 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F021521 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 218 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRF |
| Number of Associated Samples | 180 |
| Number of Associated Scaffolds | 218 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 23.11 % |
| % of genes near scaffold ends (potentially truncated) | 41.28 % |
| % of genes from short scaffolds (< 2000 bps) | 60.55 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.817 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (14.679 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.028 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.257 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 218 Family Scaffolds |
|---|---|---|
| PF00923 | TAL_FSA | 38.53 |
| PF17116 | DUF5103 | 19.27 |
| PF12704 | MacB_PCD | 3.67 |
| PF00588 | SpoU_methylase | 1.83 |
| PF08713 | DNA_alkylation | 1.38 |
| PF01252 | Peptidase_A8 | 1.38 |
| PF02894 | GFO_IDH_MocA_C | 1.38 |
| PF01642 | MM_CoA_mutase | 0.92 |
| PF05635 | 23S_rRNA_IVP | 0.92 |
| PF03606 | DcuC | 0.92 |
| PF06452 | CBM9_1 | 0.92 |
| PF07730 | HisKA_3 | 0.92 |
| PF01103 | Omp85 | 0.92 |
| PF08032 | SpoU_sub_bind | 0.46 |
| PF00106 | adh_short | 0.46 |
| PF00756 | Esterase | 0.46 |
| PF16314 | DUF4954 | 0.46 |
| PF16198 | TruB_C_2 | 0.46 |
| PF13568 | OMP_b-brl_2 | 0.46 |
| PF00196 | GerE | 0.46 |
| PF04209 | HgmA_C | 0.46 |
| PF04542 | Sigma70_r2 | 0.46 |
| PF17189 | Glyco_hydro_30C | 0.46 |
| PF00027 | cNMP_binding | 0.46 |
| PF01346 | FKBP_N | 0.46 |
| PF01075 | Glyco_transf_9 | 0.46 |
| PF05893 | LuxC | 0.46 |
| PF00154 | RecA | 0.46 |
| PF01175 | Urocanase | 0.46 |
| PF01764 | Lipase_3 | 0.46 |
| PF03706 | LPG_synthase_TM | 0.46 |
| PF13424 | TPR_12 | 0.46 |
| PF13520 | AA_permease_2 | 0.46 |
| PF00694 | Aconitase_C | 0.46 |
| PF10369 | ALS_ss_C | 0.46 |
| PF00202 | Aminotran_3 | 0.46 |
| PF07244 | POTRA | 0.46 |
| PF01244 | Peptidase_M19 | 0.46 |
| PF02838 | Glyco_hydro_20b | 0.46 |
| PF00326 | Peptidase_S9 | 0.46 |
| PF03061 | 4HBT | 0.46 |
| PF00327 | Ribosomal_L30 | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 218 Family Scaffolds |
|---|---|---|---|
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 38.53 |
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 2.75 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 2.29 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 1.83 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 1.83 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.38 |
| COG4912 | 3-methyladenine DNA glycosylase AlkD | Replication, recombination and repair [L] | 1.38 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.92 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.92 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.92 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.92 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.92 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.46 |
| COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.46 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.46 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.46 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.46 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.46 |
| COG1841 | Ribosomal protein L30/L7E | Translation, ribosomal structure and biogenesis [J] | 0.46 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.46 |
| COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 0.46 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.46 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.46 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.28 % |
| Unclassified | root | N/A | 19.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10066237 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → unclassified Sediminibacterium → Sediminibacterium sp. | 589 | Open in IMG/M |
| 3300001796|JGI24121J20154_1000508 | All Organisms → cellular organisms → Bacteria | 9640 | Open in IMG/M |
| 3300002161|JGI24766J26685_10008407 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2820 | Open in IMG/M |
| 3300002184|JGI24770J26754_10023372 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3206 | Open in IMG/M |
| 3300002275|B570J29585_1015137 | Not Available | 519 | Open in IMG/M |
| 3300002408|B570J29032_109931748 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3106 | Open in IMG/M |
| 3300002835|B570J40625_100000066 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 129496 | Open in IMG/M |
| 3300002835|B570J40625_100047495 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Asinibacterium → unclassified Asinibacterium → Asinibacterium sp. OR43 | 6203 | Open in IMG/M |
| 3300003388|JGI25910J50241_10026836 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → unclassified Sediminibacterium → Sediminibacterium sp. | 1980 | Open in IMG/M |
| 3300003394|JGI25907J50239_1003426 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3878 | Open in IMG/M |
| 3300003402|JGI26528J50254_1000059 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 96635 | Open in IMG/M |
| 3300003408|JGI26524J50256_1000146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 119024 | Open in IMG/M |
| 3300003431|JGI25913J50563_1038597 | Not Available | 737 | Open in IMG/M |
| 3300003493|JGI25923J51411_1089307 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 521 | Open in IMG/M |
| 3300003858|Ga0031656_10024156 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
| 3300003858|Ga0031656_10077505 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300004112|Ga0065166_10285990 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 670 | Open in IMG/M |
| 3300004162|Ga0066433_1000011 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 59820 | Open in IMG/M |
| 3300004169|Ga0066436_1010691 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 920 | Open in IMG/M |
| 3300004178|Ga0066410_1022037 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 995 | Open in IMG/M |
| 3300004685|Ga0065177_1034451 | Not Available | 955 | Open in IMG/M |
| 3300004786|Ga0007753_1439528 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 669 | Open in IMG/M |
| 3300004787|Ga0007755_1004701 | Not Available | 636 | Open in IMG/M |
| 3300004796|Ga0007763_10049353 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 538 | Open in IMG/M |
| 3300005330|Ga0070690_101193901 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 607 | Open in IMG/M |
| 3300005331|Ga0070670_100009239 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 8423 | Open in IMG/M |
| 3300005331|Ga0070670_102156290 | Not Available | 513 | Open in IMG/M |
| 3300005338|Ga0068868_100780316 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 861 | Open in IMG/M |
| 3300005458|Ga0070681_10803614 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 858 | Open in IMG/M |
| 3300005517|Ga0070374_10053902 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
| 3300005517|Ga0070374_10504835 | Not Available | 603 | Open in IMG/M |
| 3300005530|Ga0070679_100233987 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1796 | Open in IMG/M |
| 3300005543|Ga0070672_101156661 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 689 | Open in IMG/M |
| 3300005563|Ga0068855_102092396 | Not Available | 570 | Open in IMG/M |
| 3300005581|Ga0049081_10031238 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 2024 | Open in IMG/M |
| 3300005581|Ga0049081_10137432 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 899 | Open in IMG/M |
| 3300005582|Ga0049080_10005532 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Asinibacterium → unclassified Asinibacterium → Asinibacterium sp. OR53 | 4376 | Open in IMG/M |
| 3300005616|Ga0068852_100005400 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 9140 | Open in IMG/M |
| 3300005617|Ga0068859_100533423 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1268 | Open in IMG/M |
| 3300005656|Ga0073902_10001011 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 15698 | Open in IMG/M |
| 3300005657|Ga0073903_10207921 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium salmoneum | 889 | Open in IMG/M |
| 3300005659|Ga0073900_10010439 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4418 | Open in IMG/M |
| 3300005662|Ga0078894_10117296 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2365 | Open in IMG/M |
| 3300005662|Ga0078894_10366345 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1304 | Open in IMG/M |
| 3300005662|Ga0078894_10463690 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1140 | Open in IMG/M |
| 3300005662|Ga0078894_11325590 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 604 | Open in IMG/M |
| 3300005831|Ga0074471_11152816 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella | 1760 | Open in IMG/M |
| 3300005836|Ga0074470_11421654 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 667 | Open in IMG/M |
| 3300005836|Ga0074470_11511516 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella | 6324 | Open in IMG/M |
| 3300005941|Ga0070743_10127502 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 850 | Open in IMG/M |
| 3300005961|Ga0075157_10015027 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3775 | Open in IMG/M |
| 3300005986|Ga0075152_10018094 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4478 | Open in IMG/M |
| 3300005986|Ga0075152_10281937 | Not Available | 931 | Open in IMG/M |
| 3300005989|Ga0075154_10117543 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1569 | Open in IMG/M |
| 3300006030|Ga0075470_10025715 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 1823 | Open in IMG/M |
| 3300006046|Ga0066652_100734555 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 941 | Open in IMG/M |
| 3300006056|Ga0075163_11107829 | Not Available | 801 | Open in IMG/M |
| 3300006086|Ga0075019_10175694 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1260 | Open in IMG/M |
| 3300006103|Ga0007813_1053847 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 24-39-8 | 827 | Open in IMG/M |
| 3300006104|Ga0007882_10001587 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 13066 | Open in IMG/M |
| 3300006104|Ga0007882_10025495 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2658 | Open in IMG/M |
| 3300006639|Ga0079301_1003085 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 7168 | Open in IMG/M |
| 3300006641|Ga0075471_10032710 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella | 2982 | Open in IMG/M |
| 3300006755|Ga0079222_12310650 | Not Available | 537 | Open in IMG/M |
| 3300006805|Ga0075464_10000244 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 23304 | Open in IMG/M |
| 3300006805|Ga0075464_11017962 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 520 | Open in IMG/M |
| 3300007171|Ga0102977_1006202 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 5819 | Open in IMG/M |
| 3300007545|Ga0102873_1153412 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 694 | Open in IMG/M |
| 3300007545|Ga0102873_1169095 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium salmoneum | 658 | Open in IMG/M |
| 3300007546|Ga0102874_1016138 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2453 | Open in IMG/M |
| 3300007547|Ga0102875_1102297 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 914 | Open in IMG/M |
| 3300007553|Ga0102819_1094438 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 508 | Open in IMG/M |
| 3300007593|Ga0102918_1022132 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 1730 | Open in IMG/M |
| 3300007597|Ga0102919_1065210 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1140 | Open in IMG/M |
| 3300007600|Ga0102920_1032781 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1592 | Open in IMG/M |
| 3300007603|Ga0102921_1312386 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 560 | Open in IMG/M |
| 3300007617|Ga0102897_1150288 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 708 | Open in IMG/M |
| 3300007622|Ga0102863_1208096 | Not Available | 575 | Open in IMG/M |
| 3300007634|Ga0102901_1197728 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300007681|Ga0102824_1029030 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 1476 | Open in IMG/M |
| 3300007862|Ga0105737_1186663 | Not Available | 546 | Open in IMG/M |
| 3300008117|Ga0114351_1154127 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1260 | Open in IMG/M |
| 3300008119|Ga0114354_1011505 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 7692 | Open in IMG/M |
| 3300008119|Ga0114354_1020872 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2962 | Open in IMG/M |
| 3300008120|Ga0114355_1224876 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 575 | Open in IMG/M |
| 3300009009|Ga0105105_11055489 | Not Available | 508 | Open in IMG/M |
| 3300009059|Ga0102830_1054269 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1212 | Open in IMG/M |
| 3300009068|Ga0114973_10573425 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 580 | Open in IMG/M |
| 3300009151|Ga0114962_10035111 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3409 | Open in IMG/M |
| 3300009152|Ga0114980_10093202 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 1802 | Open in IMG/M |
| 3300009152|Ga0114980_10139720 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1438 | Open in IMG/M |
| 3300009159|Ga0114978_10517035 | Not Available | 699 | Open in IMG/M |
| 3300009160|Ga0114981_10056997 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 2184 | Open in IMG/M |
| 3300009161|Ga0114966_10056843 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2755 | Open in IMG/M |
| 3300009163|Ga0114970_10013288 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Asinibacterium → unclassified Asinibacterium → Asinibacterium sp. OR43 | 5701 | Open in IMG/M |
| 3300009164|Ga0114975_10001674 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 15608 | Open in IMG/M |
