Metagenome / Metatranscriptome Family F021566

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F021566
Family Type	Metagenome / Metatranscriptome
Number of Sequences	218
Average Sequence Length	40 residues
Representative Sequence	MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA
Number of Associated Samples	90
Number of Associated Scaffolds	218

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	83.89 %
% of genes near scaffold ends (potentially truncated)	17.89 %
% of genes from short scaffolds (< 2000 bps)	72.94 %
Associated GOLD sequencing projects	72
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (55.505 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (21.560 % of family members)
Environment Ontology (ENVO)	Unclassified (28.440 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Sediment (non-saline) (29.817 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 218 Family Scaffolds
PF13602	ADH_zinc_N_2	50.00
PF00080	Sod_Cu	12.39
PF13549	ATP-grasp_5	7.34
PF13302	Acetyltransf_3	6.88
PF02566	OsmC	5.96
PF08240	ADH_N	2.29
PF00583	Acetyltransf_1	1.38
PF00005	ABC_tran	0.92
PF13607	Succ_CoA_lig	0.92
PF12704	MacB_PCD	0.92
PF11583	AurF	0.92
PF07396	Porin_O_P	0.92
PF13091	PLDc_2	0.46
PF00850	Hist_deacetyl	0.46
PF10617	DUF2474	0.46
PF03060	NMO	0.46
PF06974	WS_DGAT_C	0.46
PF12860	PAS_7	0.46
PF08002	DUF1697	0.46
PF04952	AstE_AspA	0.46

COG ID	Name	Functional Category	% Frequency in 218 Family Scaffolds
COG2032	Cu/Zn superoxide dismutase	Inorganic ion transport and metabolism [P]	12.39
COG1764	Organic hydroperoxide reductase OsmC/OhrA	Defense mechanisms [V]	5.96
COG1765	Uncharacterized OsmC-related protein	General function prediction only [R]	5.96
COG0123	Acetoin utilization deacetylase AcuC or a related deacetylase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.92
COG3746	Phosphate-selective porin	Inorganic ion transport and metabolism [P]	0.92
COG0516	IMP dehydrogenase/GMP reductase	Nucleotide transport and metabolism [F]	0.46
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	0.46
COG3797	Uncharacterized conserved protein, DUF1697 family	Function unknown [S]	0.46

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	55.50 %
Unclassified	root	N/A	44.50 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	55.50 %
Unclassified	root	N/A	44.50 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	55.50 %
Unclassified	root	N/A	44.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.50 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	27.52 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	2.29 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.46 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.50 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	19.72 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	2.29 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.46 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.46 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.50 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	15.14 %
Leptospirales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales	2.29 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.46 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.46 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.50 %
unclassified Xanthomonadales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales	11.01 %
Leptospiraceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae	2.29 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1.38 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.46 %
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	0.46 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.46 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.50 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	11.01 %
Leptospira	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	2.29 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1.38 %
Marinilabiliales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales	0.46 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.46 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.46 %
Sorangiineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.50 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	11.01 %
Leptospira	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	2.29 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1.38 %
Prolixibacteraceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae	0.46 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.46 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.46 %
Polyangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.50 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	11.01 %
Leptospira	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	2.29 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1.38 %
Sunxiuqinia	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia	0.46 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.46 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.46 %
Sorangium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.50 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	11.01 %
Leptospira	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	2.29 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1.38 %
Sunxiuqinia indica	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia indica	0.46 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.46 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.46 %
Sorangium cellulosum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum	0.92 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2010549000\|RicEn_FSXC82502_b1	All Organisms → cellular organisms → Bacteria	670	Open in IMG/M
3300003858\|Ga0031656_10000729	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	11808	Open in IMG/M
3300003858\|Ga0031656_10009576	All Organisms → cellular organisms → Bacteria → Proteobacteria	4043	Open in IMG/M
3300003858\|Ga0031656_10012462	All Organisms → cellular organisms → Bacteria	3560	Open in IMG/M
3300003858\|Ga0031656_10017139	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3033	Open in IMG/M
3300003858\|Ga0031656_10120712	Not Available	936	Open in IMG/M
3300003859\|Ga0031653_10082394	Not Available	847	Open in IMG/M
3300004026\|Ga0055443_10158692	Not Available	686	Open in IMG/M
3300004048\|Ga0055494_10000177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	4530	Open in IMG/M
3300004048\|Ga0055494_10011721	All Organisms → cellular organisms → Bacteria	1293	Open in IMG/M
3300004048\|Ga0055494_10047292	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	817	Open in IMG/M
3300004049\|Ga0055493_10015266	All Organisms → cellular organisms → Bacteria	1161	Open in IMG/M
3300004049\|Ga0055493_10087089	Not Available	650	Open in IMG/M
3300004049\|Ga0055493_10171069	Not Available	506	Open in IMG/M
3300004050\|Ga0055491_10037650	Not Available	1038	Open in IMG/M
3300004051\|Ga0055492_10014863	Not Available	1263	Open in IMG/M
3300004071\|Ga0055486_10109172	Not Available	636	Open in IMG/M
3300004146\|Ga0055495_10050543	Not Available	866	Open in IMG/M
3300004154\|Ga0066603_10049213	All Organisms → cellular organisms → Bacteria → Proteobacteria	1797	Open in IMG/M
3300004481\|Ga0069718_10017699	All Organisms → cellular organisms → Bacteria	1530	Open in IMG/M
3300004481\|Ga0069718_14687451	Not Available	838	Open in IMG/M
3300006224\|Ga0079037_100000010	All Organisms → cellular organisms → Bacteria → Proteobacteria	57853	Open in IMG/M
3300006224\|Ga0079037_100000164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	25197	Open in IMG/M
3300006224\|Ga0079037_100002833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	9749	Open in IMG/M
3300006224\|Ga0079037_100031157	All Organisms → cellular organisms → Bacteria	3945	Open in IMG/M
3300006224\|Ga0079037_100063861	All Organisms → cellular organisms → Bacteria	2947	Open in IMG/M
3300006224\|Ga0079037_100089240	All Organisms → cellular organisms → Bacteria → Proteobacteria	2556	Open in IMG/M
3300006224\|Ga0079037_100131694	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	2160	Open in IMG/M
3300006224\|Ga0079037_100135766	All Organisms → cellular organisms → Bacteria	2131	Open in IMG/M
3300006224\|Ga0079037_100272217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1558	Open in IMG/M
3300006224\|Ga0079037_100366056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1356	Open in IMG/M
3300006224\|Ga0079037_100490907	Not Available	1177	Open in IMG/M
3300006224\|Ga0079037_100652610	All Organisms → cellular organisms → Bacteria	1024	Open in IMG/M
3300006224\|Ga0079037_101027742	Not Available	816	Open in IMG/M
3300006224\|Ga0079037_101271212	Not Available	732	Open in IMG/M
3300006224\|Ga0079037_101549313	Not Available	662	Open in IMG/M
3300006224\|Ga0079037_101767465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	618	Open in IMG/M
3300006224\|Ga0079037_101932510	Not Available	590	Open in IMG/M
3300006224\|Ga0079037_101934409	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300009009\|Ga0105105_10001937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	8529	Open in IMG/M
3300009009\|Ga0105105_10021940	All Organisms → cellular organisms → Bacteria → Proteobacteria	2687	Open in IMG/M
3300009009\|Ga0105105_10573852	Not Available	655	Open in IMG/M
3300009037\|Ga0105093_10765951	Not Available	558	Open in IMG/M
3300009075\|Ga0105090_10001102	All Organisms → cellular organisms → Bacteria → Proteobacteria	14312	Open in IMG/M
3300009075\|Ga0105090_10003423	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	9013	Open in IMG/M
3300009075\|Ga0105090_10004065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	8378	Open in IMG/M
3300009075\|Ga0105090_10010583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	5497	Open in IMG/M
3300009075\|Ga0105090_10026562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3591	Open in IMG/M
3300009075\|Ga0105090_10048071	All Organisms → cellular organisms → Bacteria	2665	Open in IMG/M
3300009075\|Ga0105090_10092439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1893	Open in IMG/M
3300009075\|Ga0105090_10125267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1606	Open in IMG/M
3300009078\|Ga0105106_10072894	All Organisms → cellular organisms → Bacteria	2528	Open in IMG/M
3300009078\|Ga0105106_10366641	Not Available	1040	Open in IMG/M
3300009078\|Ga0105106_10381214	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1017	Open in IMG/M
3300009081\|Ga0105098_10078151	Not Available	1395	Open in IMG/M
3300009082\|Ga0105099_10736327	Not Available	614	Open in IMG/M
3300009085\|Ga0105103_10145944	All Organisms → cellular organisms → Bacteria	1248	Open in IMG/M
3300009091\|Ga0102851_10418079	All Organisms → cellular organisms → Bacteria	1354	Open in IMG/M
3300009091\|Ga0102851_10524723	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	1222	Open in IMG/M
3300009091\|Ga0102851_10824069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	994	Open in IMG/M
3300009091\|Ga0102851_11150733	Not Available	851	Open in IMG/M
3300009091\|Ga0102851_11722718	Not Available	704	Open in IMG/M
3300009091\|Ga0102851_13127937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	531	Open in IMG/M
3300009111\|Ga0115026_10983317	All Organisms → cellular organisms → Bacteria	673	Open in IMG/M
3300009120\|Ga0117941_1000146	All Organisms → cellular organisms → Bacteria → Proteobacteria	23529	Open in IMG/M
3300009131\|Ga0115027_10715031	Not Available	753	Open in IMG/M
3300009153\|Ga0105094_10108762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1567	Open in IMG/M
3300009165\|Ga0105102_10216246	Not Available	964	Open in IMG/M
3300009165\|Ga0105102_10450608	All Organisms → cellular organisms → Bacteria	691	Open in IMG/M
3300009166\|Ga0105100_10593491	All Organisms → cellular organisms → Bacteria	679	Open in IMG/M
3300009166\|Ga0105100_10808436	Not Available	581	Open in IMG/M
3300009167\|Ga0113563_10300582	All Organisms → cellular organisms → Bacteria	1664	Open in IMG/M
3300009167\|Ga0113563_10306086	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum	1651	Open in IMG/M
3300009169\|Ga0105097_10172942	Not Available	1189	Open in IMG/M
3300009169\|Ga0105097_10248594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	980	Open in IMG/M
3300009170\|Ga0105096_10119094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1321	Open in IMG/M
3300009170\|Ga0105096_10402322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	706	Open in IMG/M
3300009179\|Ga0115028_10010028	Not Available	3544	Open in IMG/M
3300009430\|Ga0114938_1007743	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	5314	Open in IMG/M
3300009430\|Ga0114938_1027026	All Organisms → cellular organisms → Bacteria	2282	Open in IMG/M
3300009506\|Ga0118657_10129547	All Organisms → cellular organisms → Bacteria	3641	Open in IMG/M
3300009506\|Ga0118657_10279794	All Organisms → cellular organisms → Bacteria	2258	Open in IMG/M
3300009509\|Ga0123573_10020648	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	13132	Open in IMG/M
3300009509\|Ga0123573_10061448	All Organisms → cellular organisms → Bacteria → Proteobacteria	3959	Open in IMG/M
3300009509\|Ga0123573_10217150	All Organisms → cellular organisms → Bacteria	1880	Open in IMG/M
3300009509\|Ga0123573_10738696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	924	Open in IMG/M
3300009776\|Ga0116154_10026385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	2905	Open in IMG/M
3300009776\|Ga0116154_10330085	Not Available	654	Open in IMG/M
3300009868\|Ga0130016_10140310	All Organisms → cellular organisms → Bacteria → Proteobacteria	1967	Open in IMG/M
3300009868\|Ga0130016_10368343	Not Available	968	Open in IMG/M
3300010051\|Ga0133939_1005550	All Organisms → cellular organisms → Bacteria → Proteobacteria	29740	Open in IMG/M
3300010412\|Ga0136852_10226879	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1859	Open in IMG/M
3300010412\|Ga0136852_10279171	All Organisms → cellular organisms → Bacteria → Proteobacteria	1650	Open in IMG/M
3300010412\|Ga0136852_10794351	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300014264\|Ga0075308_1079589	Not Available	679	Open in IMG/M
3300014296\|Ga0075344_1057185	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300014298\|Ga0075341_1123966	Not Available	528	Open in IMG/M
3300014306\|Ga0075346_1175347	Not Available	512	Open in IMG/M
3300014312\|Ga0075345_1012568	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1494	Open in IMG/M
3300014312\|Ga0075345_1145961	Not Available	566	Open in IMG/M
3300014312\|Ga0075345_1166038	Not Available	540	Open in IMG/M
3300014313\|Ga0075347_1024925	All Organisms → cellular organisms → Bacteria	1133	Open in IMG/M
3300014313\|Ga0075347_1139931	All Organisms → cellular organisms → Bacteria	575	Open in IMG/M
3300014316\|Ga0075339_1122785	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	701	Open in IMG/M
3300014319\|Ga0075348_1011085	All Organisms → cellular organisms → Bacteria	1736	Open in IMG/M
3300014319\|Ga0075348_1064385	Not Available	871	Open in IMG/M
3300014319\|Ga0075348_1073236	Not Available	826	Open in IMG/M
3300014319\|Ga0075348_1115864	Not Available	685	Open in IMG/M
3300020048\|Ga0207193_1224321	Not Available	1453	Open in IMG/M
3300021346\|Ga0210335_1431668	Not Available	875	Open in IMG/M
3300022213\|Ga0224500_10009521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	4460	Open in IMG/M
3300025106\|Ga0209398_1013231	All Organisms → cellular organisms → Bacteria	2644	Open in IMG/M
3300025106\|Ga0209398_1016679	All Organisms → cellular organisms → Bacteria	2260	Open in IMG/M
3300025561\|Ga0210119_1067555	Not Available	686	Open in IMG/M
3300025706\|Ga0209507_1098753	Not Available	818	Open in IMG/M
3300025715\|Ga0209310_1228032	Not Available	522	Open in IMG/M
3300025715\|Ga0209310_1239519	Not Available	506	Open in IMG/M
3300025950\|Ga0210134_1006520	Not Available	1705	Open in IMG/M
3300025950\|Ga0210134_1039414	Not Available	658	Open in IMG/M
3300025956\|Ga0210104_1009808	All Organisms → cellular organisms → Bacteria	1139	Open in IMG/M
3300025964\|Ga0210127_1032780	Not Available	619	Open in IMG/M
3300025966\|Ga0210105_1001210	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia indica	3970	Open in IMG/M
3300025968\|Ga0210103_1003420	All Organisms → cellular organisms → Bacteria	2913	Open in IMG/M
3300025968\|Ga0210103_1010411	All Organisms → cellular organisms → Bacteria	1653	Open in IMG/M
3300025968\|Ga0210103_1072065	Not Available	567	Open in IMG/M
3300026476\|Ga0256808_1063417	Not Available	555	Open in IMG/M
3300027683\|Ga0209392_1000586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	8605	Open in IMG/M
3300027683\|Ga0209392_1002826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	4785	Open in IMG/M
3300027683\|Ga0209392_1008605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	3073	Open in IMG/M
3300027683\|Ga0209392_1020234	All Organisms → cellular organisms → Bacteria	2117	Open in IMG/M
3300027683\|Ga0209392_1027141	All Organisms → cellular organisms → Bacteria	1843	Open in IMG/M
3300027683\|Ga0209392_1032959	All Organisms → cellular organisms → Bacteria	1679	Open in IMG/M
3300027693\|Ga0209704_1013636	All Organisms → cellular organisms → Bacteria	1976	Open in IMG/M
3300027693\|Ga0209704_1071913	All Organisms → cellular organisms → Bacteria	965	Open in IMG/M
3300027719\|Ga0209467_1216595	All Organisms → cellular organisms → Bacteria	662	Open in IMG/M
3300027721\|Ga0209492_1011982	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	2909	Open in IMG/M
3300027721\|Ga0209492_1084340	Not Available	1121	Open in IMG/M
3300027721\|Ga0209492_1132404	All Organisms → cellular organisms → Bacteria	873	Open in IMG/M
3300027762\|Ga0209288_10009813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2686	Open in IMG/M
3300027871\|Ga0209397_10021521	All Organisms → cellular organisms → Bacteria	2031	Open in IMG/M
3300027871\|Ga0209397_10083467	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	1297	Open in IMG/M
3300027871\|Ga0209397_10130608	All Organisms → cellular organisms → Bacteria	1094	Open in IMG/M
3300027871\|Ga0209397_10131096	All Organisms → cellular organisms → Bacteria	1093	Open in IMG/M
3300027871\|Ga0209397_10139635	Not Available	1065	Open in IMG/M
3300027871\|Ga0209397_10210980	All Organisms → cellular organisms → Bacteria	897	Open in IMG/M
3300027871\|Ga0209397_10604287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	549	Open in IMG/M
3300027877\|Ga0209293_10722290	Not Available	528	Open in IMG/M
3300027885\|Ga0209450_10000370	All Organisms → cellular organisms → Bacteria → Proteobacteria	23711	Open in IMG/M
3300027885\|Ga0209450_10034128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3018	Open in IMG/M
3300027885\|Ga0209450_10117147	Not Available	1795	Open in IMG/M
3300027885\|Ga0209450_10197639	Not Available	1418	Open in IMG/M
3300027885\|Ga0209450_10876996	Not Available	643	Open in IMG/M
3300027885\|Ga0209450_10884016	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	640	Open in IMG/M
3300027885\|Ga0209450_11136340	Not Available	546	Open in IMG/M
3300027890\|Ga0209496_10574136	Not Available	607	Open in IMG/M
3300027890\|Ga0209496_10789879	Not Available	524	Open in IMG/M
3300027897\|Ga0209254_10001094	All Organisms → cellular organisms → Bacteria → Proteobacteria	23891	Open in IMG/M
3300027897\|Ga0209254_10650966	Not Available	734	Open in IMG/M
3300027897\|Ga0209254_10735782	Not Available	676	Open in IMG/M
3300027899\|Ga0209668_10001227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	10910	Open in IMG/M
3300027899\|Ga0209668_10165327	All Organisms → cellular organisms → Bacteria	1353	Open in IMG/M
3300027956\|Ga0209820_1130259	Not Available	691	Open in IMG/M
3300027975\|Ga0209391_10004813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	7192	Open in IMG/M
3300027975\|Ga0209391_10067933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1639	Open in IMG/M
3300027975\|Ga0209391_10207577	Not Available	810	Open in IMG/M
3300033406\|Ga0316604_10102294	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum	1506	Open in IMG/M
3300033406\|Ga0316604_10188092	Not Available	1112	Open in IMG/M
3300033406\|Ga0316604_10368999	Not Available	786	Open in IMG/M
3300033406\|Ga0316604_10452408	Not Available	705	Open in IMG/M
3300033406\|Ga0316604_10557680	Not Available	630	Open in IMG/M
3300033406\|Ga0316604_10795918	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	519	Open in IMG/M
3300033408\|Ga0316605_10190569	All Organisms → cellular organisms → Bacteria	1713	Open in IMG/M
3300033408\|Ga0316605_12220493	Not Available	534	Open in IMG/M
3300033413\|Ga0316603_10289859	Not Available	1441	Open in IMG/M
3300033413\|Ga0316603_10472563	Not Available	1146	Open in IMG/M
3300033413\|Ga0316603_10524727	Not Available	1090	Open in IMG/M
3300033413\|Ga0316603_10745386	Not Available	917	Open in IMG/M
3300033413\|Ga0316603_11144634	Not Available	736	Open in IMG/M
3300033413\|Ga0316603_11542084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	630	Open in IMG/M
3300033413\|Ga0316603_12031194	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300033414\|Ga0316619_10485498	Not Available	1002	Open in IMG/M
3300033414\|Ga0316619_10647445	All Organisms → cellular organisms → Bacteria → Proteobacteria	885	Open in IMG/M
3300033414\|Ga0316619_10839337	Not Available	788	Open in IMG/M
3300033414\|Ga0316619_11123111	Not Available	690	Open in IMG/M
3300033416\|Ga0316622_100001264	All Organisms → cellular organisms → Bacteria	16238	Open in IMG/M
3300033416\|Ga0316622_100057753	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	3686	Open in IMG/M
3300033416\|Ga0316622_100093057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	2998	Open in IMG/M
3300033416\|Ga0316622_100790288	Not Available	1102	Open in IMG/M
3300033416\|Ga0316622_102591116	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300033416\|Ga0316622_103331527	Not Available	507	Open in IMG/M
3300033418\|Ga0316625_100574386	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300033419\|Ga0316601_100279428	Not Available	1517	Open in IMG/M
3300033419\|Ga0316601_101018396	Not Available	827	Open in IMG/M
3300033419\|Ga0316601_101985157	Not Available	586	Open in IMG/M
3300033419\|Ga0316601_102407205	Not Available	530	Open in IMG/M
3300033434\|Ga0316613_10558948	Not Available	780	Open in IMG/M
3300033481\|Ga0316600_10608381	All Organisms → cellular organisms → Bacteria	764	Open in IMG/M
3300033482\|Ga0316627_100834392	Not Available	875	Open in IMG/M
3300033482\|Ga0316627_101178198	Not Available	756	Open in IMG/M
3300033482\|Ga0316627_101477255	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300033485\|Ga0316626_10243617	All Organisms → cellular organisms → Bacteria	1437	Open in IMG/M
3300033487\|Ga0316630_10189598	All Organisms → cellular organisms → Bacteria	1498	Open in IMG/M
3300033487\|Ga0316630_11920588	Not Available	542	Open in IMG/M
3300033487\|Ga0316630_12016053	Not Available	530	Open in IMG/M
3300033493\|Ga0316631_10070539	Not Available	1179	Open in IMG/M
3300033521\|Ga0316616_100773375	All Organisms → cellular organisms → Bacteria	1163	Open in IMG/M
3300033557\|Ga0316617_100446075	Not Available	1157	Open in IMG/M
3300033557\|Ga0316617_101033096	All Organisms → cellular organisms → Bacteria	806	Open in IMG/M
3300034052\|Ga0373889_048700	Not Available	659	Open in IMG/M
3300034055\|Ga0373892_025389	Not Available	743	Open in IMG/M
3300034420\|Ga0373918_0083736	Not Available	799	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	94.04%
Engineered	Engineered	5.50%
Host-Associated	Host-Associated	0.46%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	66.05%
Terrestrial	Environmental → Terrestrial	27.98%
Wastewater	Engineered → Wastewater	4.13%
Bioremediation	Engineered → Bioremediation	1.38%
Plants	Host-Associated → Plants	0.46%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	51.38%
Soil	Environmental → Terrestrial → Soil	27.98%
Marine	Environmental → Aquatic → Marine	11.01%
Sediment	Environmental → Aquatic → Sediment	3.67%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	2.29%
Activated Sludge	Engineered → Wastewater → Activated Sludge	1.38%
Metal	Engineered → Bioremediation → Metal	1.38%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.46%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.46%

Habitat	Taxonomy	Distribution
Wetlands	Environmental → Terrestrial → Soil → Wetlands	27.98%
Sediment	Environmental → Aquatic → Freshwater → Sediment	27.06%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	12.84%
Wetlands	Environmental → Aquatic → Marine → Wetlands	10.09%
Lentic	Environmental → Aquatic → Freshwater → Lentic	8.26%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.67%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	2.29%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.83%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	1.38%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	1.38%
Pond	Environmental → Aquatic → Freshwater → Pond	0.92%
Lake	Environmental → Aquatic → Freshwater → Lake	0.46%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.46%
Sediment	Environmental → Aquatic → Marine → Sediment	0.46%
Endophytes	Host-Associated → Plants → Rhizoplane → Endophytes	0.46%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.46%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	27.98%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	27.06%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	12.39%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	9.17%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	8.26%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.67%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	2.29%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.83%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	1.38%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	1.38%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	0.92%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.92%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.46%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.46%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.46%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Endophytes → Unclassified	0.46%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.46%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	21.56%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	19.72%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	12.39%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	9.17%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	8.26%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	6.42%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	6.42%
Mangrove Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment	3.21%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	2.29%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	1.83%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	1.38%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	1.38%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.92%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	0.92%
Mangrove Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment	0.92%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.46%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.46%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.46%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.46%
Lake Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment	0.46%
Rice Endophytes	Host-Associated → Plants → Rhizoplane → Endophytes → Unclassified → Rice Endophytes	0.46%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater	0.46%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2010549000	Rice endophytes microbial communities from Berkeley, California, USA	Host-Associated	Open in IMG/M
3300003858	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI	Environmental	Open in IMG/M
3300003859	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR	Environmental	Open in IMG/M
3300004026	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2	Environmental	Open in IMG/M
3300004048	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2	Environmental	Open in IMG/M
3300004049	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2	Environmental	Open in IMG/M
3300004050	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2	Environmental	Open in IMG/M
3300004051	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2	Environmental	Open in IMG/M
3300004071	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2	Environmental	Open in IMG/M
3300004146	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2	Environmental	Open in IMG/M
3300004154	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009037	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009075	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009120	Lake sediment microbial communities from Tanners Lake, St. Paul, MN	Environmental	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009153	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009179	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1	Environmental	Open in IMG/M
3300009430	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring	Environmental	Open in IMG/M
3300009506	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8	Environmental	Open in IMG/M
3300009509	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11	Environmental	Open in IMG/M
3300009776	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG	Engineered	Open in IMG/M
3300009868	Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant	Engineered	Open in IMG/M
3300010051	Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196	Engineered	Open in IMG/M
3300010412	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10	Environmental	Open in IMG/M
3300014264	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd	Environmental	Open in IMG/M
3300014296	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1	Environmental	Open in IMG/M
3300014298	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1	Environmental	Open in IMG/M
3300014306	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1	Environmental	Open in IMG/M
3300014312	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1	Environmental	Open in IMG/M
3300014313	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1	Environmental	Open in IMG/M
3300014316	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1	Environmental	Open in IMG/M
3300014319	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300021346	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.374 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022213	Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1	Environmental	Open in IMG/M
3300025106	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes)	Environmental	Open in IMG/M
3300025561	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025706	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025715	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025950	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025956	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025964	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025966	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025968	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes)	Environmental	Open in IMG/M
3300026476	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6	Environmental	Open in IMG/M
3300027683	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027693	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027719	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027762	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027871	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027890	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300027956	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027975	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300033406	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental	Open in IMG/M
3300033416	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033434	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b	Environmental	Open in IMG/M
3300033481	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033485	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A	Environmental	Open in IMG/M
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental	Open in IMG/M
3300033493	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300034052	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2	Engineered	Open in IMG/M
3300034055	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.2	Engineered	Open in IMG/M
3300034420	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.1	Engineered	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
RicEn_592700	2010549000	Rice Endophytes	MFTCKSYDKFTARVLAGLVLAVTIVFGSLTYAVSNVQAYI
Ga0031656_100007296	3300003858	Freshwater Lake Sediment	MFTCNNVDRFTTRVLAGLVVSVTIVFGSLTYAVSNIQAYA*
Ga0031656_100095763	3300003858	Freshwater Lake Sediment	MFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNIQVFA*
Ga0031656_100124622	3300003858	Freshwater Lake Sediment	MFTCKSADRFTTRILAGLVVAVAIMFGSLTHAVVNFQAFA*
Ga0031656_100171394	3300003858	Freshwater Lake Sediment	MFTCSNADSFTTRILAGLVVSVMIVMGSLTYAVANIQTFA*
Ga0031656_101207121	3300003858	Freshwater Lake Sediment	MFACKNVDRFTTRILAGLVVAVTIVFGSLTHAVAGLQAFA*
Ga0031653_100823942	3300003859	Freshwater Lake Sediment	MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQVYA*
Ga0055443_101586921	3300004026	Natural And Restored Wetlands	MFTCKNVDSFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA*
Ga0055494_100001772	3300004048	Natural And Restored Wetlands	MFTCNSADRFTTRVLAGLVVAATILFGSLTHAVVNFQAFA*
Ga0055494_100117212	3300004048	Natural And Restored Wetlands	MFTCSNNDRFATRVLAGLVVTVAIVMGSLTYAVSNIQAFA*
Ga0055494_100472921	3300004048	Natural And Restored Wetlands	MFTCNSVDTFTTRVLAGLVLAVTVVLGSLTHAVANMQAFV*
Ga0055493_100152662	3300004049	Natural And Restored Wetlands	MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAYA*
Ga0055493_100870892	3300004049	Natural And Restored Wetlands	MFTCKSYDKFAARVLAGLVLAVTIVFGSLTYAVSNVQAYI*
Ga0055493_101710691	3300004049	Natural And Restored Wetlands	MFTCNNVDRFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA*
Ga0055491_100376502	3300004050	Natural And Restored Wetlands	MFSCNHADAFTTRILAGLVLAVTVVIGSLTFAVANIQVVA*
Ga0055492_100148631	3300004051	Natural And Restored Wetlands	EDQAMFTCNSADRFTTRVLAGLVVAATILFGSLTHAVVNFQAFA*
Ga0055486_101091722	3300004071	Natural And Restored Wetlands	MFTCNNVDRFTARILSGLVVSVTIVFGSLTYAVSHMQAFA*
Ga0055495_100505432	3300004146	Natural And Restored Wetlands	MFSCNHADAFTTRILAGLVLAVTVVIGSLTYAVANIQVVA*
Ga0066603_100492133	3300004154	Freshwater	MLTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA*
Ga0069718_100176992	3300004481	Sediment	MFTCNNADRFTTRVLAGLVVTVTIVFGSLTYAVSNIQVYA*
Ga0069718_146874512	3300004481	Sediment	MFTCIKADKFTTRVLAGLVVTVTIVFGSLTHAVSNVQAFA*
Ga0079037_10000001016	3300006224	Freshwater Wetlands	MFTCNATDRFASRVLAGLVLAVTIVMGSLTYAVANIQAYA*
Ga0079037_1000001647	3300006224	Freshwater Wetlands	MFTCKTYDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI*
Ga0079037_1000028333	3300006224	Freshwater Wetlands	MFSCNHADAFTTRILAGLVLAVTIVVGSLTYAVANIQVVA*
Ga0079037_1000311572	3300006224	Freshwater Wetlands	MLTCNETDRFTTRVLAGLVLAVTVVMGSLTYAVANIQAFA*
Ga0079037_1000451574	3300006224	Freshwater Wetlands	MTTCTKYDRFSTRLFAGLVIAVTIVMGSLTYALSHVQVYA*
Ga0079037_1000638612	3300006224	Freshwater Wetlands	MFTCSNNDRFATRVFAGLVVTVAIVMGSLTYAVSNIQAFA*
Ga0079037_1000892401	3300006224	Freshwater Wetlands	TCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA*
Ga0079037_1001316943	3300006224	Freshwater Wetlands	MFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA*
Ga0079037_1001357663	3300006224	Freshwater Wetlands	MFTCSNNDRFAARVLAGLVITVTIVMGSLTYAVSNIQAFA*
Ga0079037_1002722172	3300006224	Freshwater Wetlands	MFANCNNTDRFTVRLFAGLVVTVAMVMGSLTYAVANIQVFA*
Ga0079037_1003660562	3300006224	Freshwater Wetlands	MFTCSNADSFTTRILAGLVVSVMIVMGSLTYAVANIQAFA*
Ga0079037_1004909072	3300006224	Freshwater Wetlands	TMFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAVANIQMFA*
Ga0079037_1006526102	3300006224	Freshwater Wetlands	MFTCKSYDKFTTRVLAGLVITVAVAFGSLVHAVSNIETYI*
Ga0079037_1010277422	3300006224	Freshwater Wetlands	MLTCKTTDRFAARVFAGLVLTVAVVMGSLTYAVAHMQAYA*
Ga0079037_1012712122	3300006224	Freshwater Wetlands	MFTCTDTDRFTTRILAGLVLAVTIVVGSLTHAVANIQMFA*
Ga0079037_1015493132	3300006224	Freshwater Wetlands	MFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNMQVFA*
Ga0079037_1017674652	3300006224	Freshwater Wetlands	MLTCNETDRFTTRVLAGLVLAVTIVMGSLTYAVANIQTFA*
Ga0079037_1019325101	3300006224	Freshwater Wetlands	MFTCNRIDRFTTRVLAGLVLAVTIVVGSLTYAVANIQVIA*
Ga0079037_1019344092	3300006224	Freshwater Wetlands	MFASCSNTDRFTVRLFAGLVVTVAMVMGSLTYAVANIQVFA*
Ga0105105_100019373	3300009009	Freshwater Sediment	MFTCNEVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAYA*
Ga0105105_100219404	3300009009	Freshwater Sediment	MFTCTDTDRFTTRVLAGLVIAVTIVVGSLTHAVIGIQAFA*
Ga0105105_105738521	3300009009	Freshwater Sediment	MFTCKSYDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI*
Ga0105093_107659511	3300009037	Freshwater Sediment	MEDPKMFTCNNVDRFTTRVLAGLVVSVTIVFGSLTYAVSNMQAYA*
Ga0105090_100011024	3300009075	Freshwater Sediment	MFSCNHADAFTTRILAGLVLAVTIVMGSLTYAVANIQVVA*
Ga0105090_100034235	3300009075	Freshwater Sediment	MFTCKSYDKFTTRVLAGLVLAVTIVVGSLTHAVSNIETYI*
Ga0105090_100040652	3300009075	Freshwater Sediment	MFTCKSYDKFTTRVLAGLVITVAVAFGSLVHAVSSIETYI*
Ga0105090_100105836	3300009075	Freshwater Sediment	MLTCTDTDRFTTRILAGLVLAVTIVLGSLTHAVTNIQAFA*
Ga0105090_100265624	3300009075	Freshwater Sediment	MFTCNDTDRFTTRVLAGLVLAVTIVMGSLTYAVTNIQAFA*
Ga0105090_100480712	3300009075	Freshwater Sediment	MFTCKTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI*
Ga0105090_100924392	3300009075	Freshwater Sediment	MFTCTDTDRFTTRVLAGLVLAVTIVVGSLTHAVTNIQTFA*
Ga0105090_101252673	3300009075	Freshwater Sediment	MFSCNHADSFTTRVLAGLVLAVTIVIGSLTYAVANIQVVA*
Ga0105106_100728942	3300009078	Freshwater Sediment	MFTCKTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQAYI*
Ga0105106_103666412	3300009078	Freshwater Sediment	MFTCNNVDRFTTRVLAGLVVSVTIVFGSLTYAVSNMQAYA*
Ga0105106_103812142	3300009078	Freshwater Sediment	MITCSNADSFTTRILAGLVVSVMIVMGSLTYAVANIQTFA*
Ga0105098_100781513	3300009081	Freshwater Sediment	EDPTMFTCNNVDRFTTRVLAGLVVTVTIVFGSLTHAVSNIQAYA*
Ga0105099_107363272	3300009082	Freshwater Sediment	KTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI*
Ga0105103_101459442	3300009085	Freshwater Sediment	MEDPKMFTCNNVDRFTTRVLAGLVVTVTIVFGSLTHAVSNIHAYA*
Ga0102851_104180792	3300009091	Freshwater Wetlands	MFTCSNADSFTTRIVAGLVVSVMIVMGSLTYAVANIQAFA*
Ga0102851_105247232	3300009091	Freshwater Wetlands	FTCKSYDKFTTRVLAGLVITVAVAFGSLVHAVSNIETYI*
Ga0102851_108240691	3300009091	Freshwater Wetlands	MLTCNESDRFATRVMAGLVIAVTIVMGSLPYAVANTQAFA*
Ga0102851_111507332	3300009091	Freshwater Wetlands	MLTCNENDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA*
Ga0102851_117227181	3300009091	Freshwater Wetlands	MTTCNKYDRFSTRILAGLVIAVTIVFGSLTYALSNVQAYA*
Ga0102851_131279371	3300009091	Freshwater Wetlands	MSTCKNVDRFTTRILAGLVVAVTIVIGSLTHAVSGLQAFA*
Ga0115026_109833172	3300009111	Wetland	AMLTCNETDRFTTRVLAGLVLAVTVVMGSLTYAVANIQAFA*
Ga0117941_10001467	3300009120	Lake Sediment	MFTCTDSDRYTTRILAGLVLAVTIVVGSLTHAVSNLQTFA*
Ga0115027_107150312	3300009131	Wetland	MFTCKSYDKFATRVLAGLVLAVTIVFGSLTYAVSNVQAYI*
Ga0105094_101087622	3300009153	Freshwater Sediment	MFTCNDTDRFTTRVLAGLVLAVTIVVGSLTYAVTNIQAFA*
Ga0105102_102162462	3300009165	Freshwater Sediment	MFTCKSYDKFTTRVLAGLVLAVTIVFGSLTHAVSNIETYI*
Ga0105102_104506082	3300009165	Freshwater Sediment	MFTCTDTDRFTTRILAGLVLAVTIVLGSLTHAVTNIQAFA*
Ga0105100_105934912	3300009166	Freshwater Sediment	EDPIVFSCTHADAFTTRVLAGLVLAVTIVMGSLTYAVANIQVVA*
Ga0105100_108084362	3300009166	Freshwater Sediment	MFTCKTCDKFNTRVLAGLVLTVTIVVGSLTHAVSNVQAYI*
Ga0113563_103005822	3300009167	Freshwater Wetlands	MEDSAMTTCNKYDRFSTRILAGLVIAVTIVFGSLTYALSNVQAYA*
Ga0113563_103060863	3300009167	Freshwater Wetlands	MFTCTDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA*
Ga0105097_101729422	3300009169	Freshwater Sediment	MFSCKHADAFTTRILAGLVLAVTIVMGSLTYAVANIQVVA*
Ga0105097_102485942	3300009169	Freshwater Sediment	MLTCNDTDRFTTRILAGLVLAVTIVLGSLTHAVTNIQAFA*
Ga0105096_101190941	3300009170	Freshwater Sediment	MFTCKTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQAY
Ga0105096_104023222	3300009170	Freshwater Sediment	MFTCTDTDRFTTRILAGLVLAVTIVLGSLTHAVTNIQ
Ga0115028_100100282	3300009179	Wetland	MFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNIQAYA*
Ga0114938_10077433	3300009430	Groundwater	MFTCNSADRFTNRILAGLVVAVAIMFGSLTHAVVNFQAFA*
Ga0114938_10270262	3300009430	Groundwater	MFTCNETDRFTSRLLAGLVLAVTIVVGSLTHAVSSIQTFA*
Ga0118657_101295474	3300009506	Mangrove Sediment	MLTCSQTDRFTTRIFAGLVVSVTIAFGSLMYAVSNLQIVA*
Ga0118657_102797943	3300009506	Mangrove Sediment	MLTCSQTDRYTSRVLAGLVLAVTIVFGSLTYAVANLQIVA*
Ga0123573_100206482	3300009509	Mangrove Sediment	MLTCTTADRFTTHILAGLVLAVTIVMGSLTYAVANIQVIA*
Ga0123573_100614482	3300009509	Mangrove Sediment	MLTCSQTDRYTSRVLAGLVLAVTIVFGSLTYAVANMQIVA*
Ga0123573_102171503	3300009509	Mangrove Sediment	MEDPSMITCSNVDRFTSRVLAGLVVAVTIVFGSLTYAVTHVQAFA*
Ga0123573_107386962	3300009509	Mangrove Sediment	MFTCTETDRFTTRVLAGLVLAVTIAMGSLTYAVTNIQAFA*
Ga0116154_100263851	3300009776	Anaerobic Digestor Sludge	MFTCNNVDRFTTRVLAGLVITVTIAFGSLTYAVSNIQAYA*
Ga0116154_103300852	3300009776	Anaerobic Digestor Sludge	MLTCNENDRFAARILAGLVITVTIVMGSLTYAVANIQAFA*
Ga0130016_100189616	3300009868	Wastewater	MPATRKYDSYTNRVFAGLVIAVTIVVGSLAYAASNVQAYV*
Ga0130016_101403101	3300009868	Wastewater	MPATRKCDRYTNRVLAGLVIAVSIVVGSLTYAVSNIQVYV*
Ga0130016_103683432	3300009868	Wastewater	MPATRKCDSYTNRVLAGLVIAVSIVVGSLAYAVSNVQAYV*
Ga0133939_10055506	3300010051	Industrial Wastewater	MFTCTDSDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA*
Ga0136852_102268792	3300010412	Mangrove Sediment	MFTCTDTDRFTTRVLAGLVLAVTIVMGSLTYAVTNIQAFV*
Ga0136852_102791712	3300010412	Mangrove Sediment	MFTCNSVDTFTTRILAGLVLAVTVVLGSLTHAVANMQAFV*
Ga0136852_107943512	3300010412	Mangrove Sediment	MLTCNATDRFTTHILAGLVLAVTIVMGSLTYAVANVQAFA*
Ga0075308_10795892	3300014264	Natural And Restored Wetlands	MFTRNNTDRFTTRVVASLVVVATILFGSLTHAVVNFQAFA*
Ga0075344_10571852	3300014296	Natural And Restored Wetlands	MFTCNNVDRFTTRVLAGLVLSVTIVMGSLAYAVSHIQVVA*
Ga0075341_11239661	3300014298	Natural And Restored Wetlands	MFTCNSADRFTTRVLAGLVVAATILFGSLTHAVVNSQAFA*
Ga0075346_11753472	3300014306	Natural And Restored Wetlands	ADRFTTRVLAGLVVAATILFGSLTHAVVNFQAFA*
Ga0075345_10125681	3300014312	Natural And Restored Wetlands	MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA*
Ga0075345_11459612	3300014312	Natural And Restored Wetlands	MFTCKSVDSFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA*
Ga0075345_11660382	3300014312	Natural And Restored Wetlands	MFTCKSYDKFTARVLAGLVLAVTIVFGSLTYAVSNVQAYI*
Ga0075347_10249252	3300014313	Natural And Restored Wetlands	MLTCNETDRFTTRVLAGLVLAVTVVLGSLTHAVANMQAFV*
Ga0075347_11399312	3300014313	Natural And Restored Wetlands	MFTCKNYDKFTTRVLAGLVLAVTSVVGSLTHAVSNIETYI*
Ga0075339_11227851	3300014316	Natural And Restored Wetlands	MFTCKNYDKFATRVLTGLVLAVTIVVGSLTHAVSNIETYI*
Ga0075348_10110851	3300014319	Natural And Restored Wetlands	VDRFTTRVLAGLVVSVTIVFGSLTYAVSNIQAYA*
Ga0075348_10643852	3300014319	Natural And Restored Wetlands	MFTCNNVDRFTTRVLAGLVLAVTIVMGSLTHAVTNIQAFA*
Ga0075348_10732362	3300014319	Natural And Restored Wetlands	DQTMFTCKNVDSFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA*
Ga0075348_11158642	3300014319	Natural And Restored Wetlands	MFTCKNYDKFTTRVLAGLVVTVAVVFGSLVHAVSNIETYI*
Ga0207193_12243212	3300020048	Freshwater Lake Sediment	MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQVYA
Ga0210335_14316682	3300021346	Estuarine	MFTCNNVDRFTARILSGLVVSVTIVFGSLTYAVSHMQAFA
Ga0224500_100095212	3300022213	Sediment	MLTCNETDRYTARILAGLVLAVTIVMGSLTYAVANIQAYA
Ga0209398_10132313	3300025106	Groundwater	MFTCNSADRFTNRILAGLVVAVAIMFGSLTHAVVNFQAFA
Ga0209398_10166792	3300025106	Groundwater	MFTCNETDRFTSRLLAGLVLAVTIVVGSLTHAVSSIQTFA
Ga0210119_10675551	3300025561	Natural And Restored Wetlands	MFTCKNVDSFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA
Ga0209507_10987532	3300025706	Anaerobic Digestor Sludge	MFTCNNVDRFTTRVLAGLVITVTIAFGSLTYAVSNIQAYA
Ga0209310_12280322	3300025715	Anaerobic Digestor Sludge	MLTCNENDRFAARILAGLVITVTIVMGSLTYAVANIQAFA
Ga0209310_12395192	3300025715	Anaerobic Digestor Sludge	MLTCNENDRFAARILAGLVITVTIVMGSLTYAVNNIQAFA
Ga0210134_10065201	3300025950	Natural And Restored Wetlands	MFTCNSADRFTTRVLAGLVVAATILFGSLTHAVVNFQAFA
Ga0210134_10394141	3300025950	Natural And Restored Wetlands	MFTCSNNDRFATRVLAGLVVTVAIVMGSLTYAVSHMQAFA
Ga0210104_10098082	3300025956	Natural And Restored Wetlands	MFTCSNNDRFATRVLAGLVVAATILFGSLTHAVVNFQAFA
Ga0210127_10327801	3300025964	Natural And Restored Wetlands	MFTCNNVDRFTARVLSGLVVSVTIVFGSLTYAVSNIQAFA
Ga0210105_10012103	3300025966	Natural And Restored Wetlands	MFTCNSADRFTTRVLAGLVVTVAIVMGSLTYAVSNIQAFA
Ga0210103_10034202	3300025968	Natural And Restored Wetlands	MFTCSNNDRFATRVLAGLVVTVAIVMGSLTYAVSNIQAFA
Ga0210103_10104112	3300025968	Natural And Restored Wetlands	MFTCKSYDKFAARVLAGLVLAVTIVFGSLTYAVSNVQAYI
Ga0210103_10720652	3300025968	Natural And Restored Wetlands	MFTCNNVDRFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA
Ga0256808_10634172	3300026476	Sediment	MFTCNNVDRFSTRVFAGLVVAVTILFGSLTHAVVNFQAFA
Ga0209392_10005866	3300027683	Freshwater Sediment	MFTCKTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI
Ga0209392_10028264	3300027683	Freshwater Sediment	MFTCKTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQAYI
Ga0209392_10086053	3300027683	Freshwater Sediment	MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTHAVSNIQAYA
Ga0209392_10202343	3300027683	Freshwater Sediment	MFSCKHADAFTTRILAGLVLAVTIVMGSLTYAVANIQVVA
Ga0209392_10271412	3300027683	Freshwater Sediment	MFTCNNVDRFTTRVLAGLVVSVTIVFGSLTYAVSNMQAYA
Ga0209392_10329593	3300027683	Freshwater Sediment	MFTCKSYDKFTTRVLAGLVLAVTIVVGSLTHAVSNIETYI
Ga0209704_10136362	3300027693	Freshwater Sediment	MFTCNEVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAYA
Ga0209704_10719132	3300027693	Freshwater Sediment	MFTCKNYDKFTTRVLAGLVITVAVAFGSLVHAVSSIETYI
Ga0209467_12165952	3300027719	Freshwater	MLTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA
Ga0209492_10119823	3300027721	Freshwater Sediment	MFTCSNADSFTTRILAGLVVSVMIVMGSLTYAVANIQTFA
Ga0209492_10843402	3300027721	Freshwater Sediment	MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAYA
Ga0209492_11324042	3300027721	Freshwater Sediment	MFANCNNTDRFTVRLFAGLVVTVAMVMGSLTYAVANIQVFA
Ga0209288_100098132	3300027762	Freshwater Sediment	MFTCTDTDRFTTRVLAGLVIAVTIVVGSLTHAVIGIQAFA
Ga0209397_100215213	3300027871	Wetland	MLTCNENDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA
Ga0209397_100834672	3300027871	Wetland	MFTCKSYDKFTTRVLAGLVITVAVAFGSLVHAVSNIETYI
Ga0209397_101306081	3300027871	Wetland	MLTCNETDRFTTRVLAGLVLAVTVVMGSLTYAVANIQAFA
Ga0209397_101310962	3300027871	Wetland	MFTCSNNDRFATRVFAGLVVTVAIVMGSLTYAVSNIQAFA
Ga0209397_101396352	3300027871	Wetland	MFTCKTYDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI
Ga0209397_102109802	3300027871	Wetland	MFTCSNADSFTTRILAGLVVSVMIVMGSLTYAVANIQAFA
Ga0209397_106042871	3300027871	Wetland	MFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA
Ga0209293_100458202	3300027877	Wetland	MTTCTKYDRFSTRLFAGLVIAVTIVMGSLTYALSHVQVYA
Ga0209293_107222902	3300027877	Wetland	TQEDLAMLTCNETDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA
Ga0209450_100003705	3300027885	Freshwater Lake Sediment	MFTCSNSDRFTVRILAGLVVTVALVMGSLTYAVANIQVVA
Ga0209450_100341283	3300027885	Freshwater Lake Sediment	MTTCKNVDRYTARILAGLVIAVTIVLGALTHAVSNVQAFA
Ga0209450_101171472	3300027885	Freshwater Lake Sediment	MFTCNNVDRFTTRVLAGLVVSVTIVFGSLTYAVSNIQAYA
Ga0209450_101976392	3300027885	Freshwater Lake Sediment	MFTCKSADRFTTRILAGLVVAVAIMFGSLTHAVVNFQAFA
Ga0209450_108769961	3300027885	Freshwater Lake Sediment	MFTCIKADKFTTRVLAGLVVTVTIVFGSLTHAVSNVQAFA
Ga0209450_108840161	3300027885	Freshwater Lake Sediment	MFTCNNADRFTTRILAGLVVAVTIVFGSLTHAVVNLQAFA
Ga0209450_111363402	3300027885	Freshwater Lake Sediment	MFTRCHNADRFTVRILAGLVVTVAMVMGSLTYAVANMQAFA
Ga0209496_105741362	3300027890	Wetland	MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSHMQAFA
Ga0209496_107898791	3300027890	Wetland	MFTCSNADSFTTRIVAGLVVSVMIVMGSLTYAVANIQAFA
Ga0209254_100010944	3300027897	Freshwater Lake Sediment	MFTCKSYDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQAYI
Ga0209254_106509662	3300027897	Freshwater Lake Sediment	MMTCSNADSFTVRLLAGLVVGVMIVMGSLTYAVANIQTYA
Ga0209254_107357821	3300027897	Freshwater Lake Sediment	MFTCSNADSFTTRIFAGLVVSVMIVMGSLTYAVANIQTFA
Ga0209668_100012276	3300027899	Freshwater Lake Sediment	MLTCNETDRFATRVLAGLVIAVTIVMGSLTYAVANIQAYA
Ga0209668_101653272	3300027899	Freshwater Lake Sediment	MLTCNESDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA
Ga0209820_11302592	3300027956	Freshwater Sediment	MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNI
Ga0209391_100048136	3300027975	Freshwater Sediment	MLTCTDTDRFTTRILAGLVLAVTIVLGSLTHAVTNIQAFA
Ga0209391_100679333	3300027975	Freshwater Sediment	MFSCNHADSFTTRVLAGLVLAVTIVIGSLTYAVANIQVVA
Ga0209391_102075772	3300027975	Freshwater Sediment	MFTCTDTDRFTTRVLAGLVLAVTIVVGSLTHAVTNIQTFA
Ga0316604_101022941	3300033406	Soil	MFTCTNTDRFTTRILAGLVLAVTIVVGSLTHAVSNIQTFA
Ga0316604_101880921	3300033406	Soil	MFTCTDTDRFTTRILAGLVLAVTIVVGSLTHAVANIQMFA
Ga0316604_103689991	3300033406	Soil	MTTCNKYDRFSTRILAGLVIAVTIVFGSLTYALSNVQAYA
Ga0316604_104524082	3300033406	Soil	MFTCNATDRFASRVLAGLVLAVTIVMGSLTYAVANIQAYA
Ga0316604_105576802	3300033406	Soil	MFTCSNNDRFAARVLAGLVITVTIVMGSLTYAVSNIQAFA
Ga0316604_107959182	3300033406	Soil	ATEDPTMFTCKSYDKFTTRILAGLVITVAVAFGSLVHAVSNIETYI
Ga0316605_101905692	3300033408	Soil	MFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNMQVFA
Ga0316605_122204931	3300033408	Soil	MFSCNHADAFTTRILAGLVLAVTIVVGSLTYAVANIQVVA
Ga0316603_100009491	3300033413	Soil	MTTCTKYDRFSTRLFAGLVIAVTIVMGSLTYALSHVHVYA
Ga0316603_101683461	3300033413	Soil	MPARQKCNSYTHRVFAGLVIAVTIVAGSLVYAVSNVQVYV
Ga0316603_102898592	3300033413	Soil	MFTCKSYDKFATRVLAGLVLAVTIVFGSLTYAVSNVQAYI
Ga0316603_104725631	3300033413	Soil	FTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNMQVFA
Ga0316603_105247271	3300033413	Soil	MFTCNNVDSFTTRVLAGLVVTVTMVFGSLTYAVSNIQAFA
Ga0316603_107453862	3300033413	Soil	MFTCKSYDKFTTRILAGLVITVAVAFGSLVHAVSNIETYI
Ga0316603_111446342	3300033413	Soil	WPPHATEDPKMFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNMQVFA
Ga0316603_115420841	3300033413	Soil	MLTCNETDRFTTRVLAGLVLAVTIVMGSLTYAVANIQTFA
Ga0316603_120311941	3300033413	Soil	MLTCNENDRFATRVLAGLVITVTIVMGSLTYAVAT
Ga0316619_104854982	3300033414	Soil	MFASCSNTDRFTVRLFAGLVVTVAMVMGSLTYAVANIQVFA
Ga0316619_106474451	3300033414	Soil	MTTCNKYDRFSTRVLAGLVIAVTIVMGSLTYALSHVQAYA
Ga0316619_108393371	3300033414	Soil	MLTCNENDRFATRVLAGLVITVTIVMGSLTYAVAN
Ga0316619_111231111	3300033414	Soil	TCNENDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA
Ga0316622_1000012641	3300033416	Soil	NVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA
Ga0316622_1000577532	3300033416	Soil	MFTCNNVDSFTTRILAGLVLAVTIVFGSLTYAVANMQAYA
Ga0316622_1000930571	3300033416	Soil	TCNDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA
Ga0316622_1003569761	3300033416	Soil	MFTCNDNDSFLTRILAGLVVAVTIVVGSLTHAVSNIQAFT
Ga0316622_1007902882	3300033416	Soil	MRTCQNADRFTTRVLAGLVIAVTIVFGSLTHAVVNLQAFA
Ga0316622_1025911162	3300033416	Soil	EDPTMFTCTDTDRFTTRILAGLVLAVTIVVGSLTHAVANIQMFA
Ga0316622_1033315272	3300033416	Soil	MFTCTDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA
Ga0316625_1005743861	3300033418	Soil	MLTCNETDRFTTRILAGLVLAVTIVMGSLTYAVSNIQTFA
Ga0316601_1002794282	3300033419	Soil	MTTCNKYDRFSTRILAGLVIAVTIVFGSLAYALSNVQAYA
Ga0316601_1010183962	3300033419	Soil	PHATEDPTMFTCNNVDSFTTRVLAGLVVTVAIVFSSLTYAVSNMQAFA
Ga0316601_1019851572	3300033419	Soil	CNENDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA
Ga0316601_1024072052	3300033419	Soil	MFSCNHADAFSTRILAGLVLAVTIVVGSLTYAVANIQVVA
Ga0316613_105589482	3300033434	Soil	NVDSFTTRVLAGLVVTVTIVFGSLTYAVSHMQAFA
Ga0316600_106083811	3300033481	Soil	MLTCNETDRFATRVLAGLVIAVTVVMGSLTYAVANIQAFA
Ga0316627_1008343921	3300033482	Soil	WPPYATEDPTMFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA
Ga0316627_1011781982	3300033482	Soil	MFTCKNVDRFTTRILAGLVVAVTIVIGSLTHAVSGLQAFA
Ga0316627_1014772551	3300033482	Soil	TCNETDRFTTRVLAGLVLAVTVVMGSLTYAVANIQAFA
Ga0316626_102436173	3300033485	Soil	SNNDRFATRVFAGLVVTVAIVMGSLTYAVSNIQAFA
Ga0316630_101895981	3300033487	Soil	MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA
Ga0316630_119205882	3300033487	Soil	PTEDPTMFTCNATDRFASRVLAGLVLAVTIVMGSLTYAVANIQAYA
Ga0316630_120160532	3300033487	Soil	DPKMLTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA
Ga0316631_100705392	3300033493	Soil	DLAMLTCNENDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA
Ga0316616_1007733752	3300033521	Soil	MFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAVANIQMFA
Ga0316617_1004460751	3300033557	Soil	FTCTNNDRFATRVLAGLVVTVAIVMGSLTYAVSNIQAFA
Ga0316617_1010330962	3300033557	Soil	MFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAITNIQTFA
Ga0316617_1017980651	3300033557	Soil	MSTCTKYDRFSTRLFAGLVIAVTIVMGSLTYALSHVQVYA
Ga0373889_048700_68_190	3300034052	Sediment Slurry	MFTFKSYDKFTARILAGLVLAVTIVFGSLTYAVSNVQAYI
Ga0373892_025389_305_424	3300034055	Sediment Slurry	MFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNIQVL
Ga0373918_0083736_121_246	3300034420	Sediment Slurry	MFSTSNNFDRFTTRILAGLVVTVAIVMGSLTYAVANIQVVA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F021566

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences