NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F020616

Metagenome Family F020616

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020616
Family Type Metagenome
Number of Sequences 223
Average Sequence Length 41 residues
Representative Sequence MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEF
Number of Associated Samples 158
Number of Associated Scaffolds 223

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.95 %
% of genes near scaffold ends (potentially truncated) 82.06 %
% of genes from short scaffolds (< 2000 bps) 83.86 %
Associated GOLD sequencing projects 143
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.686 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(10.314 % of family members)
Environment Ontology (ENVO) Unclassified
(42.601 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.601 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.47%    β-sheet: 0.00%    Coil/Unstructured: 48.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 223 Family Scaffolds
PF13495Phage_int_SAM_4 3.14
PF00589Phage_integrase 2.24
PF13620CarboxypepD_reg 1.79
PF07638Sigma70_ECF 1.79
PF00069Pkinase 1.79
PF13360PQQ_2 1.35
PF07676PD40 1.35
PF00753Lactamase_B 1.35
PF00989PAS 0.90
PF08281Sigma70_r4_2 0.90
PF00392GntR 0.90
PF04972BON 0.90
PF13450NAD_binding_8 0.90
PF01553Acyltransferase 0.90
PF13676TIR_2 0.90
PF01266DAO 0.90
PF07714PK_Tyr_Ser-Thr 0.90
PF02985HEAT 0.45
PF06210DUF1003 0.45
PF13519VWA_2 0.45
PF00850Hist_deacetyl 0.45
PF05598DUF772 0.45
PF00440TetR_N 0.45
PF01546Peptidase_M20 0.45
PF16576HlyD_D23 0.45
PF01522Polysacc_deac_1 0.45
PF11138DUF2911 0.45
PF00027cNMP_binding 0.45
PF03601Cons_hypoth698 0.45
PF14319Zn_Tnp_IS91 0.45
PF00535Glycos_transf_2 0.45
PF05738Cna_B 0.45
PF13247Fer4_11 0.45
PF00665rve 0.45
PF02371Transposase_20 0.45
PF02954HTH_8 0.45
PF09335SNARE_assoc 0.45
PF05163DinB 0.45
PF07592DDE_Tnp_ISAZ013 0.45
PF00144Beta-lactamase 0.45
PF03098An_peroxidase 0.45
PF13478XdhC_C 0.45
PF12804NTP_transf_3 0.45
PF01807zf-CHC2 0.45
PF05090VKG_Carbox 0.45
PF01895PhoU 0.45
PF16640Big_3_5 0.45
PF01695IstB_IS21 0.45
PF00498FHA 0.45
PF13271DUF4062 0.45
PF13751DDE_Tnp_1_6 0.45
PF09286Pro-kuma_activ 0.45
PF13649Methyltransf_25 0.45
PF02687FtsX 0.45
PF12704MacB_PCD 0.45
PF07883Cupin_2 0.45
PF07690MFS_1 0.45
PF04116FA_hydroxylase 0.45
PF13231PMT_2 0.45
PF03682UPF0158 0.45
PF16483Glyco_hydro_64 0.45
PF11994DUF3489 0.45
PF13618Gluconate_2-dh3 0.45
PF02838Glyco_hydro_20b 0.45
PF09587PGA_cap 0.45
PF12833HTH_18 0.45

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 223 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 10.76
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.79
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.90
COG0358DNA primase (bacterial type)Replication, recombination and repair [L] 0.45
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.45
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.45
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.45
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.45
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.45
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.45
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.45
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.45
COG2367Beta-lactamase class ADefense mechanisms [V] 0.45
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.45
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.45
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 0.45
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.45
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.45
COG3525N-acetyl-beta-hexosaminidaseCarbohydrate transport and metabolism [G] 0.45
COG3547TransposaseMobilome: prophages, transposons [X] 0.45
COG4420Uncharacterized membrane proteinFunction unknown [S] 0.45
COG4584TransposaseMobilome: prophages, transposons [X] 0.45
COG4934Serine protease, subtilase familyPosttranslational modification, protein turnover, chaperones [O] 0.45


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.69 %
UnclassifiedrootN/A10.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02IK6GRAll Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7515Open in IMG/M
2189573000|GPBTN7E02FY59WAll Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7519Open in IMG/M
3300000567|JGI12270J11330_10038075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2721Open in IMG/M
3300000567|JGI12270J11330_10273165All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300000574|JGI1357J11328_10196151All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3547Open in IMG/M
3300000955|JGI1027J12803_109589061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7700Open in IMG/M
3300004092|Ga0062389_104859357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7506Open in IMG/M
3300005340|Ga0070689_101389401All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7634Open in IMG/M
3300005356|Ga0070674_100632451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7908Open in IMG/M
3300005366|Ga0070659_101043168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7719Open in IMG/M
3300005434|Ga0070709_10383631All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300005471|Ga0070698_100672927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7976Open in IMG/M
3300005533|Ga0070734_10046207All Organisms → cellular organisms → Bacteria2665Open in IMG/M
3300005533|Ga0070734_10087669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1836Open in IMG/M
3300005533|Ga0070734_10206990All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas1130Open in IMG/M
3300005534|Ga0070735_10044209All Organisms → cellular organisms → Bacteria → Acidobacteria2992Open in IMG/M
3300005563|Ga0068855_100661759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71121Open in IMG/M
3300005564|Ga0070664_100383308All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300005564|Ga0070664_100654544All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7976Open in IMG/M
3300005591|Ga0070761_10208220All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300005591|Ga0070761_10690392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7639Open in IMG/M
3300005591|Ga0070761_10716324All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005617|Ga0068859_100163221All Organisms → cellular organisms → Bacteria → Acidobacteria2307Open in IMG/M
3300005841|Ga0068863_100563765All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300005921|Ga0070766_10867455All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005921|Ga0070766_11015019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria571Open in IMG/M
3300005993|Ga0080027_10479395All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300006050|Ga0075028_100279317All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076925Open in IMG/M
3300006052|Ga0075029_100868624All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7617Open in IMG/M
3300006059|Ga0075017_100347319All Organisms → cellular organisms → Bacteria → Acidobacteria1104Open in IMG/M
3300006102|Ga0075015_100501914All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7699Open in IMG/M
3300006102|Ga0075015_100986487All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300006163|Ga0070715_10380642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium779Open in IMG/M
3300006174|Ga0075014_100075456All Organisms → cellular organisms → Bacteria1516Open in IMG/M
3300006237|Ga0097621_100005837All Organisms → cellular organisms → Bacteria8696Open in IMG/M
3300006237|Ga0097621_101458718All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7649Open in IMG/M
3300006237|Ga0097621_101753471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia591Open in IMG/M
3300006354|Ga0075021_10880457All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7581Open in IMG/M
3300006354|Ga0075021_11106898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7519Open in IMG/M
3300006358|Ga0068871_100012366All Organisms → cellular organisms → Bacteria6288Open in IMG/M
3300006846|Ga0075430_100463874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71045Open in IMG/M
3300006847|Ga0075431_100345627All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300009088|Ga0099830_10526915All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300009090|Ga0099827_10716499All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300009098|Ga0105245_11940149All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300009098|Ga0105245_11984669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7635Open in IMG/M
3300009143|Ga0099792_10505330Not Available757Open in IMG/M
3300009143|Ga0099792_10746435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium637Open in IMG/M
3300009174|Ga0105241_10103491All Organisms → cellular organisms → Bacteria2267Open in IMG/M
3300009174|Ga0105241_11257193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter703Open in IMG/M
3300009174|Ga0105241_12202629All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300009176|Ga0105242_10250168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1597Open in IMG/M
3300009176|Ga0105242_12116011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3607Open in IMG/M
3300009176|Ga0105242_12504713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7564Open in IMG/M
3300009177|Ga0105248_10120843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae2955Open in IMG/M
3300009177|Ga0105248_10222107All Organisms → cellular organisms → Bacteria2127Open in IMG/M
3300009177|Ga0105248_12419412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7598Open in IMG/M
3300009177|Ga0105248_12574826All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7580Open in IMG/M
3300009177|Ga0105248_12859172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7550Open in IMG/M
3300009177|Ga0105248_12884486All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7548Open in IMG/M
3300009521|Ga0116222_1314112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7678Open in IMG/M
3300009522|Ga0116218_1134355All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300009522|Ga0116218_1569657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7502Open in IMG/M
3300009523|Ga0116221_1041791All Organisms → cellular organisms → Bacteria2189Open in IMG/M
3300009525|Ga0116220_10099925All Organisms → cellular organisms → Bacteria → Proteobacteria1229Open in IMG/M
3300009545|Ga0105237_10128767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae2526Open in IMG/M
3300009551|Ga0105238_10091507All Organisms → cellular organisms → Bacteria → Acidobacteria3029Open in IMG/M
3300010358|Ga0126370_12349528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7528Open in IMG/M
3300010379|Ga0136449_100350114All Organisms → cellular organisms → Bacteria → Acidobacteria2655Open in IMG/M
3300010379|Ga0136449_102794468Not Available689Open in IMG/M
3300010398|Ga0126383_12379206Not Available615Open in IMG/M
3300010403|Ga0134123_10484368Not Available1159Open in IMG/M
3300011119|Ga0105246_10692394All Organisms → cellular organisms → Bacteria → Acidobacteria892Open in IMG/M
3300011270|Ga0137391_10640949All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300011270|Ga0137391_10735933All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae817Open in IMG/M
3300011270|Ga0137391_11071806All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7653Open in IMG/M
3300011270|Ga0137391_11422567Not Available539Open in IMG/M
3300011271|Ga0137393_11579596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7545Open in IMG/M
3300011444|Ga0137463_1119331Not Available992Open in IMG/M
3300012096|Ga0137389_11531142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7563Open in IMG/M
3300012189|Ga0137388_10230810All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1679Open in IMG/M
3300012189|Ga0137388_11373779Not Available645Open in IMG/M
3300012189|Ga0137388_11906060Not Available524Open in IMG/M
3300012351|Ga0137386_10470288All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7906Open in IMG/M
3300012361|Ga0137360_10286490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1364Open in IMG/M
3300012362|Ga0137361_10845024All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300012363|Ga0137390_10539126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1138Open in IMG/M
3300012923|Ga0137359_10178924All Organisms → cellular organisms → Bacteria1893Open in IMG/M
3300012923|Ga0137359_10510603All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1060Open in IMG/M
3300012923|Ga0137359_10984895Not Available724Open in IMG/M
3300012930|Ga0137407_10791737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7895Open in IMG/M
3300012930|Ga0137407_10954791All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7812Open in IMG/M
3300012930|Ga0137407_11416646All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300012951|Ga0164300_10063778Not Available1505Open in IMG/M
3300013105|Ga0157369_11634398All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7655Open in IMG/M
3300013296|Ga0157374_11811544All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7636Open in IMG/M
3300013296|Ga0157374_12210115All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300013296|Ga0157374_12522148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7542Open in IMG/M
3300013297|Ga0157378_10311081All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1528Open in IMG/M
3300013306|Ga0163162_10010663All Organisms → cellular organisms → Bacteria → Acidobacteria8935Open in IMG/M
3300013306|Ga0163162_13453981All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7503Open in IMG/M
3300013308|Ga0157375_10002131All Organisms → cellular organisms → Bacteria17095Open in IMG/M
3300013832|Ga0120132_1011057Not Available1501Open in IMG/M
3300014153|Ga0181527_1203638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina widdelii824Open in IMG/M
3300014158|Ga0181521_10075527All Organisms → cellular organisms → Bacteria2167Open in IMG/M
3300014490|Ga0182010_10018054All Organisms → cellular organisms → Bacteria3195Open in IMG/M
3300014501|Ga0182024_10798029Not Available1151Open in IMG/M
3300014745|Ga0157377_11087157All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300014838|Ga0182030_11500383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium556Open in IMG/M
3300014969|Ga0157376_10027905All Organisms → cellular organisms → Bacteria4481Open in IMG/M
3300014969|Ga0157376_11023658All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300014969|Ga0157376_11676242All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300016319|Ga0182033_12114465Not Available513Open in IMG/M
3300017821|Ga0187812_1129170Not Available818Open in IMG/M
3300017933|Ga0187801_10120516All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71007Open in IMG/M
3300017942|Ga0187808_10124585All Organisms → cellular organisms → Bacteria → Proteobacteria1128Open in IMG/M
3300017942|Ga0187808_10414858All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7617Open in IMG/M
3300017942|Ga0187808_10519608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7553Open in IMG/M
3300017955|Ga0187817_10749919All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300017972|Ga0187781_10233960All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1299Open in IMG/M
3300017973|Ga0187780_11417366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7512Open in IMG/M
3300018001|Ga0187815_10185332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7881Open in IMG/M
3300018006|Ga0187804_10033444All Organisms → cellular organisms → Bacteria1945Open in IMG/M
3300018007|Ga0187805_10069408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1585Open in IMG/M
3300018007|Ga0187805_10529486All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7554Open in IMG/M
3300018008|Ga0187888_1240333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231707Open in IMG/M
3300018012|Ga0187810_10134080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7988Open in IMG/M
3300018012|Ga0187810_10321244All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7642Open in IMG/M
3300018042|Ga0187871_10817912All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300018058|Ga0187766_11260593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7537Open in IMG/M
3300018062|Ga0187784_10390827All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300018062|Ga0187784_10644404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7850Open in IMG/M
3300020579|Ga0210407_10596437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7861Open in IMG/M
3300020580|Ga0210403_10958401Not Available672Open in IMG/M
3300020581|Ga0210399_11013338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076668Open in IMG/M
3300021168|Ga0210406_10527139All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300021168|Ga0210406_10904934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7663Open in IMG/M
3300021180|Ga0210396_11422663All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7573Open in IMG/M
3300021181|Ga0210388_10761626All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300021401|Ga0210393_10508125Not Available984Open in IMG/M
3300021403|Ga0210397_11605334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7505Open in IMG/M
3300021405|Ga0210387_11564666All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7562Open in IMG/M
3300021420|Ga0210394_10620344All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium950Open in IMG/M
3300021433|Ga0210391_10954300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7668Open in IMG/M
3300021433|Ga0210391_11159142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7599Open in IMG/M
3300021445|Ga0182009_10849964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7501Open in IMG/M
3300021474|Ga0210390_11367983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3565Open in IMG/M
3300021478|Ga0210402_10358789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60761353Open in IMG/M
3300021478|Ga0210402_10368219All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300021559|Ga0210409_10101161All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2659Open in IMG/M
3300023255|Ga0224547_1048805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7550Open in IMG/M
3300024290|Ga0247667_1034559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7959Open in IMG/M
3300024331|Ga0247668_1051765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria834Open in IMG/M
3300025576|Ga0208820_1015088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales2615Open in IMG/M
3300025911|Ga0207654_10134761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1567Open in IMG/M
3300025912|Ga0207707_10032724All Organisms → cellular organisms → Bacteria4551Open in IMG/M
3300025912|Ga0207707_11421193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7553Open in IMG/M
3300025914|Ga0207671_11022712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7651Open in IMG/M
3300025920|Ga0207649_11533026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7527Open in IMG/M
3300025924|Ga0207694_10228705All Organisms → cellular organisms → Bacteria1518Open in IMG/M
3300025934|Ga0207686_11794042All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7508Open in IMG/M
3300025937|Ga0207669_10527380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7949Open in IMG/M
3300025941|Ga0207711_10146617All Organisms → cellular organisms → Bacteria2127Open in IMG/M
3300025942|Ga0207689_10048393All Organisms → cellular organisms → Bacteria → Acidobacteria3506Open in IMG/M
3300025944|Ga0207661_10196447All Organisms → cellular organisms → Bacteria → Acidobacteria1771Open in IMG/M
3300025944|Ga0207661_11321352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300025949|Ga0207667_10139336All Organisms → cellular organisms → Bacteria2498Open in IMG/M
3300025949|Ga0207667_10379835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1440Open in IMG/M
3300025949|Ga0207667_10395375All Organisms → cellular organisms → Bacteria → Acidobacteria1407Open in IMG/M
3300025949|Ga0207667_11257537All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17718Open in IMG/M
3300026023|Ga0207677_10132675All Organisms → cellular organisms → Bacteria → Acidobacteria1894Open in IMG/M
3300026023|Ga0207677_10162428All Organisms → cellular organisms → Bacteria1737Open in IMG/M
3300026035|Ga0207703_11880089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7575Open in IMG/M
3300026041|Ga0207639_10269594All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1493Open in IMG/M
3300026078|Ga0207702_11112223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7784Open in IMG/M
3300026118|Ga0207675_102312068All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300027570|Ga0208043_1092995All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300027604|Ga0208324_1111315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3760Open in IMG/M
3300027641|Ga0208827_1114521All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300027667|Ga0209009_1073636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis panaciterrae860Open in IMG/M
3300027905|Ga0209415_10355389All Organisms → cellular organisms → Bacteria → Acidobacteria1216Open in IMG/M
3300027905|Ga0209415_10834302All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7637Open in IMG/M
3300027908|Ga0209006_10664503Not Available856Open in IMG/M
3300028379|Ga0268266_11684599All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300028381|Ga0268264_10006076All Organisms → cellular organisms → Bacteria → Proteobacteria10201Open in IMG/M
3300029883|Ga0311327_10884225All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7516Open in IMG/M
3300029910|Ga0311369_10858562All Organisms → cellular organisms → Bacteria → Proteobacteria729Open in IMG/M
3300029922|Ga0311363_11519875All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7535Open in IMG/M
3300029943|Ga0311340_10967117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7702Open in IMG/M
3300029955|Ga0311342_10186928All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72022Open in IMG/M
3300030007|Ga0311338_10601846All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1131Open in IMG/M
3300030057|Ga0302176_10262898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7691Open in IMG/M
3300031231|Ga0170824_119182703Not Available1081Open in IMG/M
3300031234|Ga0302325_10612688All Organisms → cellular organisms → Bacteria1599Open in IMG/M
3300031234|Ga0302325_11325025All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7944Open in IMG/M
3300031234|Ga0302325_11332771All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobaculum → Chlorobaculum limnaeum940Open in IMG/M
3300031234|Ga0302325_11576533All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYMSc13B840Open in IMG/M
3300031234|Ga0302325_13089406All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7535Open in IMG/M
3300031236|Ga0302324_102395324All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7648Open in IMG/M
3300031525|Ga0302326_11834748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7792Open in IMG/M
3300031708|Ga0310686_104302724All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300031708|Ga0310686_106097902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4945Open in IMG/M
3300031708|Ga0310686_112556207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2165Open in IMG/M
3300031708|Ga0310686_119840648All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7512Open in IMG/M
3300031754|Ga0307475_10933892All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300032160|Ga0311301_10280713All Organisms → cellular organisms → Bacteria2696Open in IMG/M
3300032160|Ga0311301_10779268All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium1320Open in IMG/M
3300032160|Ga0311301_11950240All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300032783|Ga0335079_10077282All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3785Open in IMG/M
3300032783|Ga0335079_11931148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7571Open in IMG/M
3300032805|Ga0335078_11151483All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium901Open in IMG/M
3300032829|Ga0335070_11988982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7523Open in IMG/M
3300032892|Ga0335081_12033888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7612Open in IMG/M
3300032892|Ga0335081_12295710All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7564Open in IMG/M
3300033158|Ga0335077_12055904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7529Open in IMG/M
3300033402|Ga0326728_10049190All Organisms → cellular organisms → Bacteria → Proteobacteria6216Open in IMG/M
3300033412|Ga0310810_10232057All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2049Open in IMG/M
3300033513|Ga0316628_100456867All Organisms → cellular organisms → Bacteria → Acidobacteria1638Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.52%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.62%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.38%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.04%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.59%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.14%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.69%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.69%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.24%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.24%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.35%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.90%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.90%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.90%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.90%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.90%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.90%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.45%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.45%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.45%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.45%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.45%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.45%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.45%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.45%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.45%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.45%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.45%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.45%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.45%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300023255Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_040716302170459005Grass SoilMNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEF
N55_082083802189573000Grass SoilMTDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNMALD
JGI12270J11330_1003807543300000567Peatlands SoilMNDLIVAEKIAQWQKLKMLVLDSVSSPITKRVYNMALDEFMAWFQ*
JGI12270J11330_1027316513300000567Peatlands SoilMNELIAPQRIAQWQELKALVLDSVSSPITKRVYNMALEEFYAWF
JGI1357J11328_1019615123300000574GroundwaterMNELMVVEKIAEWQRLKALVLDSVSSSISRRVYNMALDEFMAPRRR*
JGI1027J12803_10958906113300000955SoilMTDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNM
Ga0062389_10485935723300004092Bog Forest SoilMTDLIVAEKIAQWQKSRALVLDSVSSPITKRVYNRALDEFMNRFRR
Ga0070689_10138940123300005340Switchgrass RhizosphereMTDLIAIQKISGWEKLKTLVLDSVSSPITKRVYNMALDEF
Ga0070674_10063245123300005356Miscanthus RhizosphereMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEF
Ga0070659_10104316813300005366Corn RhizosphereMTDLIAIQKISGWEKLKTLVLDSVSSPITKRVYNMALDEFL
Ga0070709_1038363123300005434Corn, Switchgrass And Miscanthus RhizosphereMTDLISLEKIAQWQKLKTLVLDSLSSPITKRVYNMALDEFMGW
Ga0070698_10067292713300005471Corn, Switchgrass And Miscanthus RhizosphereVVEKIAGWEKLKALVLDSVSSPITKRVYNMALEEFLVWFQ
Ga0070734_1004620713300005533Surface SoilMNDLMVVEKIAQWQKLKGMVLDSVSSPITKRVYNMALDEFMAWFQQ
Ga0070734_1008766933300005533Surface SoilMNDLIAVEKIAQWQKLKALVLDSVSSPITKRVYTWR*
Ga0070734_1020699013300005533Surface SoilMNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALEEF
Ga0070735_1004420943300005534Surface SoilMHDLVVVEKHEEWHRLKALVLDSVSSPTTRRVYNMALNEFIAWFKEA
Ga0070731_1018061823300005538Surface SoilMNDLAVVEKPAQREKLKAMVLDSVSSPITKRVYNKALNEF
Ga0068855_10066175933300005563Corn RhizosphereMNDLISLEKIAQWQRLKTLVLDSVSSPITKRVYNMALDEFMCWF
Ga0070664_10038330813300005564Corn RhizosphereMNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALD
Ga0070664_10065454413300005564Corn RhizosphereMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMAL
Ga0070761_1020822013300005591SoilMNELIVIEKIAQWEKLKQLVLDSVSSPITKRVYNMALDEFMEWFQ
Ga0070761_1069039223300005591SoilMNNLIAVEKIARWLKLKAMVLDSVPPPITKRVYNMALEEFL
Ga0070761_1071632423300005591SoilMNELIELDKIAQWQKLKALVLDSVSSPITKRVYNMALEEFYAWF*
Ga0068856_10058097813300005614Corn RhizosphereMPNNVPKMTDLIAIQKIAGWEKLKTLVLDSVSSPI
Ga0068859_10016322143300005617Switchgrass RhizosphereMNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALLARGEYP*
Ga0068863_10056376533300005841Switchgrass RhizosphereMTDLIEIQKIAGWEKLKALVLDSVSSPITKRVYKMA
Ga0070766_1086745523300005921SoilMNELIAVQKIAQWQKLKMLVLDSVSSPITKRVYNMALDEFYG
Ga0070766_1101501913300005921SoilMNAIAIEKIAQWEKLKALVLDSVSSPITKRVYNMALNEFM
Ga0080027_1047939523300005993Prmafrost SoilMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGWFQQ
Ga0075028_10027931733300006050WatershedsMNELIAVQKIAGWEKLKTLVLDSVSSPITKRVYNMAL
Ga0075029_10086862423300006052WatershedsMSDLIAIQKIAGWEKLKTMVLDSVSSPITKRVYNMALDEFL
Ga0075017_10034731913300006059WatershedsMTDLIAIQKIVGWEKLKTLVLDSVSSPITKRVYNMAL
Ga0075015_10050191423300006102WatershedsMNELIVVEKLAEWQRLKTLVLDSVSSPITKRVYNMALDEF
Ga0075015_10098648713300006102WatershedsMNDLMVVEKIAQWQTLKTLVLDSVSSPITKRVYNMA
Ga0070715_1038064213300006163Corn, Switchgrass And Miscanthus RhizosphereMTDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMA
Ga0075014_10007545653300006174WatershedsMNDLMVVEKIAQWQTLKTLVLDSVSSPITKRVYNM
Ga0097621_10000583743300006237Miscanthus RhizosphereVNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALLARGEYP*
Ga0097621_10145871813300006237Miscanthus RhizosphereMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFM
Ga0097621_10175347123300006237Miscanthus RhizosphereMNDLISLEKIAQWQKWKTLVIDSVSSPITKRVYNMALDEFMS*
Ga0075021_1088045723300006354WatershedsMNELISIEKVAQWQKLKTLVLDSVSSPITKRVYNMA
Ga0075021_1110689813300006354WatershedsVNDLIAVEKIAQWQKLKTLVLDSVPSPITKRVYNMALDEFMG
Ga0068871_10001236633300006358Miscanthus RhizosphereMNDLISLEKIAQWQRLKTLVLDSVSSPITKRIQHGA*
Ga0075430_10046387423300006846Populus RhizosphereMAPLMTNNRTKMNDLIAVKKLAEWDRLKALVLDSVSSPITRHVYNMAWL*
Ga0075431_10034562713300006847Populus RhizosphereVDDLIAVKKLAEWDRLKALVLDSVSSPITRLVYNMALNEFMNSY
Ga0099830_1052691533300009088Vadose Zone SoilMTDLIAVQRIAGWEKLKTLVLDSVSSPITKRVYNM
Ga0099827_1071649913300009090Vadose Zone SoilMNELIVVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFYNWFQ
Ga0105245_1194014913300009098Miscanthus RhizosphereMTELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMG
Ga0105245_1198466913300009098Miscanthus RhizosphereMTDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNMA
Ga0099792_1050533013300009143Vadose Zone SoilMTDLIAVQRIAGWEKLKTLVLDSVSSPITKRVYNMALDEFM
Ga0099792_1074643523300009143Vadose Zone SoilMNDLVVVQKIAGWEKLKALVLDSVSSPITKRVYNMALDEFCLAAGDAN*
Ga0105241_1010349133300009174Corn RhizosphereMNDLISLEKIAHLQKLKMLALDSRSSPTTKRVYSPILLD
Ga0105241_1125719313300009174Corn RhizosphereMTDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNMAL
Ga0105241_1220262913300009174Corn RhizosphereVNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEF
Ga0105242_1025016813300009176Miscanthus RhizosphereMADLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNMALDEFLAWVPAGNPAR
Ga0105242_1211601123300009176Miscanthus RhizosphereVNDLIAVEKIAQWQNLKTLVLDSVSSPITKRVYNMALLARGEYP*
Ga0105242_1250471313300009176Miscanthus RhizosphereMSDLIAVERIAQWQKLKTLVLDSVSSPITKRVYNMALDEFM
Ga0105248_1012084323300009177Switchgrass RhizosphereMNSLSILEKSTEWQRLKALVLDSVSSPLTRRVYSMALDEFVAWFQQSPRP
Ga0105248_1022210723300009177Switchgrass RhizosphereMNELISLEKIAQWQKLKTLVLNSVSSLITKRVYNMALD*
Ga0105248_1241941223300009177Switchgrass RhizosphereMNDLIAVKRLAEWQRMKALVLDSVSSPITRRVYNMALNEFMDW
Ga0105248_1257482613300009177Switchgrass RhizosphereMNELISLEKIAQWQKLKTLVLDSVSSPIPKRVYNMAL
Ga0105248_1285917223300009177Switchgrass RhizosphereMNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGWFQQ
Ga0105248_1288448623300009177Switchgrass RhizosphereMNDLMVVEKIAQWQKLKALVLDSVSSPITRRVYNMALD
Ga0116222_131411213300009521Peatlands SoilMNELTVVDKASEWRRMKALVLDSVSSPITKRVYNMALDEF
Ga0116218_113435523300009522Peatlands SoilLIVAEKIAQLQKLKMLVLDSVSSPITKRVYNMALDEFMAWFQ*
Ga0116218_156965723300009522Peatlands SoilMNELTVVDKASEWRRMKALVLDSVSSPITKRVYNMALDEFFSWYGR
Ga0116221_104179133300009523Peatlands SoilMTDLIVVEKIAEWQRLKALVLDSVSSPITRRVYNMALEEFITWFRQ
Ga0116220_1009992513300009525Peatlands SoilMNDLIVVEKIAHWEKLKALVLDSVSSPITKRVYNMALNEFLAW
Ga0105237_1012876733300009545Corn RhizosphereMNELIAIQKIAGLEKLKTLVLDRVSSPITKRVYNM
Ga0105238_1009150723300009551Corn RhizosphereMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVLQHGAG*
Ga0126370_1234952813300010358Tropical Forest SoilMSDLVVLEKPAEWDRLKQMVLDSVSSPITKRVYNMALDEFHGRF*
Ga0136449_10035011433300010379Peatlands SoilMTDLIAIQKIAGWEKLKTLVLDSVSSPIRKRVYNMALDEFLG
Ga0136449_10279446823300010379Peatlands SoilMNDLISLEKIAQWQKLKTRVLDSVSSRITKRVYNM
Ga0126383_1237920613300010398Tropical Forest SoilMNDLQVVEKLAEWQRLKALVLESVSSPLTRRAYNMALDEFMT*
Ga0134123_1048436813300010403Terrestrial SoilMNDLVLATKAADWYKLKALVLDSVSSPITRRVYNMALDEFMVWFRLEPR
Ga0105246_1069239423300011119Miscanthus RhizosphereMNALNVVEKLAEWQRLKSLVLDSVASPITRRVYNMALDE
Ga0137391_1064094933300011270Vadose Zone SoilMTDLIAVQKIAEWEKLKMLVLDSVSSPITKRVYNMALDE
Ga0137391_1073593323300011270Vadose Zone SoilMTDLIAVQKIAGWEKLKTLVLDSVSSPITKRVYNMA
Ga0137391_1107180633300011270Vadose Zone SoilMNDLISLEKIAQWQKLKALVLDRVSSPITKRVYNMALEEFMQWFQN
Ga0137391_1142256713300011270Vadose Zone SoilMNDLIVVEKIADWHRLKTLVLDSVSSPITRRVYNM
Ga0137393_1157959613300011271Vadose Zone SoilMTELIVVEKTAEWQRLKTLVLDSVSSPITRRVYNMALDE
Ga0137463_111933113300011444SoilMNDLVLAAKAADWYKLKTLVLDSVSSPITRRVYNM
Ga0137389_1153114213300012096Vadose Zone SoilMNDLIAVEKIAQWQKLKALVLDSVSSPITKRVYNMALNE
Ga0137388_1023081013300012189Vadose Zone SoilMNDLVVVQKIAGWEKLKALVLDSVSSPITKRVNNMALDEFL
Ga0137388_1137377913300012189Vadose Zone SoilMNDLIAVKKLAEWDKLKALVLDSVSSSITKRVYNMALNEFMNWYGL
Ga0137388_1190606013300012189Vadose Zone SoilMNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMAW
Ga0137386_1047028813300012351Vadose Zone SoilMNDLIAAKRLAEWERMKALVLDSVSSPITRRVCNMALNEFIDC
Ga0137360_1028649033300012361Vadose Zone SoilMNDLVLAEKAADWTRLKTLVLDSVSSPITRRVYNMALNE
Ga0137361_1084502423300012362Vadose Zone SoilMNDLIPVKKLAECDRLKALVLDSVSSPITKRVYNMA
Ga0137390_1053912623300012363Vadose Zone SoilMTDLITIQRIAGWEKLKTLVLDSVSSPITKRVYNMALDEFLGWF
Ga0137359_1017892423300012923Vadose Zone SoilMKWTGAFTDLIALEKLANWQKLKTLVLDSVSSPIT
Ga0137359_1051060313300012923Vadose Zone SoilMNDLIAVEKIAQCQKLKALVLDSVSSPITKRVYNMALNEFM
Ga0137359_1098489523300012923Vadose Zone SoilMNDLIVVEKIAGWEKLKALVLNSVSSPITKRVYNMALDEFLVWF
Ga0137407_1079173733300012930Vadose Zone SoilMTELTAIPKIAQWQKLKMLVLDSVSSPITKRVYNMALDEFYDWYQ
Ga0137407_1095479113300012930Vadose Zone SoilMNDLIAVKKLAEWDRLKTLVLDSVSSPITRRVYNIALNEFWRVWFSTK*
Ga0137407_1141664613300012930Vadose Zone SoilMTDLISLEEIAQWQKLKTLVLDSVSSPITERVCSGALCAR*
Ga0164300_1006377823300012951SoilMNHLVLAEKAAEWNFLKKLVLDSVSSPITRRVYNMALNEFLDWFR
Ga0157369_1163439813300013105Corn RhizosphereMNELISLEMIAQWQKLKMLVLDSISSPITKRVYNMPLDEFMGWFQQD
Ga0157374_1181154423300013296Miscanthus RhizosphereMMNDLIAVEKIAQWQKLKTLVLDSVPSPITKRVYNMALD
Ga0157374_1221011513300013296Miscanthus RhizosphereMNHLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALLARGEYP*
Ga0157374_1252214813300013296Miscanthus RhizosphereMNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGWFQLV
Ga0157378_1031108123300013297Miscanthus RhizosphereMNDLIAVEKIAQWQKLKMLVLDSVSSPITKRVYNMALDEFMGWFQQ
Ga0163162_1001066383300013306Switchgrass RhizosphereMNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGWF
Ga0163162_1345398113300013306Switchgrass RhizosphereMNDLMVVEKIAQWQKLKTLVLDSVSSPITRRVYNITLDEFLNWFQ
Ga0157375_10002131113300013308Miscanthus RhizosphereMTALISLEKIAQWQKLKTLVLDSVSSPITKRVYSMALDEFMGWFQ*
Ga0120132_101105723300013832PermafrostMNDLVVLDKIAHWQKLKGMVLDSVSSPITKRVYNMALNEFMN
Ga0181527_120363823300014153BogMTDLIAVQKIAGWEKLKTLVLDSVSSPITKRVYNMALDEFLAWF
Ga0181521_1007552713300014158BogMTDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNMALDEFLGW
Ga0182010_1001805443300014490FenVSPEADLIVLPQTNQWQKLKTLVLDSVSSPITKRVYNHALDEFFA
Ga0182024_1079802933300014501PermafrostLVVVEKIAQWQRLKSLVLDSVSSPITKRVYNMALDEFMAW
Ga0157377_1108715713300014745Miscanthus RhizosphereMNDLISLEKIAQWQKLKMLVLDSISSPITKRVYNMPLDEFMGWFQQ
Ga0182030_1150038323300014838BogMNDLIAVQKIARWEKLKAMVLDSVSSPITKRVYNMALEEFLAW
Ga0157376_1002790513300014969Miscanthus RhizosphereMNDLISLEEIAQWQKLKTLVLDSVSSPITKRVYNMAL
Ga0157376_1102365823300014969Miscanthus RhizosphereVNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGWF
Ga0157376_1167624223300014969Miscanthus RhizosphereMTDLIAIQKTAGWEKLKTLVLDSVSSPITKRVYNMALD
Ga0182033_1211446513300016319SoilMRRAFPMNPLVPAEKLSQWRRLKTLVLDSVSSPTTRRMYNMALEEFIG
Ga0187812_112917013300017821Freshwater SedimentMNDLIVAEKIAQWQKLKALVLDSVSSPITKRVYSM
Ga0187801_1012051623300017933Freshwater SedimentMNDLIVAEKIAQWQKLKSLVLDSVSSPITKRVYNMALDEFIDWFR
Ga0187808_1012458513300017942Freshwater SedimentMNDLIVAEKIAQWQKLKALVLDSVSSPTTKRVYNMALDEFMAWFQL
Ga0187808_1041485813300017942Freshwater SedimentMNDLIVAEKPAEWQRLKALVLDSVSSPITRRVYNMALDEFMAGY
Ga0187808_1051960823300017942Freshwater SedimentMNDLIVAEKIAQWQKLKALVLDSVSSPITRRVYNMALDEFMEW
Ga0187817_1074991923300017955Freshwater SedimentMNDLIAVEKIAGWTKLKALVLDSVSSPITKRVYNMAL
Ga0187783_1053247113300017970Tropical PeatlandMNALTVVERPAQWDRLKQIVLDSVSSPITKRVYNKALDEFLVWFRQA
Ga0187781_1023396013300017972Tropical PeatlandMNEIAVIKRTAEWQRLKPLVLDSVSSPITKRVYNMALDEF
Ga0187780_1141736613300017973Tropical PeatlandMNDLVVVEKPAQWDRLKALVLDSVSSPITKRVYNMA
Ga0187815_1018533223300018001Freshwater SedimentMTDLIVAEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFM
Ga0187804_1003344413300018006Freshwater SedimentMHDLIAVERIAQWEKLKTLVLDSVSSPITKRVYNMALNEFMA
Ga0187805_1006940833300018007Freshwater SedimentMHDLIAVERIAQWKKLKTLVLDSVSSPITKRVYNMA
Ga0187805_1052948623300018007Freshwater SedimentMNDLIAVEKIAQWQKLKMLVLDSVSSPITKRVYNM
Ga0187888_124033313300018008PeatlandMTDLIVVPQMNQWQKLKALVLDSVSSPITKRVYNHSL
Ga0187810_1013408023300018012Freshwater SedimentMNDLIVAEKIAQWQKLKALVLDSVSSPITKRLYSMALDEFLAWFR
Ga0187810_1032124423300018012Freshwater SedimentMNDLIVAEKIAQWQKLKALVLDSVSSPITKRVYSMALD
Ga0187871_1081791213300018042PeatlandMTDLIVVPQINQWHKLKTLVLDSVSSPITRRVYNLGLDEFFAW
Ga0187766_1126059313300018058Tropical PeatlandMNDLIVAKNIANWQRLKALVLDSVSSPITKRVYSMALDEFLAWFR
Ga0187784_1039082713300018062Tropical PeatlandMNDLVVVEQPAHWSRLKQLVLDSVSSPITKRVYNMAL
Ga0187784_1064440413300018062Tropical PeatlandMNDLMVVEKPAEWDRLKALMLDSVSSPITKRVYSMALD
Ga0182025_129665013300019786PermafrostMNDLIAMEKIAHWQKLKGMVLDSVSSPITKRVLQYGA
Ga0210407_1059643723300020579SoilMNDLVVVEKIAQWQKLKALVLDSVSSPITKRVYNMALDEFLLWFQ
Ga0210403_1095840123300020580SoilMNDLIVVEKIAQWQRLKALVLDSVSSPITKRVYNMALDEF
Ga0210399_1101333833300020581SoilMNDLIVVEKIAGWEKLKALVLDSVSSPITKRVYNMALDEFLAW
Ga0210406_1052713923300021168SoilMNDLVVLEKIAQWEKLKALVLDSVSSPITKRVYNMALNEFMASF
Ga0210406_1090493423300021168SoilMNELIAVEKIAQWQKLKALVLDSVSSPITKRVYNMAL
Ga0210396_1142266313300021180SoilMPNNEDKMNDLIVVQKIAGWEKLKALVLDSVSSPITKRVYNMALNE
Ga0210388_1076162613300021181SoilMHDLIAVERIAQWEKLKTLVLDSVSSPITKRVYNMAL
Ga0210393_1050812513300021401SoilMNDLVVIEKIAQWEKLKMLVLDSVSSPITKRVYNM
Ga0210397_1160533413300021403SoilMNDLVAIEKIAQWEKLKTLVLDSVSSPITKRVYNMALNE
Ga0210387_1156466623300021405SoilMNDLIVIEKIAQWEKLKMLVLDSVSSPITKRVYNMALNEF
Ga0210394_1062034413300021420SoilMNELIAVQKIAGWEKLKALVLDSVSSPITRRVYNMALNEFL
Ga0210391_1095430013300021433SoilMNDLAVVEKPAQWEKLKAMVLDSVSSPITKRVYNMALNEFM
Ga0210391_1115914213300021433SoilMNELTIARRTAEWQRLKPLVLDSVSSPITKRVYNMALDEFF
Ga0182009_1084996423300021445SoilVNDLIAVERIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMG
Ga0210390_1136798323300021474SoilVNDLIVVEKNAQWRRLKTLVLDSVSSPITKRVYNMALDEFYNWFQ
Ga0210402_1035878913300021478SoilLVVVEKIAGWEKLKALVLDSVSSPITKRVYNMALDEFLV
Ga0210402_1036821933300021478SoilMNDLIAIEKIAQREKLKALVLDSVSSPITKRVYNMG
Ga0210409_1010116113300021559SoilMNDLMLVEKLAHWEKLKALVLDSVSSPITKRVYNMALNE
Ga0224547_104880533300023255SoilMNELVAIEKIAQWEKLKALVLDSVSSPITKRVYNMALNEFMAWF
Ga0247667_103455913300024290SoilMTELIVVEKIAEWQRLKALVLDSVSSPITRRVYNMALDEFIN
Ga0247668_105176523300024331SoilMTELIVVEKIAEWQRLKALVLDSVSSPITRRVYNMALDEFINWYKQA
Ga0208820_101508843300025576PeatlandMNDLIVVPQTNHWHKLKALVLDSVSSPITKRVYNL
Ga0207654_1013476133300025911Corn RhizosphereMNDLISLEKIAQWQKWKTLVIDSVSSPITKRVYNMALDEFMS
Ga0207707_1003272413300025912Corn RhizosphereMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVLQHGAG
Ga0207707_1142119313300025912Corn RhizosphereMNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNM
Ga0207671_1102271223300025914Corn RhizosphereMTDLIAIQKIAGWEKLKTLVLDSFSSPITKRVYNMALDEFL
Ga0207649_1153302623300025920Corn RhizosphereMTDLIEIQKIAGWEKLKALVLDSVSSPITKRVYNMA
Ga0207694_1022870523300025924Corn RhizosphereMNELISLEKIAQWQKLKTLVLDSVSSPLTKRVYNMALD
Ga0207686_1179404213300025934Miscanthus RhizosphereMSDLIAVERIAQWQKLKTLVLDSVSSPITKRVYNMALDEF
Ga0207669_1052738023300025937Miscanthus RhizosphereMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFIS
Ga0207711_1014661723300025941Switchgrass RhizosphereMNELISLEKIAQWQKLKTLVLNSVSSLITKRVYNMALD
Ga0207689_1004839333300025942Miscanthus RhizosphereMTDLIVIQKIAGWEKLKTLVLDSVSSPITKRVYNMALDEFLSWFQ
Ga0207661_1019644733300025944Corn RhizosphereMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFI
Ga0207661_1132135213300025944Corn RhizosphereMNELISLEKIAQWQQLKTLVLDSVSSPITKRVYNMALDEFMGWFQQA
Ga0207667_1013933613300025949Corn RhizosphereMTDLIAIQKISGWEKLKTLVLDSVSSPITKRVYNMALD
Ga0207667_1037983513300025949Corn RhizosphereMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALD
Ga0207667_1039537523300025949Corn RhizosphereMNDLITLEKIAQWQKLKTLVLDSVSSPITKRVYTMALDEFMGWFQQA
Ga0207667_1125753713300025949Corn RhizosphereMNELISLEKIAQWQKVKTLVLDSVSSPITKRVYNMALD
Ga0207677_1013267533300026023Miscanthus RhizosphereMNDLISLEKIAQWQRLKTLVLDSVSSPITKRVYNMALDEFMGW
Ga0207677_1016242823300026023Miscanthus RhizosphereMNDLISLEKIAQWQRLKTLVLDSVSSPITKRIQHGA
Ga0207703_1188008913300026035Switchgrass RhizosphereMNDLMVVEKIAQWQRLKTLVLDSVSSPITRRVYNMALDEFLHWFQQ
Ga0207639_1026959423300026041Corn RhizosphereMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGW
Ga0207702_1111222313300026078Corn RhizosphereMNDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNM
Ga0207675_10231206813300026118Switchgrass RhizosphereMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYSMALDEF
Ga0208043_109299513300027570Peatlands SoilMNDLIVAEKIAQWQKLKMLVLDSVSSPITKRVYNMALDE
Ga0208324_111131523300027604Peatlands SoilMNDLIVAEKIAQWQKLKMLVLDSVSSPITKRVYNMALDEFMAWFQ
Ga0208827_111452113300027641Peatlands SoilMNDLIVVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFYLWFQQE
Ga0209009_107363623300027667Forest SoilMNDLIVVEKIAQWQKLKALVLDSVSSPITRRVYNMALDES
Ga0209415_1035538913300027905Peatlands SoilMNDLIVVEKIAQWQRLKALVLDSVSSRITKRVYSM
Ga0209415_1083430213300027905Peatlands SoilMNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNM
Ga0209006_1066450313300027908Forest SoilMLELTVLDNAKKWQKLKTLVLDSVSSPITRGIYNMALDEFVVW
Ga0268266_1168459913300028379Switchgrass RhizosphereMNALNVVEKLAEWQRLKSLVLDSVASPITRRVYNM
Ga0268264_1000607633300028381Switchgrass RhizosphereVNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALLARGEYP
Ga0311327_1088422513300029883BogMTDLIAIQKIAEWEKLKTLVLDSVSSPITKRVYNMALD
Ga0311369_1085856233300029910PalsaMTDLIAVQKIAGWEKLKALVLDSVSSPITKRVYNMALNEF
Ga0311363_1151987513300029922FenMTEIIAVERVEKEAVWLRLKTMVLDSVSSPITRRVYNMALDEFIGWFHQGGHAGFTK
Ga0311340_1096711723300029943PalsaMGLPKASDWRRMKSLVLDSVSSPITKRVYNMALDEFFSWYAQ
Ga0311342_1018692823300029955BogMTEIIAVERVEKEAVWLRLKTMVLDSVSSPITRRVYNMALDEFIGWFHQGGHAGF
Ga0311338_1060184623300030007PalsaMNQLIVVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFYAWFQQG
Ga0302176_1026289813300030057PalsaMNELTVVDKATEWRRMKSLVLDSVSSPITKRVYNMALDE
Ga0170824_11918270323300031231Forest SoilMNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALNEFMGWFQQ
Ga0302325_1061268813300031234PalsaMNDLIAVEKIAQWQKLKTLVLDGVSSPITKRVYNMALDAFY
Ga0302325_1132502513300031234PalsaMNELTVVDKATEWRRMKSLVLDSVRSPITKRVYNMALDEFFG
Ga0302325_1133277113300031234PalsaMNELTVVSKTAEWQRLKTLVLDSVSSLITRRVYNMAL
Ga0302325_1157653313300031234PalsaMSKLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALEEFYAWF
Ga0302325_1308940613300031234PalsaMNDLIVVEKIAQWRRLKALVLDSVSSPITKRVYNMALDEFMAWF
Ga0302325_1321626423300031234PalsaMNDLIPVEKIAGRHKLKAMVLDSVSSPITKRVGSGCT
Ga0302324_10239532413300031236PalsaMNDLMAVQKIERWEKVKALVLDSVSSPITKRVYNMALNE
Ga0302326_1183474823300031525PalsaMTEIIAVERVEKEAVWLRLKTMVLDSVSSPITRRVYNMALDEFIGWFHQGGHS
Ga0310686_10430272423300031708SoilPIMPNNREQKDPKMDDLIAGERIAGWEKLKALALDSVSSPITKRVYNRRWRRRAW
Ga0310686_10609790213300031708SoilMKDLISLEKIAQWQKLKTLVLDSVSSPITKRVHNTALKSGRSSW
Ga0310686_11255620723300031708SoilMNELIAIEKIAQWEKLKTLVLDSVSSPITKRVYNMA
Ga0310686_11984064813300031708SoilMNDLIVVEKIAQWQRLKSLVLDSVSSPITKRVYNMALDEFMAWFRL
Ga0307475_1093389223300031754Hardwood Forest SoilMNDLVVVEKPAQWERLKALVLDSVSSPITKRVYNMALD
Ga0311301_1028071313300032160Peatlands SoilVNDLIVVEKIAQWKRLKTLVLDSVSSPITKRVYNMA
Ga0311301_1077926823300032160Peatlands SoilMTDLIVVPQTNQWHKLKTLVLDSVSSPITRRVYNL
Ga0311301_1195024013300032160Peatlands SoilMNDLIVAEKIAQWQKLKSLVLDSVSSPITRRVYNMALDK
Ga0335079_1007728213300032783SoilMAEKLAEWQRLKALVLDSVSSPITRRVYNMALDEFIEWY
Ga0335079_1193114813300032783SoilMNDLIVLEKIEQWQKLKALVLDSVSSPITKRVYNMALDEFL
Ga0335078_1115148313300032805SoilMNELTIVRRTAEWQRLKPLVLDSVSSPITKRVYNMALEEFFSWYDQE
Ga0335070_1198898223300032829SoilMNDLIVAEKIAQWQRLKALVLDSVSSPITKRVYSMALDEFLAWFRQEP
Ga0335081_1203388813300032892SoilMNDLIVLEKIEQWQKLKALVLDSVSSPITKRVYNMALDEFLA
Ga0335081_1229571023300032892SoilMNDLTIVRRTAEWQRLKHLVLDSVSSPITKRVYNMALDEF
Ga0335077_1205590413300033158SoilMTDLIAVERIAQWEKLKALVLDSVSSPITKRVYNMALN
Ga0326728_1004919033300033402Peat SoilMNDLAVVEKTTEWQRLTTLVLDSVSSPITKRVYNMALNEFFA
Ga0310810_1023205753300033412SoilMNDLTTLEKIAQWQKLKTLVLDSVSSPITKRVYNMALD
Ga0316628_10045686713300033513SoilMNELAVVDKRTEWQRMKSLVLDSVSSPITKRVYNMALDEFFSWYVRE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.