| 3300009164|Ga0114975_10005618 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 8125 | Open in IMG/M |
| 3300009181|Ga0114969_10077969 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 2161 | Open in IMG/M |
| 3300009181|Ga0114969_10134911 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1562 | Open in IMG/M |
| 3300009182|Ga0114959_10390768 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 682 | Open in IMG/M |
| 3300009183|Ga0114974_10037270 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 3322 | Open in IMG/M |
| 3300009185|Ga0114971_10009090 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6604 | Open in IMG/M |
| 3300009527|Ga0114942_1001055 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 7863 | Open in IMG/M |
| 3300009870|Ga0131092_10044581 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6108 | Open in IMG/M |
| 3300010158|Ga0114960_10006691 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium ginsengisoli | 8278 | Open in IMG/M |
| 3300010312|Ga0102883_1061063 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1112 | Open in IMG/M |
| 3300010334|Ga0136644_10003194 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 12282 | Open in IMG/M |
| 3300010344|Ga0116243_10440740 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 802 | Open in IMG/M |
| 3300010388|Ga0136551_1056867 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 708 | Open in IMG/M |
| 3300010400|Ga0134122_10800948 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 899 | Open in IMG/M |
| 3300010885|Ga0133913_10001540 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 54884 | Open in IMG/M |
| 3300010885|Ga0133913_10088760 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter | 8288 | Open in IMG/M |
| 3300010885|Ga0133913_11772219 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1547 | Open in IMG/M |
| 3300010885|Ga0133913_12324088 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1315 | Open in IMG/M |
| 3300010885|Ga0133913_13482390 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1027 | Open in IMG/M |
| 3300010885|Ga0133913_13579238 | Not Available | 1010 | Open in IMG/M |
| 3300011011|Ga0139556_1025940 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 854 | Open in IMG/M |
| 3300012533|Ga0138256_10000263 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 61049 | Open in IMG/M |
| 3300012533|Ga0138256_10059933 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3772 | Open in IMG/M |
| 3300012533|Ga0138256_10077231 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3244 | Open in IMG/M |
| 3300012754|Ga0138278_1139970 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300012775|Ga0138280_1099542 | Not Available | 512 | Open in IMG/M |
| 3300012829|Ga0160467_100009 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 588364 | Open in IMG/M |
| 3300012921|Ga0164290_1000172 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium goheungense | 241278 | Open in IMG/M |
| 3300012921|Ga0164290_1002317 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium goheungense | 14296 | Open in IMG/M |
| 3300012956|Ga0154020_10608234 | Not Available | 893 | Open in IMG/M |
| 3300013004|Ga0164293_10085858 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2445 | Open in IMG/M |
| 3300013014|Ga0164295_10066440 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2693 | Open in IMG/M |
| 3300013306|Ga0163162_10518258 | Not Available | 1322 | Open in IMG/M |
| 3300014055|Ga0119878_1042098 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1244 | Open in IMG/M |
| 3300015371|Ga0132258_13248042 | Not Available | 1120 | Open in IMG/M |
| 3300015373|Ga0132257_102276772 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 702 | Open in IMG/M |
| 3300018414|Ga0194135_10253749 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 24-39-8 | 1193 | Open in IMG/M |
| 3300018432|Ga0190275_12598233 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 583 | Open in IMG/M |
| 3300018476|Ga0190274_10060157 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2806 | Open in IMG/M |
| 3300020151|Ga0211736_10596872 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 2286 | Open in IMG/M |
| 3300020155|Ga0194050_1092958 | Not Available | 817 | Open in IMG/M |
| 3300020157|Ga0194049_1044460 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1157 | Open in IMG/M |
| 3300020160|Ga0211733_10885934 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1539 | Open in IMG/M |
| 3300020205|Ga0211731_10265657 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 8902 | Open in IMG/M |
| 3300020205|Ga0211731_10438237 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 885 | Open in IMG/M |
| 3300020205|Ga0211731_11502460 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 934 | Open in IMG/M |
| 3300020524|Ga0208858_1021497 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 985 | Open in IMG/M |
| 3300020560|Ga0208852_1005682 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2800 | Open in IMG/M |
| 3300020561|Ga0207934_1072458 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 573 | Open in IMG/M |
| 3300020563|Ga0208082_1007501 | Not Available | 2663 | Open in IMG/M |
| 3300021070|Ga0194056_10002256 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 10233 | Open in IMG/M |
| 3300021849|Ga0210304_1068120 | Not Available | 634 | Open in IMG/M |
| 3300021963|Ga0222712_10042839 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium goheungense | 3445 | Open in IMG/M |
| 3300022549|Ga0212091_10050062 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Emticicia → Emticicia oligotrophica | 1511 | Open in IMG/M |
| 3300022549|Ga0212091_10148139 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter → unclassified Segetibacter → Segetibacter sp. 3557_3 | 927 | Open in IMG/M |
| 3300022592|Ga0236342_1028487 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1431 | Open in IMG/M |
| 3300023184|Ga0214919_10002462 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 29144 | Open in IMG/M |
| 3300023184|Ga0214919_10776623 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300023311|Ga0256681_11433254 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1111 | Open in IMG/M |
| 3300023311|Ga0256681_11651512 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1374 | Open in IMG/M |
| 3300023311|Ga0256681_12061009 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 505 | Open in IMG/M |
| 3300024346|Ga0244775_10174679 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium | 1808 | Open in IMG/M |
| 3300024346|Ga0244775_10454572 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1049 | Open in IMG/M |
| 3300024348|Ga0244776_10030088 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4375 | Open in IMG/M |
| 3300024490|Ga0255185_1015992 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1070 | Open in IMG/M |
| 3300024857|Ga0256339_1038032 | Not Available | 1033 | Open in IMG/M |
| 3300024980|Ga0208882_1053139 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 24-39-8 | 626 | Open in IMG/M |
| 3300025356|Ga0208870_1000203 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 10681 | Open in IMG/M |
| 3300025745|Ga0255244_1012849 | Not Available | 1000 | Open in IMG/M |
| 3300025899|Ga0207642_10603963 | Not Available | 683 | Open in IMG/M |
| 3300025938|Ga0207704_10642996 | Not Available | 873 | Open in IMG/M |
| 3300026023|Ga0207677_11825952 | Not Available | 564 | Open in IMG/M |
| 3300026555|Ga0179593_1065047 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. | 2618 | Open in IMG/M |
| 3300027084|Ga0208443_1023271 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1397 | Open in IMG/M |
| 3300027198|Ga0208163_1059852 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 611 | Open in IMG/M |
| 3300027242|Ga0208806_1081351 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300027256|Ga0208932_1007776 | Not Available | 1773 | Open in IMG/M |
| 3300027259|Ga0208178_1035952 | Not Available | 914 | Open in IMG/M |
| 3300027259|Ga0208178_1075782 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 601 | Open in IMG/M |
| 3300027281|Ga0208440_1058873 | Not Available | 830 | Open in IMG/M |
| 3300027418|Ga0208022_1020821 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1534 | Open in IMG/M |
| 3300027499|Ga0208788_1009908 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3527 | Open in IMG/M |
| 3300027649|Ga0208960_1017834 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2834 | Open in IMG/M |
| 3300027673|Ga0209278_1010714 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4111 | Open in IMG/M |
| 3300027689|Ga0209551_1031896 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1771 | Open in IMG/M |
| 3300027694|Ga0209170_1000382 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 20373 | Open in IMG/M |
| 3300027707|Ga0209443_1134030 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 913 | Open in IMG/M |
| 3300027707|Ga0209443_1241853 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 620 | Open in IMG/M |
| 3300027710|Ga0209599_10009778 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2982 | Open in IMG/M |
| 3300027735|Ga0209261_10028564 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1381 | Open in IMG/M |
| 3300027736|Ga0209190_1105442 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1291 | Open in IMG/M |
| 3300027746|Ga0209597_1036403 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2543 | Open in IMG/M |
| 3300027749|Ga0209084_1022879 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3342 | Open in IMG/M |
| 3300027759|Ga0209296_1252256 | Not Available | 725 | Open in IMG/M |
| 3300027770|Ga0209086_10099706 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga → Chitinophaga sancti | 1490 | Open in IMG/M |
| 3300027793|Ga0209972_10463414 | Not Available | 527 | Open in IMG/M |
| 3300027794|Ga0209480_10008178 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6063 | Open in IMG/M |
| 3300027805|Ga0209229_10018406 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2997 | Open in IMG/M |
| 3300027836|Ga0209230_10000632 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium goheungense | 13706 | Open in IMG/M |
| 3300027843|Ga0209798_10005431 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 7262 | Open in IMG/M |
| 3300027898|Ga0209067_10204258 | Not Available | 1063 | Open in IMG/M |
| 3300027969|Ga0209191_1082222 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1404 | Open in IMG/M |
| 3300028394|Ga0304730_1272291 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 598 | Open in IMG/M |
| 3300028648|Ga0268299_1096910 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 836 | Open in IMG/M |
| 3300031232|Ga0302323_100569822 | Not Available | 1224 | Open in IMG/M |
| 3300031722|Ga0311351_10743191 | Not Available | 748 | Open in IMG/M |
| 3300031758|Ga0315907_10041147 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4105 | Open in IMG/M |
| 3300031758|Ga0315907_10184385 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1755 | Open in IMG/M |
| 3300031758|Ga0315907_10858065 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium salmoneum | 671 | Open in IMG/M |
| 3300031784|Ga0315899_11535250 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 556 | Open in IMG/M |
| 3300031786|Ga0315908_10397125 | Not Available | 1154 | Open in IMG/M |
| 3300031857|Ga0315909_10456108 | Not Available | 897 | Open in IMG/M |
| 3300031997|Ga0315278_10021096 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6169 | Open in IMG/M |
| 3300032050|Ga0315906_10029233 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 5985 | Open in IMG/M |
| 3300032177|Ga0315276_10739990 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1054 | Open in IMG/M |
| 3300032516|Ga0315273_10058063 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5243 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 14.68% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 11.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.21% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 3.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.75% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.83% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.83% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.83% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.83% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.38% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.38% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.38% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.38% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.38% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.38% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.38% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.38% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.92% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Contaminated Culture | Environmental → Terrestrial → Soil → Unclassified → Desert → Contaminated Culture | 0.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.92% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.92% |
| Wastewater Bioreactor | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor | 0.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater | 0.46% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.46% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.46% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.46% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.46% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.46% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.46% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.46% |
| Serpentinite Rock And Fluid | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Insecta | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Insecta | 0.46% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.46% |
| Sewage Treatment Plant | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001796 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_QV12A | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002184 | Freshwater and sediment microbial communities from Lake Erie, Canada | Environmental | Open in IMG/M |
| 3300002275 | Freshwater microbial communities from Lake Mendota, WI - 06JUL2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003402 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1 | Engineered | Open in IMG/M |
| 3300003408 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan | Engineered | Open in IMG/M |
| 3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004162 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 49_LOW8 | Environmental | Open in IMG/M |
| 3300004169 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 52_LOW8 | Environmental | Open in IMG/M |
| 3300004178 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 14_LOW5 | Environmental | Open in IMG/M |
| 3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004786 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004787 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005656 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit | Engineered | Open in IMG/M |
| 3300005657 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk | Engineered | Open in IMG/M |
| 3300005659 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit | Engineered | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005961 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA | Engineered | Open in IMG/M |
| 3300005986 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA | Engineered | Open in IMG/M |
| 3300005989 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA | Engineered | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012754 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012775 | Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Host-Associated | Open in IMG/M |
| 3300012921 | Contaminated culture microbial community from soil near Moab, Utah, USA - Microcoleus steenstrupii SON62 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014055 | Sewage treatment plant microbial communities from Vermont, USA - ANOX_W | Engineered | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018414 | Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020155 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-10m | Environmental | Open in IMG/M |
| 3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021070 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13m | Environmental | Open in IMG/M |
| 3300021849 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022549 | Cold Creek_combined assembly | Environmental | Open in IMG/M |
| 3300022592 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024980 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 14_LOW5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025356 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025745 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027198 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes) | Environmental | Open in IMG/M |
| 3300027220 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027242 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027256 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027259 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027673 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027694 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk (SPAdes) | Engineered | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027794 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028648 | Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor | Engineered | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_100662372 | 3300000882 | Freshwater And Marine | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSLIFK |
| JGI24121J20154_100050811 | 3300001796 | Serpentinite Rock And Fluid | MAGYSHRTAQPPILAAFLPWGGSAGAGRVRPAGAKVRVETYFP* |
| JGI24766J26685_100084073 | 3300002161 | Freshwater And Sediment | MAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIIEINEGKN* |
| JGI24770J26754_100233722 | 3300002184 | Freshwater And Sediment | MAGYLHRAATTAYLAAFLPWEGSAGAGRVRPAAANIGQKVFYKK* |
| B570J29585_10151372 | 3300002275 | Freshwater | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSLIFKVLNKPNY |
| B570J29032_1099317481 | 3300002408 | Freshwater | CLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKIIEINEGKN* |
| B570J40625_10000006631 | 3300002835 | Freshwater | MAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKIIEINEGKN* |
| B570J40625_1000474957 | 3300002835 | Freshwater | VAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGANVGQIEGFTKCY* |
| JGI25910J50241_100268362 | 3300003388 | Freshwater Lake | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAVAKVRFALNSP* |
| JGI25907J50239_10034264 | 3300003394 | Freshwater Lake | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMD* |
| JGI26528J50254_100005981 | 3300003402 | Wastewater Bioreactor | MASYLYHTAQPPTLAAFRPWGSSAGAGRIRLATAKIKQLHQKEK* |
| JGI26524J50256_100014647 | 3300003408 | Wastewater Bioreactor | MAGYSHRTATTIYLAAFRPWGGSTGAGRVRPAGAKIQAQGIFPQKKAL* |
| JGI25913J50563_10385972 | 3300003431 | Freshwater Lake | VAGYSHRTAQPLILAVFLPWGSSAGAGRVRPAGANVGQIEGLKKSQ |
| JGI25923J51411_10893071 | 3300003493 | Freshwater Lake | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGTKVRFALNSP* |
| Ga0031656_100241564 | 3300003858 | Freshwater Lake Sediment | MAGDLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIGEKYMLTVDG* |
| Ga0031656_100775051 | 3300003858 | Freshwater Lake Sediment | KMAGDLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIGEKYMLTVDG* |
| Ga0065166_102859902 | 3300004112 | Freshwater Lake | VAGYSHRTAQPPILATFLSWGGSAGAGRVRPAGANVGQMKGLKKGK* |
| Ga0066433_10000119 | 3300004162 | Freshwater Sediment | MAGYFIAPLQPPILAAFLPWGGSAGAGRVRPAAAKVRVEPVFS* |
| Ga0066436_10106912 | 3300004169 | Freshwater | MAGYLHRTATTAYLAAFLPWGGSAGAGRVRPAAAKVRVEPVFS* |
| Ga0066410_10220372 | 3300004178 | Freshwater Sediment | VIATDPTPFAKKEKMAGYSHRTAQPPILAVFLPWGVSAGAGRMRPAAAKVRFEN* |
| Ga0065177_10344512 | 3300004685 | Freshwater | MAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAAAKVRFER* |
| Ga0007753_14395281 | 3300004786 | Freshwater Lake | VAGYSHHTAQPPILAVFLPWGNSAGAGRVRPAGANVGQMD* |
| Ga0007755_10047012 | 3300004787 | Freshwater Lake | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSLIFKALN |
| Ga0007763_100493531 | 3300004796 | Freshwater Lake | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN* |
| Ga0065714_100399221 | 3300005288 | Miscanthus Rhizosphere | MASDLHRTAQPRTLAMFPLGESAGAGRVGLAGANIQSFYIFA |
| Ga0070690_1011939011 | 3300005330 | Switchgrass Rhizosphere | HRTAQPPTLAAFRPWEGSAGAGRVRPAAANIRMFKLRNLIFEVYR* |
| Ga0070670_1000092398 | 3300005331 | Switchgrass Rhizosphere | MAGYLHRTATTAYLAIFRSWGSSAGAGRIRPAGANIIGFDVENL* |
| Ga0070670_1021562901 | 3300005331 | Switchgrass Rhizosphere | KKGRLIHRTAQPNILAAFLPWGGSKGAGRVRPAAANIVHEMKLEK* |
| Ga0068868_1007803162 | 3300005338 | Miscanthus Rhizosphere | MAGYLHRTATTAYLAIFRSWGSSAGAGRIRPAGANIGGLDV* |
| Ga0070681_108036142 | 3300005458 | Corn Rhizosphere | MAGLLHRTATTPTLAAFRPWEDSAGAGRVRPAAAKIMINV* |
| Ga0070374_100539024 | 3300005517 | Freshwater Lake | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP* |
| Ga0070374_105048351 | 3300005517 | Freshwater Lake | VAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGTK |
| Ga0070679_1002339873 | 3300005530 | Corn Rhizosphere | MAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAAAKIMINV* |
| Ga0070672_1011566612 | 3300005543 | Miscanthus Rhizosphere | MAGYLHRTATTAYLAIFRSWGSSAGAGRIRPAGANIGGFHV* |
| Ga0068855_1020923962 | 3300005563 | Corn Rhizosphere | MASYLYRTAQPPILAAFLPWGGSAGAGRIRLAGAKVGVFG* |
| Ga0049081_100312383 | 3300005581 | Freshwater Lentic | KVAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN* |
| Ga0049081_101374321 | 3300005581 | Freshwater Lentic | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAAANVGQMN* |
| Ga0049080_100055325 | 3300005582 | Freshwater Lentic | HHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN* |
| Ga0068852_1000054007 | 3300005616 | Corn Rhizosphere | MAGYLHRTATTAYLAIFRSWGSSAGAGRIRPAAANIG* |
| Ga0068859_1005334232 | 3300005617 | Switchgrass Rhizosphere | MAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPADAKIRV* |
| Ga0073902_1000101112 | 3300005656 | Activated Sludge | MAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAVAKIRV* |
| Ga0073903_102079212 | 3300005657 | Activated Sludge | MAGYSHRTAQPLILAAFLPWGGSAGAGRARPATPQK* |
| Ga0073900_100104391 | 3300005659 | Activated Sludge | GKKMAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAVAKIRV* |
| Ga0078894_101172963 | 3300005662 | Freshwater Lake | VAGYSHRTAQPLILATFLSWGGSAGAGRVRPAGANVGQMRGLKKRWNN* |
| Ga0078894_103663453 | 3300005662 | Freshwater Lake | MAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAK |
| Ga0078894_104636903 | 3300005662 | Freshwater Lake | MAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIIEISEVNIELTVNLP |
| Ga0078894_113255902 | 3300005662 | Freshwater Lake | KKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP* |
| Ga0074471_111528162 | 3300005831 | Sediment (Intertidal) | MAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPAAAKIRVWPYL* |
| Ga0074470_114216541 | 3300005836 | Sediment (Intertidal) | MAGLLHRTAQPPTLAAFRPWEVSAGAGRVRPAVAKIRS* |
| Ga0074470_115115166 | 3300005836 | Sediment (Intertidal) | MAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAAAKISMMNED* |
| Ga0070743_101275022 | 3300005941 | Estuarine | MASYLYHTAQPITLAAFPPWGSSSGASCIGLAGANVSCIFQLSK* |
| Ga0075157_100150272 | 3300005961 | Wastewater Effluent | VAGYSHRTAQPPILAVFLPWGGSAGAGRIRPADAKIRE* |
| Ga0075152_100180942 | 3300005986 | Wastewater Effluent | VAGYSHRTAQPPILAVFLPWGGSAGAGRIRPATAKIRD* |
| Ga0075152_102819371 | 3300005986 | Wastewater Effluent | VAGYSHRTAQPPTLAAFRPWEDSAGAGRVRPAGAKIRQ |
| Ga0075154_101175431 | 3300005989 | Wastewater Effluent | MKKVAGYSHRTAQPPTLAAFRPWEDSAGAGRVRPAGA |
| Ga0075470_100257152 | 3300006030 | Aqueous | MAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAAANVG* |
| Ga0066652_1007345552 | 3300006046 | Soil | MAGYLHRTAQPLILAAFRPWGDSAGAGRIRPAAAKIGKHG* |
| Ga0075163_111078292 | 3300006056 | Wastewater Effluent | MAGYSHRTATTAYLAAFRPWGGSAGAGRVRPAGAKIRKV* |
| Ga0075019_101756943 | 3300006086 | Watersheds | MAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAGAKVRFEY* |
| Ga0007813_10538472 | 3300006103 | Freshwater | RKKMAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAAAKVRFER* |
| Ga0007882_1000158710 | 3300006104 | Freshwater | VAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVL* |
| Ga0007882_100254952 | 3300006104 | Freshwater | MAGYSHRTATTAYLAAFLPWGGSAGAGRVRPAGAKVRIEK* |
| Ga0079301_10030852 | 3300006639 | Deep Subsurface | MAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIIEFNEEKN* |
| Ga0075471_100327102 | 3300006641 | Aqueous | MAGLLHRTAQPLTLAAFRPWEGSAGAGRVRPAGQI* |
| Ga0079222_123106501 | 3300006755 | Agricultural Soil | MAGLLHRTAQPPTLAAFLPWEGSAGAGRVRPAGAKISLALLTQAHFLKII* |
| Ga0075464_1000024412 | 3300006805 | Aqueous | VAGYSHRTAQPLILAVFLPWGSSAGAGRVRPAGANVGQIEGLKKSQ* |
| Ga0075464_110179621 | 3300006805 | Aqueous | AGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGANVGQIEGSTKRY* |
| Ga0102977_10062024 | 3300007171 | Freshwater Lake | MAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKIIEFSEEKH* |
| Ga0102873_11534121 | 3300007545 | Estuarine | HRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP* |
| Ga0102873_11690952 | 3300007545 | Estuarine | MAGYSHRTAQPLILATFLAWGDSAGAGRVRPADANVGQRMD* |
| Ga0102874_10161383 | 3300007546 | Estuarine | MAGYSHRTAQPLILATFLSWGDSAGAGRVRPAGANVG* |
| Ga0102875_11022972 | 3300007547 | Estuarine | SHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN* |
| Ga0102819_10944381 | 3300007553 | Estuarine | KMAGYSHRTAQPLILATFLSWGDSAGAGRVRPAGANVG* |
| Ga0102918_10221321 | 3300007593 | Estuarine | RTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP* |
| Ga0102919_10652102 | 3300007597 | Estuarine | MAGYSHRTAQPLLLAVFLPWGGSAGAGRVRPAGAKVRFALNSP* |
| Ga0102920_10327812 | 3300007600 | Estuarine | RNRRGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP* |
| Ga0102921_13123862 | 3300007603 | Estuarine | MAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVGQMRGLKKTK* |
| Ga0102897_11502882 | 3300007617 | Estuarine | AQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP* |
| Ga0102863_12080961 | 3300007622 | Estuarine | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGANVG |
| Ga0102901_11977282 | 3300007634 | Estuarine | QPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP* |
| Ga0102824_10290302 | 3300007681 | Estuarine | VAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGANVGQMN* |
| Ga0105737_11866632 | 3300007862 | Estuary Water | MAGYSHRTAQPLILATFLSWGDSAGAGRVRPADANVGQRMD* |
| Ga0114351_11541273 | 3300008117 | Freshwater, Plankton | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRF |
| Ga0114354_10115058 | 3300008119 | Freshwater, Plankton | RGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP* |
| Ga0114354_10208721 | 3300008119 | Freshwater, Plankton | RGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPADTKVRFALNSP* |
| Ga0114355_12248761 | 3300008120 | Freshwater, Plankton | MAGYFHRTAQPPTLAAFPPWGSSAGAGRVRPAGAKI* |
| Ga0105105_110554891 | 3300009009 | Freshwater Sediment | MAGDLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIGKKYK |
| Ga0102830_10542691 | 3300009059 | Estuarine | HTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN* |
| Ga0114973_105734251 | 3300009068 | Freshwater Lake | GYSHHTAQPPILAVFLPWGSSAGAGRVRPADANVGQMN* |
| Ga0114962_100351115 | 3300009151 | Freshwater Lake | VAGYSHRTAQPLILATFLSWGGSAGAGRVRPAGANVG* |
| Ga0114980_100932021 | 3300009152 | Freshwater Lake | GYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN* |
| Ga0114980_101397203 | 3300009152 | Freshwater Lake | MAGYSHRTAQPLVLAVFLPWGVSAGAGRVRPATANVGGSCLLTN* |
| Ga0114978_105170352 | 3300009159 | Freshwater Lake | MYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADAKITVFLKENK* |
| Ga0114981_100569973 | 3300009160 | Freshwater Lake | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVAQLN* |
| Ga0114966_100568433 | 3300009161 | Freshwater Lake | MAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADAKITVFLKENK* |
| Ga0114970_100132883 | 3300009163 | Freshwater Lake | MAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAKAKVRFEA* |
| Ga0114975_1000167410 | 3300009164 | Freshwater Lake | VAGYSHRTAQPLILATFLSWGGSAGAGRVRPAGANVVN* |
| Ga0114975_100056186 | 3300009164 | Freshwater Lake | MAGYSHRTAQPLVLAVFLPWGVSAGAGRVRPAAANVGGSCLLTN* |
| Ga0114969_100779691 | 3300009181 | Freshwater Lake | MYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPAD |
| Ga0114969_101349112 | 3300009181 | Freshwater Lake | EMYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADTKITVFLKENK* |
| Ga0114959_103907682 | 3300009182 | Freshwater Lake | MAGYSHRTAQPLVLAVFLPWGVSAGAGRVRPAAANVGGSYLLTN* |
| Ga0114974_100372702 | 3300009183 | Freshwater Lake | VAGYSHHTAQPPILAVFLPWGSSAGAGRARPAGANVAQLN* |
| Ga0114971_100090904 | 3300009185 | Freshwater Lake | MYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADTKITVFLKENK* |
| Ga0114942_10010555 | 3300009527 | Groundwater | MAGYSHRTAQPPTLAAFPPWEGSAGAGRVRPAAANIQVR* |
| Ga0105164_106016002 | 3300009777 | Wastewater | LKFLNTPLGDVGKKMAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPAVAK |
| Ga0131092_100445815 | 3300009870 | Activated Sludge | VAGYSHRTAQPPILAVFLPWGGSAGAGRIRPAAANVRFLNF* |
| Ga0114960_100066912 | 3300010158 | Freshwater Lake | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAVANVAQLN* |
| Ga0102883_10610632 | 3300010312 | Estuarine | FEILKMAGYSHRTAQPLILATFLSWGDSAGAGRVRPAGANVG* |
| Ga0136644_100031941 | 3300010334 | Freshwater Lake | MAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAGAKVRFEN* |
| Ga0116243_104407402 | 3300010344 | Anaerobic Digestor Sludge | VAGYSHRTAQPPILAVFLPWGGSAGAGRIRPATAKIGVHDK* |
| Ga0136551_10568672 | 3300010388 | Pond Fresh Water | VAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVGQMRGLKKTK* |
| Ga0134122_108009482 | 3300010400 | Terrestrial Soil | AGLLHRTAQPPTLAAFRPWEGSAGAGRVRPAGAKIRTFEV* |
| Ga0133913_1000154018 | 3300010885 | Freshwater Lake | MAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKINKISEGKN* |
| Ga0133913_100887603 | 3300010885 | Freshwater Lake | MAGLLHRTAQPPTLATFRSWGSSAGAGRVRPANANI* |
| Ga0133913_117722191 | 3300010885 | Freshwater Lake | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPADANVGQMN* |
| Ga0133913_123240881 | 3300010885 | Freshwater Lake | KMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKITVFFKENK* |
| Ga0133913_134823901 | 3300010885 | Freshwater Lake | GYSHRTAQPPILAVFLPWGVSAGAGRVRPATAKVRFEA* |
| Ga0133913_135792383 | 3300010885 | Freshwater Lake | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANV |
| Ga0139556_10259402 | 3300011011 | Freshwater | VAGYSHRTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN* |
| Ga0138256_1000026316 | 3300012533 | Active Sludge | MASYLYHTAQPPTLAAFRPWGSSAGAGCIRLAAAKIKQMHQKEK* |
| Ga0138256_100599331 | 3300012533 | Active Sludge | LLHRTAQPPTLAAFRPWEDSAGAGRVRPAAAKIRV* |
| Ga0138256_100772311 | 3300012533 | Active Sludge | LHRTAQPPTLAAFRPWEGSAGAGRVRPAGAKIRV* |
| Ga0138256_101114371 | 3300012533 | Active Sludge | PLGDGGKKMAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAVAKIRV* |
| Ga0138278_11399701 | 3300012754 | Freshwater Lake | MAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAAANVGQNK |
| Ga0138280_10995422 | 3300012775 | Freshwater Lake | MAGYSHRTAQPPILAVFLPWGVSAGAGRVRPATAKVRFEA* |
| Ga0160467_100009357 | 3300012829 | Insecta | VASYLYRTAQPLILAAFLPWGGSVGAGRIRLAAAKVGGIMKRIKF* |
| Ga0164290_1000172110 | 3300012921 | Contaminated Culture | VIPSRAKGEKMAGYSHRTAQPPILAAFLPWGGSAGAGRVRPAAAKVRVDTYFP* |
| Ga0164290_10023178 | 3300012921 | Contaminated Culture | MAGYSHRTAQPPILAAFLPWGGSAGAGRVRPAGAKVRVGSYFP* |
| Ga0154020_100624021 | 3300012956 | Active Sludge | PLGDGGKKMAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAAAKIRV* |
| Ga0154020_106082342 | 3300012956 | Active Sludge | MASYLYHTAQPPTLAAFRPWGSSAGAGCIRLAAAKIKQMHQKEK |
| Ga0164293_100858584 | 3300013004 | Freshwater | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAK |
| Ga0164295_100664404 | 3300013014 | Freshwater | MAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADANIAHFLKIF* |
| Ga0170791_143479502 | 3300013295 | Freshwater | MYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRV |
| Ga0163162_105182583 | 3300013306 | Switchgrass Rhizosphere | MAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAAANIGKNFRRK |
| Ga0119878_10420982 | 3300014055 | Sewage Treatment Plant | MAGYSHRTAQPPILAVFLPWGVSAGAGRIRPASAKVRVLIF* |
| Ga0132258_132480421 | 3300015371 | Arabidopsis Rhizosphere | MAGLLHRTAQPPTLAAFLPWEGSAGAGRVRPAGANVIIND* |
| Ga0132257_1022767721 | 3300015373 | Arabidopsis Rhizosphere | YSHRTAQPPTLAAFRPWEGSAGAGRVRPAGTKISEKFEV* |
| Ga0194135_102537492 | 3300018414 | Watersheds | MAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAGAKVRFEY |
| Ga0190275_125982331 | 3300018432 | Soil | KKMASYLHRTAQPLTLATFRSWGSSAGAGRIRLAGANIRDYALNNSECYLL |
| Ga0190274_100601571 | 3300018476 | Soil | MAGYLHRTAQPPILAAFRPWGDSAGAGRIRPAAAKIGK |
| Ga0211736_105968722 | 3300020151 | Freshwater | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN |
| Ga0194050_10929582 | 3300020155 | Anoxic Zone Freshwater | MAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAKAKVRFEA |
| Ga0194049_10444602 | 3300020157 | Anoxic Zone Freshwater | MAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAAAKVRFER |
| Ga0211733_108859341 | 3300020160 | Freshwater | IPRNRRGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP |
| Ga0211731_102656573 | 3300020205 | Freshwater | MAGYSHRTAQPLILATFLSWGDSAGAGRVRPAGANVG |
| Ga0211731_104382372 | 3300020205 | Freshwater | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAAANVGQMN |
| Ga0211731_115024602 | 3300020205 | Freshwater | VAGYSHHTAQPPILAVFLPWGSLAGAGRVRPAGANVGQMN |
| Ga0208858_10214972 | 3300020524 | Freshwater | AGCLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKIIEINEGKN |
| Ga0208852_10056822 | 3300020560 | Freshwater | MAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGAKVRFALNSP |
| Ga0207934_10724581 | 3300020561 | Freshwater | HHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN |
| Ga0208082_10075012 | 3300020563 | Freshwater | VAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP |
| Ga0194056_100022569 | 3300021070 | Anoxic Zone Freshwater | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVAQLN |
| Ga0210304_10681201 | 3300021849 | Estuarine | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNS |
| Ga0222712_100428391 | 3300021963 | Estuarine Water | SHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP |
| Ga0212091_100500623 | 3300022549 | Groundwater | MAGYSHRTAQPPTLAAFPPWEGSAGAGRVRPAAANIQV |
| Ga0212091_101481392 | 3300022549 | Groundwater | AVKEEKKMAGYSHRTAQPPTLAAFPPWEGSAGAGRVRPAAANIQVR |
| Ga0236342_10284871 | 3300022592 | Freshwater | KVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVL |
| Ga0214919_1000246212 | 3300023184 | Freshwater | MAGYSHRTAQPPILAVFLPWGVSAGAGRVRPATAKVRFEA |
| Ga0214919_107766232 | 3300023184 | Freshwater | MAGYSHRTAQPLVLAVFLPWGVSAGAGRVRPATANVGGSCLLTN |
| Ga0256681_114332542 | 3300023311 | Freshwater | LKYKKVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVL |
| Ga0256681_116515123 | 3300023311 | Freshwater | VAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANV |
| Ga0256681_120610091 | 3300023311 | Freshwater | HLKYKKVAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVA |
| Ga0244775_101746792 | 3300024346 | Estuarine | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMD |
| Ga0244775_104545722 | 3300024346 | Estuarine | YSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVGQMN |
| Ga0244776_100300885 | 3300024348 | Estuarine | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFAL |
| Ga0255185_10159921 | 3300024490 | Freshwater | MAGLLHRTAQPLTLAAFRPWEGSAGAGRVRPAGTNLMNI |
| Ga0256339_10380322 | 3300024857 | Freshwater | VAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVGQKGGLKKTKRE |
| Ga0208882_10531392 | 3300024980 | Freshwater Sediment | RKKEKMAGYSHRTAQPPILAVFLPWGVSAGAGRMRPAAAKVRFEN |
| Ga0208870_10002038 | 3300025356 | Freshwater | VAGYSHRTAQPLILATFLSWGGSAGAGRVRPAAANVL |
| Ga0255244_10128491 | 3300025745 | Freshwater | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAVAKVRFALNSP |
| Ga0207642_106039632 | 3300025899 | Miscanthus Rhizosphere | MAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAAANIGKNF |
| Ga0207704_106429961 | 3300025938 | Miscanthus Rhizosphere | MAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAAANIGKNFRRKRQDAEG |
| Ga0207677_118259522 | 3300026023 | Miscanthus Rhizosphere | MAGLLHRTAQPPTLAAFLPWEGSAGAGRVRPAAANIVYEFK |
| Ga0179593_10650471 | 3300026555 | Vadose Zone Soil | MASYLHRTAQPSTLAAFRPWGSSTGAGRIRLAAANIRAYHKYVSQFLI |
| Ga0208443_10232711 | 3300027084 | Estuarine | MAGLLHRTAQPLTLAAFRPWEGSAGAGRVRPATAKLMN |
| Ga0208163_10598522 | 3300027198 | Estuarine | VAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGANVGQMN |
| Ga0208927_10266452 | 3300027220 | Estuarine | VAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGAKVVKTD |
| Ga0208806_10813512 | 3300027242 | Estuarine | PRNRRGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP |
| Ga0208932_10077762 | 3300027256 | Estuarine | MAGLLHRTAQPLTLAAFRPWEGSAGAGRVRPAGAKVRFALNSP |
| Ga0208178_10359522 | 3300027259 | Estuarine | MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFA |
| Ga0208178_10757822 | 3300027259 | Estuarine | HRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP |
| Ga0208440_10588732 | 3300027281 | Estuarine | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVG |
| Ga0208022_10208213 | 3300027418 | Estuarine | MAGLLHRTAQPLTLAAFRPWEGSAGAGRVRPAGTN |
| Ga0208788_10099083 | 3300027499 | Deep Subsurface | MAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIIEFNEEKN |
| Ga0208960_10178341 | 3300027649 | Freshwater Lentic | VAGYSHHTAQPPILAVFLPWGNSAGAGRVRPAGANVGQMD |
| Ga0209278_10107144 | 3300027673 | Wastewater Effluent | VAGYSHRTAQPPILAVFLPWGGSAGAGRIRPADAKIRE |
| Ga0209551_10318961 | 3300027689 | Freshwater Lake | YSHHTAQPPILAVFLPWGNSAGAGRVRPAGANVGQMD |
| Ga0209170_100038213 | 3300027694 | Activated Sludge | MAGLLHRTAQPPTLAAFRPWEDSAGAGRVRPAVAKIRV |
| Ga0209443_11340302 | 3300027707 | Freshwater Lake | MAGYSHRTAQPLILATFLSWGDSAGAGRVRPADANVGQRMD |
| Ga0209443_12418531 | 3300027707 | Freshwater Lake | HRTAQPLILAVFLPWGGSAGAGRVRPAGTKVRFALNSP |
| Ga0209599_100097782 | 3300027710 | Deep Subsurface | MAGYSHRTAQPPILAVFLPWGVSAGAGRVRPAGAKVRFEN |
| Ga0209261_100285643 | 3300027735 | Wetland Sediment | MAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPAGAKIREQR |
| Ga0209190_11054422 | 3300027736 | Freshwater Lake | KKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADAKITVFLKENK |
| Ga0209597_10364032 | 3300027746 | Freshwater Lake | MYFWNKKMAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADTKITVFLKENK |
| Ga0209084_10228792 | 3300027749 | Freshwater Lake | VAGYSHRTAQPLILATFLSWGGSAGAGRVRPAGANVG |
| Ga0209296_12522562 | 3300027759 | Freshwater Lake | VAGYSHHTAQPPILAVFLPWGSSAGAGRVRPAGANVAQL |
| Ga0209086_100997062 | 3300027770 | Freshwater Lake | MAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADAKITVFLKENK |
| Ga0209972_104634142 | 3300027793 | Freshwater Lake | VAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGAKVGK |
| Ga0209480_100081782 | 3300027794 | Wastewater Effluent | VAGYSHRTAQPPILAVFLPWGGSAGAGRIRPATAKIRD |
| Ga0209229_100184062 | 3300027805 | Freshwater And Sediment | MAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAGAKIIEINEGKN |
| Ga0209230_1000063213 | 3300027836 | Freshwater And Sediment | IPRNRRGIKKMAGYSHRTAQPLILAVFLPWGGSAGAGRVRPADTKVRFALNSP |
| Ga0209798_100054311 | 3300027843 | Wetland Sediment | KMAGLLHRTAQPPTLAAFRPWEGSAGAGRVRPAGAKIREQR |
| Ga0209067_102042583 | 3300027898 | Watersheds | MAGYSHRTAQPPILAVFLPWGDSAGAGRVRPAGAKVRFE |
| Ga0209191_10822222 | 3300027969 | Freshwater Lake | MAGYSHRTAQPLVLAVFLPWGVSAGAGRVRPAAANVGGSCLLTN |
| Ga0304730_12722911 | 3300028394 | Freshwater Lake | AGLLHRTAQPPTLATFRSWGSSAGAGRVRPADAKITVFLKENK |
| Ga0268299_10969101 | 3300028648 | Activated Sludge | YSSEVKKMAGYSHRTAQPPILAVFLPWGVSAGAGRIRPASAKVRVLIF |
| Ga0302323_1005698223 | 3300031232 | Fen | MAGDLHRTAQPPTLAAFRPWGGSAGAGRTRPAGANIGMN |
| Ga0311351_107431912 | 3300031722 | Fen | MAGLLHRTAQPPTLAAFRPWEVSAGAGRVRPAVAKIRS |
| Ga0315907_100411472 | 3300031758 | Freshwater | MAGCLHRTAQPPTLATFRSWGSSAGAGRVRPAAAKIIEINEGKN |
| Ga0315907_101843853 | 3300031758 | Freshwater | MAGLLHRTAQPPTLATFRSWGSSAGAGRVRPADANIKKFKRPFKNTMAEI |
| Ga0315907_108580652 | 3300031758 | Freshwater | MAGYSHRTAQPLILAAFLPWGGSAGAGRARPATPQK |
| Ga0315899_115352502 | 3300031784 | Freshwater | AGYSHRTAQPLILATFLSWGGSAGAGRVRPAGANVGQMRGLKKRWNN |
| Ga0315908_103971251 | 3300031786 | Freshwater | AQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNSP |
| Ga0315909_104561082 | 3300031857 | Freshwater | VAGYSHRTAQPPILAVFLPWGGSAGAGRVRPAGAKV |
| Ga0315278_100210965 | 3300031997 | Sediment | MAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAGAKIWKNHKKRLNLD |
| Ga0315906_100292333 | 3300032050 | Freshwater | MAGDLHRTAQPPTLAAFRPWGSSAGAGRVRPASANVKQLKK |
| Ga0315276_107399903 | 3300032177 | Sediment | MAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAGAKIRKNHK |
| Ga0315273_100580632 | 3300032516 | Sediment | MAGDLHHTAQPPTLAAFRPWGSSAGAGRVRPAGAKIRKNHKKRLNLD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |