999813300006797SoilREIEVRGTQHINSAEILNEKGEILARSRGVFIAIDPERMFAKYAER*
Ga0075434_10126638113300006871Populus RhizosphereLRVRGREHINMAEILNQKDEVLASGEGLFIAIDPHKMFAKHIGK*
Ga0099829_1180682513300009038Vadose Zone SoilEILNQKDEVLARSRGLFIAIDPKKMFAKFVNRKKKEIT*
Ga0099827_1018609233300009090Vadose Zone SoilPVPLNKPLRVEGREMKVRGRTHVNSAEILNDKNEILARSRGIFIAIDPEKMFAKYVER*
Ga0105240_1127703523300009093Corn RhizosphereRRHVNMGEILNQKGEVLARGRALFIAIDPRRFAKFMK*
Ga0105247_1174805113300009101Switchgrass RhizosphereSVRGRKHVNQGEILNQKGEVLARSRALFIAIDPRRFAKFVK*
Ga0116214_101864343300009520Peatlands SoilVHGRQHVNMAEILNDKNEVLARSKGVFIAIDPEKMFGKFVER*
Ga0116221_108859723300009523Peatlands SoilQHTNMAEILNPKGEVLARGRGLFIAIDPQKMFAKFVDR*
Ga0116113_117537813300009638PeatlandVEGREVSVDGRIHINAAEIMNEKNEVLARSRGTFIAIDPEKMFGKFVER*
Ga0116110_105351113300009643PeatlandGREVSLHGRQHVNMAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER*
Ga0116216_1002304213300009698Peatlands SoilGRQHVNMAEILNDKNEVLARSKGVFIAIDPEKMFGKFVER*
Ga0116219_1062958713300009824Peatlands SoilQPLHVEGREVSVHGRQHINQAEIRNQKNEVLARSKGIFIAIDPEKMFAKFVER*
Ga0126384_1138265713300010046Tropical Forest SoilINMAEILNKKDEVLASGEGLFIAIDPHKMFAKFVDK*
Ga0134071_1029426923300010336Grasslands SoilAEILNDKNEVLASSRGTFIAIDPHRMFSRFVKRG*
Ga0074044_1033286423300010343Bog Forest SoilMAEILNEKGEVLARSQGLFIAIDPHKMFARFVDR*
Ga0126376_1172341613300010359Tropical Forest SoilRRHINVAEILNQKGDVLARSRGTFVAIDAHKMFSRFVER*
Ga0126379_1029833413300010366Tropical Forest SoilEAWILNEKNEILARSRGVFIAIDPEKMFGKFVER*
Ga0126381_10104867623300010376Tropical Forest SoilAAEILNAEGEVLARSRGVFVAIDPEKMFGKFVER*
Ga0126381_10225441133300010376Tropical Forest SoilHINMAEIMNEKREVLARSKGTFIAIDPEKMFGKFVER*
Ga0126381_10350941313300010376Tropical Forest SoilMAEILNGRDEVLARSQGTFIAIDPDRMFAKFVDR*
Ga0136449_10104964613300010379Peatlands SoilHVNQAEIKNEKGEILARSRGLFIAIDPEKMFGKFVER*
Ga0126383_1078794723300010398Tropical Forest SoilHGRQHINMAEIMNEEGEVLARGRGVFIAIDPEKMFGKFVER*
Ga0126344_100256613300010866Boreal Forest SoilVEGRELSVQGRQHINTAEILNDKNAVLARSRGIFIAIDPEKMFAKYVDR*
Ga0126356_1075690213300010877Boreal Forest SoilYEVEAQGRQHVNMAEISNEKNEVLARGQGIFIAIDPEKMFAKYAKK*
Ga0150983_1231852913300011120Forest SoilQHINAAEIRNQKNEVLARSRGTFIAIDPERMFGKFVER*
Ga0150983_1516412713300011120Forest SoilEITNEQGEILARSYGVFIAIDPMKMFAKFAKNGK*
Ga0137392_1023435623300011269Vadose Zone SoilETKVRGRTHVNTAEILNNKNDVLARSTGIFIAIDPEQMFAKYVDS*
Ga0137389_1006002013300012096Vadose Zone SoilVKVKGRKHINMAEILNDKGDVLARSQGLFSAIDPHRMFARFVER*
Ga0137389_1010428313300012096Vadose Zone SoilIEVRGTQHLNSAEILNEKGEILARSRGVFIAIDPETMFAKYAER*
Ga0137388_1171580123300012189Vadose Zone SoilRGKKHINIAEIRNQKGEVLARGRAVFIAIDPLKMFAKHIKKL*
Ga0137399_1009491913300012203Vadose Zone SoilNSAEILNEKSAVLARSRGVFIAIDPERMFAKYAKR*
Ga0137371_1084901013300012356Vadose Zone SoilINMAEILNQKGEVLARSRGLFIAIDPYKMFGKFVER*
Ga0137390_1088540023300012363Vadose Zone SoilERAVRGKRHVNVAEIRNQKKEVLARGRGVFIAIDPLKMFAKHIR*
Ga0137390_1145345613300012363Vadose Zone SoilREIEVRGAKHINAAEILNENNEVLARSRGIFIAIDPERMFAKYVER*
Ga0137416_1215522323300012927Vadose Zone SoilRKHINMAEILNQKGEPLARSKGLFIAIDPKKMFAKYVDK*
Ga0137404_1054813913300012929Vadose Zone SoilINTAEILNQKGETLARGKGLFIAIDPHRMFAKYVDK*
Ga0181538_1013556113300014162BogINMAEILNEKGEVLARSQGLFIAIDPHRMFARFVER*
Ga0181528_1085445013300014167BogGRKHINMAEILNDKNEVLARSQGVFIAIDPHRMFARFVER*
Ga0163163_1004058663300014325Switchgrass RhizosphereRKHVNQGEILNQKGEVLARSRALFIAIDPRRFAKFVK*
Ga0182024_1030363213300014501PermafrostREEKVQGRTHVNTAEILNDKDEVLARSRGIFIAIDPEKMFAKFVER*
Ga0182024_1033534813300014501PermafrostREEKVQGRTHVNTAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER*
Ga0182024_1217939313300014501PermafrostLRVEGREEKVHGRTHINTAEILNEKNEVLARSRGIFIAIDPEKMFAKFVER*
Ga0181525_1015292123300014654BogDILGRVHTNAAEILNAKGEVLARSRGTFVAIDPARMFAKYLNK*
Ga0181525_1088986823300014654BogEIEVRGPKHINAAEILNEKNEVLARSRGIFIAIDPEKMFAKHIKR*
Ga0181522_1066942913300014657BogQPLRVEGREIEKRGRTHVNAAEILNENNEVLARSRGIFIAIDPEKMFAKFVNK*
Ga0181519_1000157913300014658BogTAEILNEKNEVLARSRGTFIAIDPQKMFAKYVER*
Ga0134072_1014601513300015357Grasslands SoilRVESREVAVHGRQHVNMAEIMNKEGEVLARGKGIFIAIDPEKMFGNFVER*
Ga0132255_10374498513300015374Arabidopsis RhizosphereNMAEILNQKGEPLARSKGLFIAIDPKKMFAKYVDK*
Ga0187825_1034605923300017930Freshwater SedimentRHINTAEILNQRNEVLARGRGTFIAIDHQRMFATHLGK
Ga0187801_1017719723300017933Freshwater SedimentEGREVSVHGRQHINMAEILSENNEVLARSRGTFIAIDPEKLFGKFVER
Ga0187821_1020728313300017936Freshwater SedimentRQHINQAEILNEKGEILARSRGTFIAIDPEKMFGKFVDR
Ga0187819_1026190813300017943Freshwater SedimentEGREVSVHGRQHINMAEILSENNEVLARSRGTFIAIDPEKMFGKFVER
Ga0187819_1033981523300017943Freshwater SedimentSGRRHINQAEILNRKKEVLARSRGTFIAIDPHRMFGKFVDK
Ga0187879_1000272013300017946PeatlandNTAEILNEKNEVLARSRGTFIAIDPEKMFAKYAER
Ga0187847_1025062713300017948PeatlandHVNAAEILNEQNEVLARSRGIFIAIDPEKMFAKFVER
Ga0187847_1076815613300017948PeatlandPLHVEGCEIKVEGRTHINAAEILNEKNEVLARSRGTFIAIDPEKMLAKHVKS
Ga0187817_1024233813300017955Freshwater SedimentRYHTNEAEILNQKGEVLARSKGVFIAVDPHKMFAKFVQR
Ga0187778_10001700163300017961Tropical PeatlandGRYHTNAAEILDAKGQILAHSEGVFVAIDPERRFQKFVNR
Ga0187777_1075379723300017974Tropical PeatlandNMAEILNESGEVLARSKGIFIAIDPEKMFGKFVER
Ga0187782_1006037543300017975Tropical PeatlandNMAEILNAKGEVLARSRGVFIAIDAHKMFAKFVER
Ga0187816_1015563713300017995Freshwater SedimentVRVHGRQHINMAEILNPKGEVLARGRGLFIAIDPHKMFAKFVDR
Ga0187805_1049138813300018007Freshwater SedimentVSVHGRQHINAAEILNDNNEVLARSRGTFIAIDPEKMFGKFVER
Ga0187872_1015600913300018017PeatlandNMAEILNEKGEVLARSQGLFIAIDPHKMFARFVDR
Ga0187864_1020827713300018022PeatlandPLRVEGREVSVYGRQHVNTAEILNEKNEVLARSRGTFIAIDPEKMFAKYAER
Ga0187855_1039048213300018038PeatlandEVAGRRHINVAEILNQKGEILARGRGLFIAIDPHKMFARFVDR
Ga0187862_1032753313300018040PeatlandHKPLRVEGREIEKRGRTHINAAEILNEKDEVLARSRGIFIAIDPEKMFAKFVER
Ga0187871_1009240923300018042PeatlandRQHINKAEILNEKNEVLARSQGLFIAIDPQKMFAKFVER
Ga0187772_1108927413300018085Tropical PeatlandNMAEIFNQKGEVLARSRGTFIAIDPEKMFGRFVER
Ga0187771_1029167513300018088Tropical PeatlandKVKGRQHINVAQILNQKGEVLARGRALFIAIDPHKMFGKFVER
Ga0187771_1114006613300018088Tropical PeatlandRQHINMAEILNEKNEVLARSRGIFIAIDPEKMFGKFVER
Ga0187771_1134473813300018088Tropical PeatlandMTSINMAGILSEQGEVLARSRGTFIAIDPEKMSKKFVEK
Ga0066667_1205223813300018433Grasslands SoilINMAEIFDQKGEVLARSRGTFIAVDAERMFAKYADK
Ga0210407_1046236213300020579SoilVNMAEILNSDGEVLARGRGLFIAIDPQKMFAKFVER
Ga0210403_1105477413300020580SoilREIEVRGKTHVNAAEILNDKNEVLARSRGIFIAIDPEKMFAKYVER
Ga0210399_1064447623300020581SoilEGREIQKKGRTHVNAAEILNDKDEVLARSRGIFIAIDPAKMFAKFAER
Ga0210399_1099731813300020581SoilNAAEILNDKGEVLARSRGTFIAIDPAKMFAKYVES
Ga0210395_1015080133300020582SoilHKPLRVEGREVSVHGRQHINMAEILNDKNEVLARSQATFIAIDPEKMFAKFVER
Ga0210395_1064771713300020582SoilREIKVEGRTHTNAAEILNEKNEVLARSRATFIAIDPAKMFAKFVER
Ga0210401_1124864913300020583SoilHVNMAEILNEKNEVLARSRGIFIAIDPEKMFTKFVER
Ga0210400_1004992233300021170SoilNSAEILNDKNEVLARSRGIFIAVDPAKMFAKYVDK
Ga0210400_1087593013300021170SoilEVSVSGRQHINTAEILNEKNEVLARSRGLFIAIDPEKMFAKFVKK
Ga0210385_1001489213300021402SoilAEGRTHINAAEILNDKGEVLARSRGTFIAIDPAKMFAKYVES
Ga0210385_1020187043300021402SoilRTHVNSAQILNEKGEILARSRGIFIAIDPEKMFAKYVER
Ga0210397_1146349823300021403SoilKKKGRTHVNAAEILNDKNEILARSRGIFIAIDPEKMFAKYVER
Ga0210387_1120536923300021405SoilNAAEILNEKNEVLARSRATFIAIDPAKMFAKFVER
Ga0210383_1115344213300021407SoilHVNMAEILNENGEVLARGEGTFIAIDPERMFGRFAKP
Ga0210394_1050211123300021420SoilTHINAAEILNEKDEVLARSRGTFIAINPEKMFAKFVER
Ga0210394_1174378513300021420SoilNEAEIFNENNEVLARSRGTFIAIDPEKMFAKFVER
Ga0210384_1041916413300021432SoilGRKHVNMAEILNQKGEVLAQGQGLFIAIDPRKMFAKYVDK
Ga0210391_1153819023300021433SoilAEGRTHINAAEILNDKGEVLARSRGTFIAIDPAKMFAKFVER
Ga0210392_1088133623300021475SoilKRGRTHVNMAEILNEKNEVLARSRGIFIAIDPEKMFAKYVER
Ga0210392_1093393513300021475SoilTHINTAEILNEDNEVLARSRGIFIAIDPEKMFAKYVER
Ga0210398_1111113913300021477SoilVRVQGRMHINTAKILNDKNEVLARSQGTFIAIDPEKMFAKFVAR
Ga0210410_1070889423300021479SoilVPLHKPLRVEGREVSVHGRQHINMAEILNEKNEVLARSQATFIAIDPEKMFAKFVER
Ga0210410_1126102313300021479SoilVQGRQHINAAEIRNQKNEILARSRGTFIAIDPEKMFGKFVER
Ga0126371_1217609823300021560Tropical Forest SoilEIAVHGRQHINIAEILDQKGKVLARSKGIFIAIDPEKMFEKFVER
Ga0224570_10588623300022730RhizosphereVEGRELSVQGRQHINTAEILNDKNEVLARSRGIFIAIDPEKMFAKYVDR
Ga0224545_105880723300022881SoilIHINAAEILNDKNEVLARSKGTFIAIDPEKMFAKFVER
Ga0224564_111020223300024271SoilHKALRVEGREIEVRGNKHINAAEIFNENNEVLARSRGIFIAIDPEQMFKKYAER
Ga0208935_100617223300025414PeatlandHRPLKVEGKEVKVQGRTHINTAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER
Ga0208689_100652773300025459PeatlandINMAEILNEKGEVLARSEGVFIAIDPHRMFTRFADR
Ga0208686_111621513300025500PeatlandINMAEILNEKGEVLARSQGLFIAIDPHKMFARFVER
Ga0208691_102586323300025612PeatlandNTAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER
Ga0207684_1077513113300025910Corn, Switchgrass And Miscanthus RhizosphereMPDVPLRVVGRETKVRGRTHVNTAEILNDKNEVLARSTGIFIAIDPAQMFAKYVDR
Ga0207664_1091581833300025929Agricultural SoilNMAEIMNQEGEVLARGKGIFIAIDPEKMFGKFVER
Ga0207644_1078451913300025931Switchgrass RhizosphereNMAEIVNQKGEVLARGQGLFIAIDPHKMFAKFVDR
Ga0207665_1102798323300025939Corn, Switchgrass And Miscanthus RhizosphereVHRVRGRRHINTAEILNQRNEVLARGRGTFIAIDPQRMFAKHIQK
Ga0207667_1152062223300025949Corn RhizosphereRVESREVAVHGRQHVNMAEIMNTEGEVLARGKGIFIAIDPEKMFGKFVER
Ga0208532_100597423300026011Rice Paddy SoilQHVNMAEIMNKEGEVLARGKGIFIAIDPEKMFGKFVER
Ga0209470_121503623300026324SoilSVRERRHIHRAEILNDKNEVLASSRGTFIAIDPHRMFSRFVKRG
Ga0209159_128079213300026343SoilHRAEILNDKNEVLASSRGTFIAIDPHRMFSRFVKRG
Ga0257168_108383423300026514SoilGRTHVNSAEILNDQNEVLARSRGIFIAIDPEKMFAKYVER
Ga0209648_1045485013300026551Grasslands SoilHGNSAEILNDQNEVLARSRGIFIAIDPEKMFAKYVER
Ga0209179_108834023300027512Vadose Zone SoilVEGREIKVRGRTHVNSAEILNEKNEVLARSRAIFIAIDPEKMFAKYVER
Ga0209222_101286513300027559Forest SoilLRKPLRVEGREVEVRGRIHINTAQILNEKDEVLARSRGIFIAIDPEKMFKKYVKR
Ga0208043_113130313300027570Peatlands SoilRQHINAAEILNEKNEVLARSKGIFIAIDPEKMFGKFVER
Ga0209525_108542133300027575Forest SoilHVNAAEITNEKGEVLARSRGVFIVIDPEKMFAKYVKKQGKK
Ga0208827_106293813300027641Peatlands SoilHTNMAEILNPKGEVLARGRGLFIAIDPQKMFAKFVDR
Ga0209076_113324413300027643Vadose Zone SoilNMAEILNQKGEVLARSKGLFIAIDPRRMFAKFVDK
Ga0209689_116758813300027748SoilVRVRGRKHVNMAEILNQKGEVLAQGQGLFIAIDPKKMFAKYVDK
Ga0209655_1011074823300027767Bog Forest SoilEVEVEGRTHINTAQILNEKDEVLARSRGTFIAIDPAKMFAKYVKR
Ga0209811_1016528123300027821Surface SoilLRVEGREISVRGTQHINEAWIMNEKEEVLARSRGVFIAIDPEKMFGKFVER
Ga0209580_1032606623300027842Surface SoilRTSLLRVRGRRHINTAEILNRRNEVLARGKGTFIAIDPARMFAKHLGKSR
Ga0209169_1038576613300027879SoilSVHGRQHINTAEILNDKNEVLARSRGIFIAIDPEKMFAKYVDR
Ga0209590_1074804513300027882Vadose Zone SoilPVPLNKPLRVEGREMKVRGRTHVNSAEILNDKNEILARSRGIFIAIDPEKMFAKYVER
Ga0209275_1034749623300027884SoilINMAEILNPKGEVLARGRGLFIAIDPQKMFAKFVDR
Ga0209275_1046163013300027884SoilVPLHKPLRVEGRELTVKGRTHINAAEILNEKDEVLARSKGIFIAIDPEKMFAKFVER
Ga0209380_1004434513300027889SoilINTAEILNDKNEVLARSRGIFIAIDPEKMFAKYVDR
Ga0209380_1015872643300027889SoilINMAEILNEQNEVLARSRGIFIAIDPEKMFAKFVDRPVDR
Ga0209415_1078992523300027905Peatlands SoilVSVHGRQHVNMAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER
Ga0209526_1055651613300028047Forest SoilGNKHINTAEIVNEKGEILARSKGVFIAIDPDKMFAKFVGR
Ga0302153_1026923913300028574BogRTHVNAAEILNDKDEVLARSRGIFIAIDPEKMFAKYAER
Ga0302231_1025188913300028775PalsaGRKHINMAEILNEKGEVLAHSQGLFIAIDPRRIFAGFVER
Ga0307312_1010413413300028828SoilKRHVNSAEILNQKGEVLARSRGTFLAIDPRRMFAKFVESSR
Ga0308309_1041534413300028906SoilHVEGREVSVQGRVHINEAEIMDENSEVLARSRGTFIAIDPEKMFAKYVGR
Ga0308309_1062885433300028906SoilRHINMAEILNEKDEVLARSKGLFIAIDPKKMFAKFVEK
Ga0308309_1079580733300028906SoilINAAEILNEKDEVLARSRGTFIAIDPAKMFAKYVER
Ga0308309_1118837413300028906SoilTHINAAEILNENNEVLARSRGTFIAIDPEKMFAKFVER
Ga0308309_1184791513300028906SoilKGVSVNGRQHINMAEISNEKGEILARSRGTFIAIDPEKMFGRYAGR
Ga0222749_1051960513300029636SoilRGRTHVNAAEILNDKDEVLARSRGIFIAIDPEQMFAKYVER
Ga0311329_1045722723300029907BogHINAAEILNEKNEVLARSRGIFIEIDPEKMFAKHIER
Ga0311362_1019790953300029913BogVEGHGVEIQGRVHTNAAEILNAKGEVLARSRGTFIAIDPARMFAKYLNK
Ga0311358_1021921433300029915BogLRVEGREIEKRGRTHVNAAEILNDKNEVLARSRGIFIAIDPEKMFAKYVER
Ga0311371_1115689123300029951PalsaLRVEGREIKVEGRTHVNAAEILNEKDEVLARSRGIFIAIDPEKMFAKHVER
Ga0311346_1037048413300029952BogQHKPLRVEGREIEVRGRTHVNAAEILNDKDEVLARSRGIFIAIDPEKMFAKYAER
Ga0311342_1027431933300029955BogLSVEGRKHINIAEILNGKNEVLARSQGVFIAIDPHKMFGKFVER
Ga0302150_1021112513300029956BogEVRGAKHINAAEILNEKNEVLARSRGIFVAIDPEKMFAKYVER
Ga0311339_1064443323300029999PalsaPLHVEGREVTVQGRVHINEAEIMDEKNEVLARSRGTFIAIDPEKMFAKYVGR
Ga0311338_1042988523300030007PalsaLRVEGRELEVKGRTHVNVAEILNEKNEVLARSRGIFIAIDPERMFAKYVGP
Ga0302176_1026595723300030057PalsaEIKVEGRTHVNAAEILNEKDEVLARSRGIFIAIDPEKMFANHVER
Ga0311349_1195983923300030294FenRRHINMAEILNQKDEVLARGQGLFIAIDPKKMFAKFVDR
Ga0311370_1213103423300030503PalsaQPLRVEGHELEVHGRRHVNAAEIFNEQNEVLARSRGVFVAIDPEKMFAKFVER
Ga0302183_1020397713300030509PalsaREVTVQGRVHINEAEIMDEKNEVLARSRGTFIAIDPEKMFAKYVGR
Ga0302275_1019052623300030518BogREIEKRGRTHVNAAEILNDKNEVLARSRGIFIAIDPEKMFAKYVER
Ga0311372_1084581313300030520PalsaLRVEGRELEVKGRTHVNVAEILNEKNEVLARSRGIFIAIDPAKMFAKYVER
Ga0311354_1148208723300030618PalsaPLRVEGRELEVKGRTHVNVAEILNEKNEVLARSRGIFIAIDPERMFAKYVGP
Ga0316363_1006166433300030659Peatlands SoilVEGREVSVHGRQHVNMAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER
Ga0302310_1064575013300030737PalsaVNAAEILNEKDEVLARSRGIFIAIDPEKMFAKHVER
Ga0265750_106717013300030813SoilLHVEGREVSVQGRVHINEAEIMDENSEVLARSRGTFIAIDPEKMFAKYVGR
Ga0302323_10330970413300031232FenHGRQHVNMAEILNEKDEVLARSKGIFIAIDPEKMFGKFVER
Ga0265325_1003520433300031241RhizosphereEVRGNKHINTAEILNEKNEVLARSRGTFIAIDPEKMFGKFVER
Ga0302318_1065087423300031258BogGREIEKRGRTHVNAAEILNDKNEVLARSRGIFIAIDPEKMFAKYVER
Ga0302320_1094325823300031524BogAKHINAAEILNEKNEVLARSRGIFVAIDPEKMFAKYVER
Ga0307476_1015644813300031715Hardwood Forest SoilKKGRTHVNSAEILNDKNEVLARSRGIFIAVDPAKMFAKYVDK
Ga0307476_1018623633300031715Hardwood Forest SoilVEVRGRTHINAAEILNEKNEVLARSRGTFIAIDPEKMFAKYVER
Ga0307476_1116320723300031715Hardwood Forest SoilPLRVEGKEVSVEGRIHINAAEILNEKDEVLARSKGTFIAIDPEKMFAKFVER
Ga0307474_1131023213300031718Hardwood Forest SoilINSAEILNEQGEVLARSRGIFIAIDPEKMFGKFVER
Ga0307477_1025658713300031753Hardwood Forest SoilTHVNAAEILNDKNEVLARSKGIFIAIDPAKMFAKYAER
Ga0307475_1157826813300031754Hardwood Forest SoilIEVRGTKHINAAEILNENNEVLARSRGIFIAIDPEKMFAKYVER
Ga0318567_1058723623300031821SoilHVNMAEILNQKDEVLASSEGLFIAIDPKKMFAKFVEK
Ga0307478_1083906713300031823Hardwood Forest SoilEIKKRGRTHVNMAEILNEKNEVLARSRGIFIAIDPEKMFAKFVER
Ga0311301_1190884513300032160Peatlands SoilHGRQHVNMAEILNDKNEVLARSKGVFIAIDPEKMFGKFVER
Ga0307472_10028817113300032205Hardwood Forest SoilRRHVNMAEIVNAKGEVLARSRGLFIAIDPKRMFAKFVER
Ga0335082_1009236813300032782SoilNEAWISNEKNEVLARSRGVFIAIDPERMFGKFVER
Ga0335082_1068169113300032782SoilGREVSVRGTQHINEAWILNDKDEVLARSRGVFIAIDPERMFGKFVER
Ga0335082_1167949023300032782SoilQGRKHTNVAAILDQKGEVMARGRGLFIAIDAAKMFGKFVER
Ga0335079_1014493613300032783SoilRHINVAEILNQKGEVLARGRGIFIAIDPHKLFAKFVER
Ga0335079_1069288323300032783SoilPVPLHKPLRVEGKEVSVHGRQHINMAEIFNDKGEILAHSRGTFIAIDPEKMFGKFVER
Ga0335078_1202535723300032805SoilGRRHINVAEILNRKGEVLARGRGTFIAVDPYKMFARFVER
Ga0335081_1037355233300032892SoilNMAEILNQKNEVLARGQGVFIAIDPHKMFGKFVEK
Ga0335081_1112403713300032892SoilRYHTNEAEILNSKGEVLARSKGLFIAIDPHKMFAKFVDR
Ga0335076_1007636713300032955SoilRGRYHTNMAEILNAKGEVLARSRGLFIAIDPHKLFAKFVDR
Ga0335084_1029285423300033004SoilGRKHTNVAAILDQKGEVMARGRGLFIAIDAAKMFGKCVER
Ga0326728_1035967313300033402Peat SoilNMAEILNEKGEVLANSEGVFVAIDPHRMFARFVDR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.