Metagenome Family F021437

Basic Information
Family ID	F021437
Family Type	Metagenome
Number of Sequences	219
Average Sequence Length	50 residues
Representative Sequence	RRELVTSEPGLQGILDFLSESIPEAKAAKPAQFFDDRFVRQVNSGK
Number of Associated Samples	187
Number of Associated Scaffolds	219

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	3.65 %
% of genes near scaffold ends (potentially truncated)	94.06 %
% of genes from short scaffolds (< 2000 bps)	87.67 %
Associated GOLD sequencing projects	179
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Most Common Taxonomy
Group	Bacteria (96.804 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.132 % of family members)
Environment Ontology (ENVO)	Unclassified (30.594 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (33.790 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.54% β-sheet: 0.00% Coil/Unstructured: 59.46%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 219 Family Scaffolds
PF04909	Amidohydro_2	33.79
PF01799	Fer2_2	7.76
PF09084	NMT1	5.94
PF13883	Pyrid_oxidase_2	3.65
PF00111	Fer2	2.74
PF16868	NMT1_3	2.28
PF02738	MoCoBD_1	2.28
PF00903	Glyoxalase	1.37
PF13620	CarboxypepD_reg	1.37
PF12681	Glyoxalase_2	1.37
PF01243	Putative_PNPOx	0.91
PF00011	HSP20	0.91
PF01797	Y1_Tnp	0.91
PF02604	PhdYeFM_antitox	0.46
PF04392	ABC_sub_bind	0.46
PF03795	YCII	0.46
PF04055	Radical_SAM	0.46
PF05977	MFS_3	0.46
PF05598	DUF772	0.46
PF04542	Sigma70_r2	0.46
PF04480	DUF559	0.46
PF00890	FAD_binding_2	0.46
PF01471	PG_binding_1	0.46
PF03235	DUF262	0.46
PF01408	GFO_IDH_MocA	0.46
PF00701	DHDPS	0.46
PF01053	Cys_Met_Meta_PP	0.46
PF01613	Flavin_Reduct	0.46
PF13531	SBP_bac_11	0.46
PF00171	Aldedh	0.46
PF03928	HbpS-like	0.46
PF02899	Phage_int_SAM_1	0.46
PF03466	LysR_substrate	0.46

COG ID	Name	Functional Category	% Frequency in 219 Family Scaffolds
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	5.94
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	5.94
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.91
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	0.91
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.91
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.46
COG0075	Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG	Amino acid transport and metabolism [E]	0.46
COG0156	7-keto-8-aminopelargonate synthetase or related enzyme	Coenzyme transport and metabolism [H]	0.46
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	0.46
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	0.46
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	0.46
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.46
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	0.46
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.46
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.46
COG1479	DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains	Defense mechanisms [V]	0.46
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.46
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	0.46
COG1921	Seryl-tRNA(Sec) selenium transferase	Translation, ribosomal structure and biogenesis [J]	0.46
COG1982	Arginine/lysine/ornithine decarboxylase	Amino acid transport and metabolism [E]	0.46
COG2008	Threonine aldolase	Amino acid transport and metabolism [E]	0.46
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	0.46
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.46
COG2814	Predicted arabinose efflux permease AraJ, MFS family	Carbohydrate transport and metabolism [G]	0.46
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	0.46
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.46
COG4100	Cystathionine beta-lyase family protein involved in aluminum resistance	Inorganic ion transport and metabolism [P]	0.46
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	0.46
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.46
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.46
COG4973	Site-specific recombinase XerC	Replication, recombination and repair [L]	0.46
COG4974	Site-specific recombinase XerD	Replication, recombination and repair [L]	0.46

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.80 %
Unclassified	root	N/A	3.20 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.80 %
Unclassified	root	N/A	3.20 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.80 %
Unclassified	root	N/A	3.20 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	53.42 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	7.31 %
Unclassified	root	N/A	3.20 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.46 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.46 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	45.66 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	7.31 %
Unclassified	root	N/A	3.20 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.28 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.46 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.46 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.46 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	45.66 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	7.31 %
Unclassified	root	N/A	3.20 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.46 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.46 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.46 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.46 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	44.29 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	7.31 %
Unclassified	root	N/A	3.20 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.91 %
Chloroflexi bacterium HGW-Chloroflexi-8	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-8	0.46 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.46 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.46 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.46 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	44.29 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	7.31 %
Unclassified	root	N/A	3.20 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.91 %
Comamonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas	0.46 %
Chloroflexi bacterium HGW-Chloroflexi-8	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-8	0.46 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.46 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.46 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	44.29 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	7.31 %
Unclassified	root	N/A	3.20 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.91 %
Comamonas kerstersii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas kerstersii	0.46 %
Chloroflexi bacterium HGW-Chloroflexi-8	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-8	0.46 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.46 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.46 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000559\|F14TC_102659622	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-8	864	Open in IMG/M
3300000574\|JGI1357J11328_10164632	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	618	Open in IMG/M
3300000793\|AF_2010_repII_A001DRAFT_10053288	All Organisms → cellular organisms → Bacteria	900	Open in IMG/M
3300000793\|AF_2010_repII_A001DRAFT_10134280	All Organisms → cellular organisms → Bacteria → Proteobacteria	515	Open in IMG/M
3300000890\|JGI11643J12802_10598927	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	630	Open in IMG/M
3300000953\|JGI11615J12901_10393959	All Organisms → cellular organisms → Bacteria	559	Open in IMG/M
3300001139\|JGI10220J13317_11883588	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	501	Open in IMG/M
3300001431\|F14TB_106112781	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	850	Open in IMG/M
3300002124\|C687J26631_10028487	All Organisms → cellular organisms → Bacteria	1982	Open in IMG/M
3300003996\|Ga0055467_10084755	All Organisms → cellular organisms → Bacteria	879	Open in IMG/M
3300003998\|Ga0055472_10131682	All Organisms → cellular organisms → Bacteria	729	Open in IMG/M
3300004114\|Ga0062593_101122721	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	818	Open in IMG/M
3300004267\|Ga0066396_10003963	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1522	Open in IMG/M
3300004633\|Ga0066395_10618937	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	636	Open in IMG/M
3300004778\|Ga0062383_10749114	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	501	Open in IMG/M
3300004808\|Ga0062381_10049321	All Organisms → cellular organisms → Bacteria	1190	Open in IMG/M
3300005168\|Ga0066809_10087114	All Organisms → cellular organisms → Bacteria	748	Open in IMG/M
3300005169\|Ga0066810_10122852	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	596	Open in IMG/M
3300005179\|Ga0066684_10890145	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	582	Open in IMG/M
3300005181\|Ga0066678_10626222	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	716	Open in IMG/M
3300005332\|Ga0066388_100681168	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1638	Open in IMG/M
3300005347\|Ga0070668_100186235	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1698	Open in IMG/M
3300005355\|Ga0070671_100236813	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1549	Open in IMG/M
3300005366\|Ga0070659_101001636	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	733	Open in IMG/M
3300005435\|Ga0070714_101815182	Not Available	595	Open in IMG/M
3300005444\|Ga0070694_101171221	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300005446\|Ga0066686_10239525	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1223	Open in IMG/M
3300005446\|Ga0066686_10806337	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	624	Open in IMG/M
3300005451\|Ga0066681_10321565	All Organisms → cellular organisms → Bacteria	948	Open in IMG/M
3300005518\|Ga0070699_100531427	All Organisms → cellular organisms → Bacteria → Proteobacteria	1070	Open in IMG/M
3300005545\|Ga0070695_101801792	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	513	Open in IMG/M
3300005552\|Ga0066701_10715016	All Organisms → cellular organisms → Bacteria	601	Open in IMG/M
3300005561\|Ga0066699_10955122	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	596	Open in IMG/M
3300005578\|Ga0068854_100861626	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	794	Open in IMG/M
3300005586\|Ga0066691_10153019	All Organisms → cellular organisms → Bacteria	1328	Open in IMG/M
3300005713\|Ga0066905_101609300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	594	Open in IMG/M
3300005764\|Ga0066903_105216859	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	687	Open in IMG/M
3300005764\|Ga0066903_107746739	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300005895\|Ga0075277_1005983	All Organisms → cellular organisms → Bacteria → Proteobacteria	1518	Open in IMG/M
3300005895\|Ga0075277_1061352	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	597	Open in IMG/M
3300005981\|Ga0081538_10024736	All Organisms → cellular organisms → Bacteria	4267	Open in IMG/M
3300006058\|Ga0075432_10611342	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300006794\|Ga0066658_10906047	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	508	Open in IMG/M
3300006794\|Ga0066658_10915999	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	506	Open in IMG/M
3300006845\|Ga0075421_100135508	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3084	Open in IMG/M
3300006846\|Ga0075430_100672057	All Organisms → cellular organisms → Bacteria	854	Open in IMG/M
3300006847\|Ga0075431_100705191	All Organisms → cellular organisms → Bacteria	987	Open in IMG/M
3300006847\|Ga0075431_101799184	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300006852\|Ga0075433_10223619	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1672	Open in IMG/M
3300006852\|Ga0075433_10979610	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	737	Open in IMG/M
3300006853\|Ga0075420_101142026	All Organisms → cellular organisms → Bacteria → Proteobacteria	670	Open in IMG/M
3300006854\|Ga0075425_100049142	All Organisms → cellular organisms → Bacteria	4723	Open in IMG/M
3300006871\|Ga0075434_100142234	All Organisms → cellular organisms → Bacteria	2419	Open in IMG/M
3300006871\|Ga0075434_100187341	All Organisms → cellular organisms → Bacteria → Proteobacteria	2090	Open in IMG/M
3300006954\|Ga0079219_11379525	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	628	Open in IMG/M
3300006969\|Ga0075419_10749952	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	695	Open in IMG/M
3300007076\|Ga0075435_100926128	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	760	Open in IMG/M
3300009012\|Ga0066710_102809694	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	688	Open in IMG/M
3300009053\|Ga0105095_10227446	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1023	Open in IMG/M
3300009094\|Ga0111539_10703662	All Organisms → cellular organisms → Bacteria	1176	Open in IMG/M
3300009111\|Ga0115026_10766389	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	751	Open in IMG/M
3300009137\|Ga0066709_100820217	All Organisms → cellular organisms → Bacteria	1349	Open in IMG/M
3300009157\|Ga0105092_10957639	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	508	Open in IMG/M
3300009162\|Ga0075423_10138900	All Organisms → cellular organisms → Bacteria	2551	Open in IMG/M
3300009162\|Ga0075423_12569985	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300009167\|Ga0113563_13575145	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	526	Open in IMG/M
3300009174\|Ga0105241_10054319	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3066	Open in IMG/M
3300009174\|Ga0105241_10120810	All Organisms → cellular organisms → Bacteria → Proteobacteria	2110	Open in IMG/M
3300009597\|Ga0105259_1093559	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	707	Open in IMG/M
3300009609\|Ga0105347_1026632	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2005	Open in IMG/M
3300009609\|Ga0105347_1212448	All Organisms → cellular organisms → Bacteria	782	Open in IMG/M
3300009610\|Ga0105340_1246381	All Organisms → cellular organisms → Bacteria	765	Open in IMG/M
3300009818\|Ga0105072_1002195	All Organisms → cellular organisms → Bacteria	3048	Open in IMG/M
3300009837\|Ga0105058_1023780	All Organisms → cellular organisms → Bacteria	1299	Open in IMG/M
3300010043\|Ga0126380_11488443	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	599	Open in IMG/M
3300010047\|Ga0126382_10020160	All Organisms → cellular organisms → Bacteria	3452	Open in IMG/M
3300010048\|Ga0126373_11270236	Not Available	802	Open in IMG/M
3300010329\|Ga0134111_10024064	All Organisms → cellular organisms → Bacteria	2076	Open in IMG/M
3300010360\|Ga0126372_10009780	All Organisms → cellular organisms → Bacteria	5037	Open in IMG/M
3300010360\|Ga0126372_10038438	All Organisms → cellular organisms → Bacteria	3104	Open in IMG/M
3300010360\|Ga0126372_10934498	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	873	Open in IMG/M
3300010371\|Ga0134125_12024929	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	626	Open in IMG/M
3300010398\|Ga0126383_10497254	All Organisms → cellular organisms → Bacteria	1277	Open in IMG/M
3300010400\|Ga0134122_11741042	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	653	Open in IMG/M
3300010400\|Ga0134122_11927834	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	627	Open in IMG/M
3300010401\|Ga0134121_12362366	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	571	Open in IMG/M
3300010403\|Ga0134123_11494281	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	719	Open in IMG/M
3300011398\|Ga0137348_1052995	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	691	Open in IMG/M
3300011423\|Ga0137436_1100362	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	763	Open in IMG/M
3300011429\|Ga0137455_1234989	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	542	Open in IMG/M
3300011434\|Ga0137464_1168086	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	666	Open in IMG/M
3300012038\|Ga0137431_1136433	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	698	Open in IMG/M
3300012041\|Ga0137430_1040650	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1245	Open in IMG/M
3300012041\|Ga0137430_1052290	All Organisms → cellular organisms → Bacteria	1109	Open in IMG/M
3300012143\|Ga0137354_1075326	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	536	Open in IMG/M
3300012168\|Ga0137357_1092793	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	621	Open in IMG/M
3300012202\|Ga0137363_10950223	All Organisms → cellular organisms → Bacteria	730	Open in IMG/M
3300012208\|Ga0137376_11203314	All Organisms → cellular organisms → Bacteria → Proteobacteria	647	Open in IMG/M
3300012208\|Ga0137376_11243996	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	634	Open in IMG/M
3300012231\|Ga0137465_1260306	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	511	Open in IMG/M
3300012349\|Ga0137387_10735704	All Organisms → cellular organisms → Bacteria → Proteobacteria	714	Open in IMG/M
3300012354\|Ga0137366_10228667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1383	Open in IMG/M
3300012360\|Ga0137375_10899566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas kerstersii	703	Open in IMG/M
3300012469\|Ga0150984_107443402	All Organisms → cellular organisms → Bacteria	1232	Open in IMG/M
3300012582\|Ga0137358_10717642	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	668	Open in IMG/M
3300012906\|Ga0157295_10328082	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	545	Open in IMG/M
3300012911\|Ga0157301_10464661	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	505	Open in IMG/M
3300012918\|Ga0137396_10190875	All Organisms → cellular organisms → Bacteria	1504	Open in IMG/M
3300012922\|Ga0137394_10712487	All Organisms → cellular organisms → Bacteria	844	Open in IMG/M
3300012930\|Ga0137407_10712775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	945	Open in IMG/M
3300012951\|Ga0164300_10122646	All Organisms → cellular organisms → Bacteria	1177	Open in IMG/M
3300012960\|Ga0164301_10489164	All Organisms → cellular organisms → Bacteria	885	Open in IMG/M
3300012972\|Ga0134077_10054451	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1482	Open in IMG/M
3300012985\|Ga0164308_11221725	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	679	Open in IMG/M
3300013306\|Ga0163162_10993960	All Organisms → cellular organisms → Bacteria	948	Open in IMG/M
3300013308\|Ga0157375_12515744	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	615	Open in IMG/M
3300013308\|Ga0157375_13037834	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	560	Open in IMG/M
3300014270\|Ga0075325_1030510	All Organisms → cellular organisms → Bacteria	1066	Open in IMG/M
3300014270\|Ga0075325_1069074	All Organisms → cellular organisms → Bacteria	784	Open in IMG/M
3300014295\|Ga0075305_1082823	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	628	Open in IMG/M
3300014298\|Ga0075341_1132142	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	518	Open in IMG/M
3300014307\|Ga0075304_1131124	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	591	Open in IMG/M
3300014324\|Ga0075352_1210256	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	580	Open in IMG/M
3300014745\|Ga0157377_11157120	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	596	Open in IMG/M
3300014882\|Ga0180069_1009191	All Organisms → cellular organisms → Bacteria	1995	Open in IMG/M
3300014884\|Ga0180104_1182077	All Organisms → cellular organisms → Bacteria	627	Open in IMG/M
3300015200\|Ga0173480_10684301	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	641	Open in IMG/M
3300015258\|Ga0180093_1068961	All Organisms → cellular organisms → Bacteria → Proteobacteria	826	Open in IMG/M
3300015371\|Ga0132258_11016850	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2095	Open in IMG/M
3300015372\|Ga0132256_101199555	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	872	Open in IMG/M
3300015372\|Ga0132256_102514456	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	616	Open in IMG/M
3300015373\|Ga0132257_101920218	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	762	Open in IMG/M
3300015373\|Ga0132257_102223899	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	710	Open in IMG/M
3300015374\|Ga0132255_100894469	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1327	Open in IMG/M
3300015374\|Ga0132255_102455174	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	796	Open in IMG/M
3300015374\|Ga0132255_103789576	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	642	Open in IMG/M
3300017966\|Ga0187776_10546894	All Organisms → cellular organisms → Bacteria	799	Open in IMG/M
3300018000\|Ga0184604_10336651	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	536	Open in IMG/M
3300018053\|Ga0184626_10199649	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	847	Open in IMG/M
3300018068\|Ga0184636_1286004	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	581	Open in IMG/M
3300018074\|Ga0184640_10064189	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1543	Open in IMG/M
3300018075\|Ga0184632_10099204	All Organisms → cellular organisms → Bacteria → Proteobacteria	1276	Open in IMG/M
3300018075\|Ga0184632_10283011	All Organisms → cellular organisms → Bacteria	720	Open in IMG/M
3300018078\|Ga0184612_10025019	All Organisms → cellular organisms → Bacteria	3074	Open in IMG/M
3300018079\|Ga0184627_10279125	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	877	Open in IMG/M
3300018082\|Ga0184639_10043368	All Organisms → cellular organisms → Bacteria	2314	Open in IMG/M
3300018082\|Ga0184639_10153709	All Organisms → cellular organisms → Bacteria	1222	Open in IMG/M
3300018422\|Ga0190265_10446666	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1399	Open in IMG/M
3300018429\|Ga0190272_11697112	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	653	Open in IMG/M
3300018469\|Ga0190270_10389463	All Organisms → cellular organisms → Bacteria	1285	Open in IMG/M
3300018476\|Ga0190274_11542783	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	756	Open in IMG/M
3300018481\|Ga0190271_12209080	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	656	Open in IMG/M
3300018481\|Ga0190271_12768524	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	589	Open in IMG/M
3300018481\|Ga0190271_13800068	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	505	Open in IMG/M
3300019789\|Ga0137408_1485888	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	4852	Open in IMG/M
3300020003\|Ga0193739_1056782	All Organisms → cellular organisms → Bacteria	1004	Open in IMG/M
3300020004\|Ga0193755_1175115	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	633	Open in IMG/M
3300020010\|Ga0193749_1015141	All Organisms → cellular organisms → Bacteria	1508	Open in IMG/M
3300020200\|Ga0194121_10090386	All Organisms → cellular organisms → Bacteria	2027	Open in IMG/M
3300021073\|Ga0210378_10216819	All Organisms → cellular organisms → Bacteria	728	Open in IMG/M
3300021080\|Ga0210382_10140973	All Organisms → cellular organisms → Bacteria	1028	Open in IMG/M
3300022208\|Ga0224495_10225601	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	774	Open in IMG/M
3300025310\|Ga0209172_10460024	Not Available	593	Open in IMG/M
3300025791\|Ga0210115_1034683	All Organisms → cellular organisms → Bacteria	1105	Open in IMG/M
3300025916\|Ga0207663_11065240	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	649	Open in IMG/M
3300025926\|Ga0207659_11140577	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	670	Open in IMG/M
3300025930\|Ga0207701_10005740	All Organisms → cellular organisms → Bacteria	12431	Open in IMG/M
3300025930\|Ga0207701_10055959	All Organisms → cellular organisms → Bacteria	3612	Open in IMG/M
3300025932\|Ga0207690_11578015	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300025933\|Ga0207706_11055776	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	680	Open in IMG/M
3300025961\|Ga0207712_11373310	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	632	Open in IMG/M
3300026005\|Ga0208285_1016341	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	593	Open in IMG/M
3300026035\|Ga0207703_12078128	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300026121\|Ga0207683_11080446	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	744	Open in IMG/M
3300026296\|Ga0209235_1229115	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	592	Open in IMG/M
3300026313\|Ga0209761_1191612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	912	Open in IMG/M
3300026320\|Ga0209131_1377561	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	528	Open in IMG/M
3300027056\|Ga0209879_1015994	All Organisms → cellular organisms → Bacteria	1235	Open in IMG/M
3300027364\|Ga0209967_1047054	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	660	Open in IMG/M
3300027513\|Ga0208685_1108658	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	595	Open in IMG/M
3300027654\|Ga0209799_1154211	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	523	Open in IMG/M
3300027695\|Ga0209966_1046602	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300027775\|Ga0209177_10062260	All Organisms → cellular organisms → Bacteria	1091	Open in IMG/M
3300027818\|Ga0209706_10302919	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	757	Open in IMG/M
3300027831\|Ga0209797_10014061	All Organisms → cellular organisms → Bacteria	3711	Open in IMG/M
3300027843\|Ga0209798_10151655	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1162	Open in IMG/M
3300027843\|Ga0209798_10214688	All Organisms → cellular organisms → Bacteria	945	Open in IMG/M
3300027873\|Ga0209814_10009529	All Organisms → cellular organisms → Bacteria	3803	Open in IMG/M
3300027873\|Ga0209814_10295174	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300027907\|Ga0207428_10023543	All Organisms → cellular organisms → Bacteria	5178	Open in IMG/M
3300027907\|Ga0207428_10561942	All Organisms → cellular organisms → Bacteria	824	Open in IMG/M
3300028379\|Ga0268266_10363502	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1362	Open in IMG/M
3300030006\|Ga0299907_10336005	Not Available	1226	Open in IMG/M
3300030606\|Ga0299906_10351783	Not Available	1145	Open in IMG/M
3300030619\|Ga0268386_10196638	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1513	Open in IMG/M
3300030619\|Ga0268386_10503189	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	829	Open in IMG/M
3300031820\|Ga0307473_10605493	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	757	Open in IMG/M
3300031824\|Ga0307413_12113866	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	509	Open in IMG/M
3300031847\|Ga0310907_10877675	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300031890\|Ga0306925_11554960	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	645	Open in IMG/M
3300031903\|Ga0307407_10809190	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	713	Open in IMG/M
3300031908\|Ga0310900_10683869	All Organisms → cellular organisms → Bacteria	820	Open in IMG/M
3300031995\|Ga0307409_100838666	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	929	Open in IMG/M
3300032003\|Ga0310897_10599545	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	544	Open in IMG/M
3300032013\|Ga0310906_10447043	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300032059\|Ga0318533_10789382	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	697	Open in IMG/M
3300032122\|Ga0310895_10276790	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	785	Open in IMG/M
3300032163\|Ga0315281_10133620	All Organisms → cellular organisms → Bacteria	2834	Open in IMG/M
3300032174\|Ga0307470_11820180	Not Available	516	Open in IMG/M
3300032179\|Ga0310889_10291657	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	785	Open in IMG/M
3300032180\|Ga0307471_100175928	All Organisms → cellular organisms → Bacteria → Proteobacteria	2103	Open in IMG/M
3300032180\|Ga0307471_101848134	All Organisms → cellular organisms → Bacteria	754	Open in IMG/M
3300032205\|Ga0307472_101115700	All Organisms → cellular organisms → Bacteria	748	Open in IMG/M
3300033004\|Ga0335084_10184731	All Organisms → cellular organisms → Bacteria	2166	Open in IMG/M
3300033289\|Ga0310914_10315408	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1411	Open in IMG/M
3300033813\|Ga0364928_0199435	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	503	Open in IMG/M
3300034148\|Ga0364927_0016937	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1676	Open in IMG/M
3300034177\|Ga0364932_0191050	All Organisms → cellular organisms → Bacteria	778	Open in IMG/M
3300034417\|Ga0364941_063214	Not Available	848	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	76.26%
Host-Associated	Host-Associated	23.74%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	54.34%
Plants	Host-Associated → Plants	23.74%
Aquatic	Environmental → Aquatic	21.92%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.51%
Rhizosphere	Host-Associated → Plants → Rhizosphere	17.81%
Sediment	Environmental → Aquatic → Sediment	12.79%
Freshwater	Environmental → Aquatic → Freshwater	6.85%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.48%
Marine	Environmental → Aquatic → Marine	1.83%
Floodplain	Environmental → Terrestrial → Floodplain	1.83%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.46%
Roots	Host-Associated → Plants → Roots	0.46%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	39.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.24%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	12.79%
Loam	Environmental → Terrestrial → Soil → Loam	6.85%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.02%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.57%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.74%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.74%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.74%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.28%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.83%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.37%
Sand	Environmental → Terrestrial → Soil → Sand	1.37%
Lake	Environmental → Aquatic → Freshwater → Lake	0.91%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.46%
Sediment	Environmental → Aquatic → Marine → Sediment	0.46%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	0.46%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.46%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.46%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.46%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.24%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	12.79%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	9.13%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.02%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.57%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.20%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.74%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	2.74%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.74%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.74%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.28%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.28%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.83%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.37%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.37%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.37%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.91%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.46%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.46%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.46%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.46%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	0.46%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.46%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.46%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.13%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	9.13%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	8.22%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.94%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.02%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.57%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.20%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.20%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.74%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.74%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.74%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	2.28%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.28%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.28%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.28%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.83%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.83%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.37%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.37%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.37%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.37%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.37%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.37%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.37%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.91%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.91%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.91%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.91%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.91%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.91%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.46%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.46%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.46%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.46%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.46%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.46%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	0.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.46%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.46%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.46%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.46%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.46%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.46%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere	0.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.46%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.46%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000574	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m	Environmental	Open in IMG/M
3300000793	Forest soil microbial communities from Amazon forest - 2010 replicate II A001	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300001139	Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300002124	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3	Environmental	Open in IMG/M
3300003996	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2	Environmental	Open in IMG/M
3300003998	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004267	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300004778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh	Environmental	Open in IMG/M
3300004808	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh	Environmental	Open in IMG/M
3300005168	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC	Environmental	Open in IMG/M
3300005169	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005895	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101	Environmental	Open in IMG/M
3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009597	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299	Environmental	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009818	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011398	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2	Environmental	Open in IMG/M
3300011423	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2	Environmental	Open in IMG/M
3300011429	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2	Environmental	Open in IMG/M
3300011434	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2	Environmental	Open in IMG/M
3300012038	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2	Environmental	Open in IMG/M
3300012041	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2	Environmental	Open in IMG/M
3300012143	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2	Environmental	Open in IMG/M
3300012168	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012231	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014270	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1	Environmental	Open in IMG/M
3300014295	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1	Environmental	Open in IMG/M
3300014298	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1	Environmental	Open in IMG/M
3300014307	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1	Environmental	Open in IMG/M
3300014324	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014882	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D	Environmental	Open in IMG/M
3300014884	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da	Environmental	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015258	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018068	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental	Open in IMG/M
3300018082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300020003	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2	Environmental	Open in IMG/M
3300020004	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2	Environmental	Open in IMG/M
3300020010	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2	Environmental	Open in IMG/M
3300020200	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m	Environmental	Open in IMG/M
3300021073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300022208	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1	Environmental	Open in IMG/M
3300025310	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)	Environmental	Open in IMG/M
3300025791	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026005	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes)	Environmental	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026296	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300027056	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)	Host-Associated	Open in IMG/M
3300027513	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)	Environmental	Open in IMG/M
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)	Host-Associated	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027818	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027831	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027843	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300030606	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125	Environmental	Open in IMG/M
3300030619	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M
3300033813	Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17	Environmental	Open in IMG/M
3300034148	Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17	Environmental	Open in IMG/M
3300034177	Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17	Environmental	Open in IMG/M
3300034417	Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F021437

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign