NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022272

Metagenome / Metatranscriptome Family F022272

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022272
Family Type Metagenome / Metatranscriptome
Number of Sequences 215
Average Sequence Length 41 residues
Representative Sequence AIGIAPPLPDRLAAYLKRPKLSLAMSSQYDDFKQFLLAH
Number of Associated Samples 177
Number of Associated Scaffolds 215

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.47 %
% of genes near scaffold ends (potentially truncated) 96.74 %
% of genes from short scaffolds (< 2000 bps) 88.37 %
Associated GOLD sequencing projects 168
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.488 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.581 % of family members)
Environment Ontology (ENVO) Unclassified
(27.442 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.698 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.88%    β-sheet: 0.00%    Coil/Unstructured: 76.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 215 Family Scaffolds
PF04093MreD 49.77
PF04085MreC 13.02
PF03683UPF0175 6.05
PF06723MreB_Mbl 3.72
PF02604PhdYeFM_antitox 2.33
PF00079Serpin 1.40
PF03717PBP_dimer 0.47
PF02627CMD 0.47
PF00291PALP 0.47
PF03795YCII 0.47
PF13376OmdA 0.47
PF03781FGE-sulfatase 0.47
PF08491SE 0.47
PF01850PIN 0.47
PF00067p450 0.47
PF01738DLH 0.47
PF12704MacB_PCD 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 215 Family Scaffolds
COG2891Cell shape-determining protein MreDCell wall/membrane/envelope biogenesis [M] 49.77
COG1792Cell shape-determining protein MreCCell cycle control, cell division, chromosome partitioning [D] 13.02
COG2886Predicted antitoxin, contains HTH domainGeneral function prediction only [R] 6.05
COG1077Cell shape-determining ATPase MreB, actin-like superfamilyCell cycle control, cell division, chromosome partitioning [D] 3.72
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 2.33
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 2.33
COG4826Serine protease inhibitorPosttranslational modification, protein turnover, chaperones [O] 1.40
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.93
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.47
COG0768Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2)Cell cycle control, cell division, chromosome partitioning [D] 0.47
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.47
COG2124Cytochrome P450Defense mechanisms [V] 0.47
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.47
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.47


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.49 %
UnclassifiedrootN/A6.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101897373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1899Open in IMG/M
3300000955|JGI1027J12803_100206920All Organisms → cellular organisms → Bacteria1593Open in IMG/M
3300001137|JGI12637J13337_1010027All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300001137|JGI12637J13337_1024768All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300001159|JGI12650J13346_1001696All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300001593|JGI12635J15846_10058723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2894Open in IMG/M
3300001593|JGI12635J15846_10434101All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300002245|JGIcombinedJ26739_100562950All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300004080|Ga0062385_10402522Not Available818Open in IMG/M
3300004092|Ga0062389_102290318All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300005167|Ga0066672_10797044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300005335|Ga0070666_10657415All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300005467|Ga0070706_100265318All Organisms → cellular organisms → Bacteria1602Open in IMG/M
3300005468|Ga0070707_101044096All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300005533|Ga0070734_10352808All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300005541|Ga0070733_10184613All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300005545|Ga0070695_100388048All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1055Open in IMG/M
3300005559|Ga0066700_10858071All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005576|Ga0066708_10081299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1889Open in IMG/M
3300005591|Ga0070761_10231053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1102Open in IMG/M
3300005610|Ga0070763_10371552All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300005921|Ga0070766_10084502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1853Open in IMG/M
3300005995|Ga0066790_10109032All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300006050|Ga0075028_100146606All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300006172|Ga0075018_10431304All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300006755|Ga0079222_10207917All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300006800|Ga0066660_10048733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2750Open in IMG/M
3300006804|Ga0079221_10252012All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300006804|Ga0079221_10782905All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300006881|Ga0068865_100610365All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300006954|Ga0079219_12297706All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300007076|Ga0075435_100104798All Organisms → cellular organisms → Bacteria2347Open in IMG/M
3300007255|Ga0099791_10035092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2213Open in IMG/M
3300007265|Ga0099794_10405567All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300007265|Ga0099794_10553075All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300009038|Ga0099829_10405078All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1128Open in IMG/M
3300009088|Ga0099830_10877122All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300009088|Ga0099830_11618395All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300009088|Ga0099830_11885664All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300009089|Ga0099828_10650109All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300009137|Ga0066709_103515153All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300009176|Ga0105242_10393699All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300009549|Ga0116137_1125796Not Available727Open in IMG/M
3300009615|Ga0116103_1022389All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1994Open in IMG/M
3300009634|Ga0116124_1004652All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia6595Open in IMG/M
3300009644|Ga0116121_1095747Not Available930Open in IMG/M
3300009645|Ga0116106_1176839All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300010043|Ga0126380_10335739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1093Open in IMG/M
3300010320|Ga0134109_10006043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3273Open in IMG/M
3300010343|Ga0074044_10132439All Organisms → cellular organisms → Bacteria1672Open in IMG/M
3300010343|Ga0074044_10681636All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300010358|Ga0126370_10464680All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300010359|Ga0126376_10283248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1431Open in IMG/M
3300010359|Ga0126376_10743936All Organisms → cellular organisms → Bacteria → Acidobacteria949Open in IMG/M
3300010361|Ga0126378_10586660All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1229Open in IMG/M
3300010362|Ga0126377_13174356All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300010376|Ga0126381_100524255All Organisms → cellular organisms → Bacteria → Acidobacteria1675Open in IMG/M
3300010400|Ga0134122_12560786All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300011120|Ga0150983_16012952All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300011269|Ga0137392_11034825All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300011271|Ga0137393_10564340All Organisms → cellular organisms → Bacteria → Acidobacteria976Open in IMG/M
3300012199|Ga0137383_10878175All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300012200|Ga0137382_10340703All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1050Open in IMG/M
3300012205|Ga0137362_10068217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2939Open in IMG/M
3300012205|Ga0137362_10226800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1611Open in IMG/M
3300012209|Ga0137379_10987227All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300012357|Ga0137384_10327775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1271Open in IMG/M
3300012362|Ga0137361_11437509All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300012363|Ga0137390_10428891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1299Open in IMG/M
3300012582|Ga0137358_10087733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2099Open in IMG/M
3300012582|Ga0137358_10194129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1385Open in IMG/M
3300012685|Ga0137397_10217013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1424Open in IMG/M
3300012917|Ga0137395_10405116All Organisms → cellular organisms → Bacteria → Acidobacteria977Open in IMG/M
3300012917|Ga0137395_10460266All Organisms → cellular organisms → Bacteria → Acidobacteria914Open in IMG/M
3300012917|Ga0137395_10679025All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300012922|Ga0137394_11077472All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300012923|Ga0137359_11162031All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300012924|Ga0137413_10416952Not Available969Open in IMG/M
3300012924|Ga0137413_10969717All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300012929|Ga0137404_10164917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1854Open in IMG/M
3300012930|Ga0137407_10336279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1387Open in IMG/M
3300012931|Ga0153915_10863071All Organisms → cellular organisms → Bacteria → Acidobacteria1051Open in IMG/M
3300012931|Ga0153915_11829886All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300012944|Ga0137410_12078728All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300012971|Ga0126369_11931263All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300012971|Ga0126369_12663321All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300012977|Ga0134087_10553060All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300014154|Ga0134075_10586555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300015053|Ga0137405_1358741All Organisms → cellular organisms → Bacteria → Acidobacteria1307Open in IMG/M
3300015242|Ga0137412_10030309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4418Open in IMG/M
3300016422|Ga0182039_12004028All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300017934|Ga0187803_10271037All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300017941|Ga0187850_10527981Not Available509Open in IMG/M
3300017943|Ga0187819_10313587All Organisms → cellular organisms → Bacteria → Proteobacteria910Open in IMG/M
3300017947|Ga0187785_10752938All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300017955|Ga0187817_10146258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1502Open in IMG/M
3300017973|Ga0187780_10059525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2636Open in IMG/M
3300017998|Ga0187870_1170113All Organisms → cellular organisms → Bacteria → Proteobacteria784Open in IMG/M
3300018006|Ga0187804_10042002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1764Open in IMG/M
3300018025|Ga0187885_10038335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2532Open in IMG/M
3300018088|Ga0187771_10967301All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300018088|Ga0187771_11124322All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300018088|Ga0187771_11882826Not Available508Open in IMG/M
3300018482|Ga0066669_10242073All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1419Open in IMG/M
3300019789|Ga0137408_1342557All Organisms → cellular organisms → Bacteria → Acidobacteria4442Open in IMG/M
3300019789|Ga0137408_1402963All Organisms → cellular organisms → Bacteria1639Open in IMG/M
3300020170|Ga0179594_10351211All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300020199|Ga0179592_10016783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3219Open in IMG/M
3300020580|Ga0210403_10231162All Organisms → cellular organisms → Bacteria → Acidobacteria1517Open in IMG/M
3300020580|Ga0210403_10435829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1068Open in IMG/M
3300020580|Ga0210403_11246215All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300020581|Ga0210399_10179157All Organisms → cellular organisms → Bacteria → Acidobacteria1759Open in IMG/M
3300020581|Ga0210399_10550807All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae956Open in IMG/M
3300020581|Ga0210399_10722294All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300020583|Ga0210401_10014983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7503Open in IMG/M
3300021086|Ga0179596_10158869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1080Open in IMG/M
3300021168|Ga0210406_10378425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1138Open in IMG/M
3300021168|Ga0210406_11183904Not Available557Open in IMG/M
3300021168|Ga0210406_11387025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300021170|Ga0210400_10055674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3083Open in IMG/M
3300021170|Ga0210400_11503782All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300021170|Ga0210400_11568906All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300021178|Ga0210408_10017300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5803Open in IMG/M
3300021401|Ga0210393_10315957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1270Open in IMG/M
3300021401|Ga0210393_11695300Not Available500Open in IMG/M
3300021402|Ga0210385_10121889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1841Open in IMG/M
3300021407|Ga0210383_10191734All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1746Open in IMG/M
3300021420|Ga0210394_10170855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1892Open in IMG/M
3300021420|Ga0210394_10650761All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300021432|Ga0210384_10027987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5298Open in IMG/M
3300021432|Ga0210384_10208297All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1758Open in IMG/M
3300021475|Ga0210392_11255848All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300021477|Ga0210398_11520491All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300021477|Ga0210398_11610981All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300021478|Ga0210402_10347676All Organisms → cellular organisms → Bacteria → Acidobacteria1375Open in IMG/M
3300021478|Ga0210402_10386596All Organisms → cellular organisms → Bacteria → Acidobacteria1299Open in IMG/M
3300021479|Ga0210410_10080782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2857Open in IMG/M
3300021559|Ga0210409_11307718All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300024222|Ga0247691_1037937All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300024251|Ga0247679_1085090All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300024330|Ga0137417_1068369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1393Open in IMG/M
3300024330|Ga0137417_1414334All Organisms → cellular organisms → Bacteria1669Open in IMG/M
3300025472|Ga0208692_1075072Not Available720Open in IMG/M
3300025898|Ga0207692_11130727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300025912|Ga0207707_10122539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2274Open in IMG/M
3300025938|Ga0207704_10565431All Organisms → cellular organisms → Bacteria → Acidobacteria926Open in IMG/M
3300026318|Ga0209471_1043106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2131Open in IMG/M
3300026334|Ga0209377_1248667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300026359|Ga0257163_1082532All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300026360|Ga0257173_1048514All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300026496|Ga0257157_1037280All Organisms → cellular organisms → Bacteria → Acidobacteria808Open in IMG/M
3300026507|Ga0257165_1011146All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1414Open in IMG/M
3300026524|Ga0209690_1081791All Organisms → cellular organisms → Bacteria → Acidobacteria1358Open in IMG/M
3300026551|Ga0209648_10286902All Organisms → cellular organisms → Bacteria → Acidobacteria1190Open in IMG/M
3300026557|Ga0179587_10095549All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1791Open in IMG/M
3300026557|Ga0179587_10369200All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium932Open in IMG/M
3300026557|Ga0179587_10465591All Organisms → cellular organisms → Bacteria → Acidobacteria828Open in IMG/M
3300026557|Ga0179587_10791883All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300026862|Ga0207724_1020344Not Available575Open in IMG/M
3300027063|Ga0207762_1047592Not Available631Open in IMG/M
3300027587|Ga0209220_1129563All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300027605|Ga0209329_1069673All Organisms → cellular organisms → Bacteria → Acidobacteria759Open in IMG/M
3300027669|Ga0208981_1130096All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300027674|Ga0209118_1122750All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300027727|Ga0209328_10218690Not Available573Open in IMG/M
3300027738|Ga0208989_10113368All Organisms → cellular organisms → Bacteria → Acidobacteria921Open in IMG/M
3300027765|Ga0209073_10520311All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300027783|Ga0209448_10223482All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300027853|Ga0209274_10055375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1890Open in IMG/M
3300027862|Ga0209701_10395702All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300027869|Ga0209579_10756958All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300027884|Ga0209275_10126000All Organisms → cellular organisms → Bacteria → Acidobacteria1337Open in IMG/M
3300027894|Ga0209068_10087922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1625Open in IMG/M
3300027894|Ga0209068_10230919All Organisms → cellular organisms → Bacteria → Acidobacteria1024Open in IMG/M
3300027895|Ga0209624_10040470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2974Open in IMG/M
3300027903|Ga0209488_10202079Not Available1497Open in IMG/M
3300028047|Ga0209526_10363064All Organisms → cellular organisms → Bacteria → Acidobacteria968Open in IMG/M
3300028746|Ga0302233_10315528All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300030916|Ga0075386_11999253Not Available500Open in IMG/M
3300031128|Ga0170823_16356989All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300031474|Ga0170818_113123417All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300031543|Ga0318516_10047076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2337Open in IMG/M
3300031640|Ga0318555_10098324All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1540Open in IMG/M
3300031680|Ga0318574_10123381All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1455Open in IMG/M
3300031708|Ga0310686_117236015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1901Open in IMG/M
3300031715|Ga0307476_10867670All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300031724|Ga0318500_10213620All Organisms → cellular organisms → Bacteria → Acidobacteria927Open in IMG/M
3300031753|Ga0307477_10114798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1875Open in IMG/M
3300031754|Ga0307475_10658175All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300031763|Ga0318537_10232644All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300031768|Ga0318509_10377593All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300031769|Ga0318526_10346300All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300031777|Ga0318543_10457519All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300031781|Ga0318547_10391593All Organisms → cellular organisms → Bacteria → Acidobacteria852Open in IMG/M
3300031782|Ga0318552_10298823All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300031794|Ga0318503_10035447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1480Open in IMG/M
3300031833|Ga0310917_11157046All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300031859|Ga0318527_10487268All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300031910|Ga0306923_10671295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1156Open in IMG/M
3300031912|Ga0306921_10898925All Organisms → cellular organisms → Bacteria → Acidobacteria1005Open in IMG/M
3300031945|Ga0310913_10138624All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1673Open in IMG/M
3300031946|Ga0310910_10559237All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300032001|Ga0306922_10658824All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300032009|Ga0318563_10276154All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300032025|Ga0318507_10520026All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300032043|Ga0318556_10454327All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300032091|Ga0318577_10265762All Organisms → cellular organisms → Bacteria → Acidobacteria821Open in IMG/M
3300032160|Ga0311301_10177223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3740Open in IMG/M
3300032174|Ga0307470_10014219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3404Open in IMG/M
3300032180|Ga0307471_100331093All Organisms → cellular organisms → Bacteria → Acidobacteria1625Open in IMG/M
3300032180|Ga0307471_100465370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1407Open in IMG/M
3300032180|Ga0307471_102315552All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300032261|Ga0306920_100037134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7017Open in IMG/M
3300032783|Ga0335079_10867532All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300034124|Ga0370483_0366842All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil21.40%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.19%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.26%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.86%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.40%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.40%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.40%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.47%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.47%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.47%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.47%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.47%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.47%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001137Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3EnvironmentalOpen in IMG/M
3300001159Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025472Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026359Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-AEnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026862Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes)EnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027669Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10189737343300000364SoilAPPLPDRLASYLKRPKLSIAKSNEYQDFKQFLLAH*
JGI1027J12803_10020692013300000955SoilEKAIGIAPPLPDRLASYLKRPKLSIAKSNEYQDFKQFLLAH*
JGI12637J13337_101002713300001137Forest SoilGQAPPLPERLSKYLEKTKLSLPISSSYGDFKEFLLAR*
JGI12637J13337_102476813300001137Forest SoilPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLAH*
JGI12650J13346_100169633300001159Forest SoilEIVQKGIGVAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLAH*
JGI12635J15846_1005872353300001593Forest SoilQAPPLPDRLAAYLMLPKLSQPMSSQYDDFKQFLLAH*
JGI12635J15846_1043410113300001593Forest SoilPPLPERLSKYLEKTKLSLPISSSYGDFKEFLLAR*
JGIcombinedJ26739_10056295033300002245Forest SoilGIAPPLPDRLAAYLQRPKLSLPISRAYDDFKQFLLRH*
Ga0062385_1040252223300004080Bog Forest SoilVQKGIGIAPPLPSRLAEYLQRPKLSRPISSKYEDFKQFLLAH*
Ga0062389_10229031823300004092Bog Forest SoilAEVVTRAIGTAPPLPDRLAAYLQRPKLSLPFSSSYDEFKQFLLTH*
Ga0066672_1079704413300005167SoilAKFADVVTKAIGTAPPLPDRLAAYLKRPKLSLEMSRDYDDFRQFLLAH*
Ga0070666_1065741533300005335Switchgrass RhizosphereVVQRAIGVAPPLPDRLAAYLKRPKLSQPISSNYDAFKEFLLSH*
Ga0070706_10026531813300005467Corn, Switchgrass And Miscanthus RhizosphereADVVTKAIGTAPPLPDRLAAYLERPKLSLTMSRDYEDFRQFLLAH*
Ga0070707_10104409613300005468Corn, Switchgrass And Miscanthus RhizosphereRAIGTAPPLPDRLAACLPRPTLSLPISSKYDDFKRFLLS*
Ga0070734_1035280833300005533Surface SoilPPLPDRLASHLQKPKQSRPISNAYADLKEFLSER*
Ga0070733_1018461313300005541Surface SoilPAKFAEVVHKAIGLAPPLPSRLAEYLDRPKLSLPMRSKYDDFRQFLLSH*
Ga0070695_10038804833300005545Corn, Switchgrass And Miscanthus RhizosphereVVKRAIGTAPPLPDRLAAYLKREKLSLPMTSVYDDFKQFLLGH*
Ga0066700_1085807113300005559SoilAPPLPDRLAAYLKRPKLSVGMSRDYEDFKQFLLAH*
Ga0066708_1008129913300005576SoilDIVIKAIGTAPPLPDRLAAYLKRSKLSLAISSSYDEFKQFLLAH*
Ga0070761_1023105313300005591SoilRAIGTAPPLPDRLAAYLKREKLSVPMSSAYEDFKQFLTSQ*
Ga0070763_1037155213300005610SoilIAPPLPDRLAAHLQRPKLSLPISCAYDDFKQFLLRH*
Ga0070766_1008450233300005921SoilEVVKRAIGIAPPLPDRLAAYLQRPKLSLPFSSRYDEFKQFLLTH*
Ga0066790_1010903213300005995SoilAEVVSRAIGIAPPLPERLAAYLKRPKLSVPLSSKYDDFKHFLLS*
Ga0075028_10014660633300006050WatershedsFADVVMKAIGTAPPLPDRLAAYLKRDKLSLPLSTAYDDFKQFLLAQ*
Ga0075018_1043130413300006172WatershedsIVMKAIGTAPPLPDRLAAYLKRDKLSLPISGSYDEFKQFLLAH*
Ga0079222_1020791733300006755Agricultural SoilMKAIGTAPPLPDRLSAYLKREKLSLPISSAFDDFKQFLLAQ*
Ga0066660_1004873343300006800SoilKAIGTAPPLPDRLAAYLKREKLSLLISSSYDEFKQFLLAQ*
Ga0079221_1025201233300006804Agricultural SoilAPVLPDRLAAHLKGEKLSVPMSSRYEDFKQYLLDH*
Ga0079221_1078290513300006804Agricultural SoilPLLPDRLAAYLKREKLSLPMSSSYDDFKQFLLAL*
Ga0068865_10061036513300006881Miscanthus RhizosphereEKAIGIAPPLPDRLANYLKRPKLSVPMTSKYEDFRQFLLAH*
Ga0079219_1229770613300006954Agricultural SoilKFADVMKRAIGQAPLLPERLAACLQRESLSLAMSSSYDDFRAFLCAN*
Ga0075435_10010479813300007076Populus RhizosphereIGIAPPLPDRLAAYLKRPKLSVAMSSNYEDFKQFLLVH*
Ga0099791_1003509213300007255Vadose Zone SoilKAIGIAPPLPDRLAAYLKRDKLSLPMSGIYDDFKQFLLAH*
Ga0099794_1040556723300007265Vadose Zone SoilRAIGAAPPLPERLAACLQRPKLSQPISNEYGDFKQFLLSH*
Ga0099794_1055307523300007265Vadose Zone SoilVGIAPPLPDRLAAYLKRDKLSLPMSSVYDDFRQFLDAH*
Ga0099829_1040507833300009038Vadose Zone SoilGIGVAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLAH*
Ga0099830_1087712213300009088Vadose Zone SoilPPLPDRLAAYLQRPKLSQTISSHYDDFKQFLLAH*
Ga0099830_1161839523300009088Vadose Zone SoilPPLPDRLAAYLKRDKLSLPISSSYGDFKQFLVSQ*
Ga0099830_1188566433300009088Vadose Zone SoilGTAPPLPDRLAAYLKREKLSLPISSAYDDFKQFLLVQ*
Ga0099828_1065010933300009089Vadose Zone SoilVVMKAIGSAPPLPDRLAAYLKRDKLSLPISSSYDEFKQFLLAQ*
Ga0066709_10351515313300009137Grasslands SoilEVMKAIGTAPPLPDRIAAYLKRPKLSVGMSRDYEDFKQFLLAH*
Ga0105242_1039369913300009176Miscanthus RhizosphereKFAEIVEKAIGIAPPLPDRLANYLKRPKLSLPMTSNYEDFRQFLLGH*
Ga0116137_112579613300009549PeatlandFAEIVQKGIGIAPPLPSRLAEYLNRPKLSLPMTTNYDNFKQFLLNH*
Ga0116103_102238943300009615PeatlandAPPLPSRLAEYLNRPKLSLPMTTAYDDFKQFLLAH*
Ga0116124_100465213300009634PeatlandEIVQKGIGIAPPLPSRLAEYLNRPKLSLPMTTNYDNFKQFLLNH*
Ga0116121_109574733300009644PeatlandGIAPPLPSRLAEYLNRPKLSLPMSTNYDHFKQFLLAH*
Ga0116106_117683913300009645PeatlandFAEIVQKGIGIAPPLPSRLAEYLNRPKLSLPMTTNYDDFKQFLLAH*
Ga0126380_1033573933300010043Tropical Forest SoilAKFADVVCKAIGTAPPLPDRLAAYLKRDKLSLSMSSSYDDFKQFLLRH*
Ga0134109_1000604313300010320Grasslands SoilIGTAPPLPDRLAAYLKRSKLSLAISSSYDEFKQFLLAH*
Ga0074044_1013243943300010343Bog Forest SoilPPLPSRLAEYLNRPKLSLPMTTAYDDFKQFLLAH*
Ga0074044_1068163623300010343Bog Forest SoilKRAIGTAPPLPDRLAAYLKREKLSLPMTSAYEDFKEFLIGQ*
Ga0126370_1046468033300010358Tropical Forest SoilKAIGSAPPLPDRLAAYLKKAKLSLPMSSSYDDFKQFLLSN*
Ga0126376_1028324813300010359Tropical Forest SoilKAIGMAPPLPSRLAEYLQRPKLSLPMSNAYDDFKEFLLSH*
Ga0126376_1074393633300010359Tropical Forest SoilAKFADVVTRAIGTAPPLPERLAAYLQRPKLSRPMSSLYQDFKQFLLSY*
Ga0126378_1058666023300010361Tropical Forest SoilVKKAIGSAPLLPDRLAGYLKREKLSLPMSSNYDYFKQFLITH*
Ga0126377_1317435613300010362Tropical Forest SoilIGIAPPLPDRLANCLKRPKLSVPMTNKYDDFKQFLLAH*
Ga0126381_10052425513300010376Tropical Forest SoilIVEKAIGIAPPLPDRLANYLKRPKLSVPMTSRYEDFKEFLLR*
Ga0134122_1256078613300010400Terrestrial SoilAIGIAPPLPDRLANYLKRPKLSLPMTSNYEDFRQFLLGH*
Ga0150983_1601295213300011120Forest SoilGIAPRLPARLAAYLKREKLSLPMSSNYDEFKQFLLAH*
Ga0137392_1103482523300011269Vadose Zone SoilGAAPPLPDRLAAYLHRPKLSQPISSRYDDFRQFLLAH*
Ga0137393_1056434013300011271Vadose Zone SoilMKAIGTAPQLPDRLAAYLQREKLSQPISSSYDDFKQFLLTC*
Ga0137383_1087817523300012199Vadose Zone SoilVMKAIGAAPPLPDRLAAYLKRDKLSLPISSSYDEFKQFLLSQ*
Ga0137382_1034070333300012200Vadose Zone SoilIGTAPPLPDRLAAYLKCEKLSLPISSSYDEFKQFLLSQ*
Ga0137362_1006821743300012205Vadose Zone SoilMKAIGAAPPLPDRLAAYLKRDKLSQPISSSYDEFKKFLLSQ*
Ga0137362_1022680033300012205Vadose Zone SoilVLKAVGIAPPLPDRLAAYLKRDKLSLPMSSVYDDFRQFLDAH*
Ga0137379_1098722713300012209Vadose Zone SoilFADVVTKAIGTAPPLPERLAAYLKREKLSVLISSAYDDFKQFLLTQ*
Ga0137384_1032777533300012357Vadose Zone SoilVVKKAIGTAPPLPDRLAAYLKREKLSLLISSSYDEFKQFLLAQ*
Ga0137361_1143750913300012362Vadose Zone SoilIGTAPPLPDRLAAYLKRDKLSLPMSSAYDDFKQFLLSQ*
Ga0137390_1042889113300012363Vadose Zone SoilKFADVVAKAIGAAPPLPDRLAAYLKRAKLSLPMPSAYDDFRQFLLTH*
Ga0137358_1008773313300012582Vadose Zone SoilAPPLPDRLAAYLKRPKLSVAISSNYDDFKQFLLAH*
Ga0137358_1019412933300012582Vadose Zone SoilGAAPPLPDRLAACLQLPKLSQRISSEYDSFKQFLLAH*
Ga0137397_1021701333300012685Vadose Zone SoilGTAPPLPDRLAAYLQRPKLSLAMSSLYDDFKQFLLAH*
Ga0137395_1040511613300012917Vadose Zone SoilRAIGAAPPLPDRLAACLQRPKLSQRISSEYDDFKQFLILH*
Ga0137395_1046026633300012917Vadose Zone SoilTAPPAKFADVVTRAIEAAPPLPDRLAACLHRPKLSLAMSSLYDDFKQFLLAH*
Ga0137395_1067902523300012917Vadose Zone SoilPPLPDRLAAYLQRPKLSLAMSSLYDDFKQFLLAH*
Ga0137394_1107747213300012922Vadose Zone SoilKFADVVTKAISTAPPLPDRLTAYLQRPKLSLPTSSSYDDFKLFLMAH*
Ga0137359_1116203123300012923Vadose Zone SoilTAPPLPDRLAAYLKLDKLSLPVSSSYGEFKEFLLAQ*
Ga0137413_1041695213300012924Vadose Zone SoilTAPPLPDRLAAYLKRPKLSLPMTSSYEDFKQFLVTH*
Ga0137413_1096971713300012924Vadose Zone SoilKAIGPAPPLPDRLAAYLKREKLSLPISSTYDDFKQFLLTN*
Ga0137404_1016491743300012929Vadose Zone SoilVAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLAH*
Ga0137407_1033627933300012930Vadose Zone SoilIGSAPPLPDRLAACLQRPKLSQRISSEYDSFKQFLLAH*
Ga0153915_1086307113300012931Freshwater WetlandsVMRAVGIAPQLPERLAVYLQRPKLSLPMSTDYEEFKQFLLTR*
Ga0153915_1182988613300012931Freshwater WetlandsAKFADVVMRAVGIAPQLPERLAVYLQRPKLSLPMSADYEDFKQFLLTR*
Ga0137410_1207872813300012944Vadose Zone SoilKAIGTAPPLPDRLAAYLKRDKLSLPISSTYDDFKEFLLAQ*
Ga0126369_1193126323300012971Tropical Forest SoilPPLPDRLAAYLKRDKLSVPMASSYDAFKQFLMHH*
Ga0126369_1266332123300012971Tropical Forest SoilIVEKAIGIAPPLPDRLANCLKRPKLSVPMTSRYEDFREFLLKS*
Ga0134087_1055306023300012977Grasslands SoilAIGTAPPLPDRLAAYLKRSKLSLAISSSYDEFKQFLLAH*
Ga0134075_1058655523300014154Grasslands SoilVTKAIGTAPPLPDRLAAYLKRPKLSLAISRDYEDFRQFLLAH*
Ga0137405_135874143300015053Vadose Zone SoilMKAIGTAPPLPDRLAAYLKRDKLSLPISSSYDDFKQFLLTQ*
Ga0137412_1003030963300015242Vadose Zone SoilADVVKRAIGIAPPLPDRLAAYLQRPKLSLPLSSKYDDFKHFLLS*
Ga0182039_1200402813300016422SoilTPPLPERLARYLQRPKLSRPMTSRYDDFKQFLLAH
Ga0187803_1027103723300017934Freshwater SedimentGIGIAPPLPSRLAEYLNRPKLSLPMTTSYDAFKQFLLAH
Ga0187850_1052798113300017941PeatlandGIGIAPPLPSRLAEYLNRPKLSLPMTTAYDDFKQFLLAH
Ga0187819_1031358733300017943Freshwater SedimentIAPPLPERLARYLHAPKLSLPMSSNYADFKQFLLTH
Ga0187785_1075293813300017947Tropical PeatlandAIGIAPPLPDRLAAYLKRPKLSLAMSSQYDDFKQFLLAH
Ga0187817_1014625833300017955Freshwater SedimentVAPPLPDRLAAYLQRPKLSLPASSRYDDFKQFLLAH
Ga0187780_1005952543300017973Tropical PeatlandFADIVQKAIGMAPPLPSRLAEYLQRPKLSRPMTTNYDDFKQFLLAH
Ga0187870_117011333300017998PeatlandAEIVQKGIGIAPPLPSRLAEYLNRPKLSLPMTTAYDDFKQFLLAH
Ga0187804_1004200213300018006Freshwater SedimentKFADVVRKAIGTAPPLPDRLAAYLKREKLSLPMSIAYDDFKQFLLAH
Ga0187885_1003833513300018025PeatlandKFAEIVQKGIGIAPPLPSRLAEYLNRPKLSLPMTTAYDDFKQFLLAH
Ga0187771_1096730133300018088Tropical PeatlandTPPLPSRLAEYLNRPKLSLPMTTSYDDFKQFLLAH
Ga0187771_1112432233300018088Tropical PeatlandFAEIVLKGIGIAPPLPSRLAEYLNRPKLSLPMTAAYDDFKQFLLAH
Ga0187771_1188282613300018088Tropical PeatlandKFAEIVLKGIGIAPPLPSRLAEYLNRPKLSLPMTTAYDDFKQFLLAQ
Ga0066669_1024207313300018482Grasslands SoilPPLPDRLAAYLKREKLSLPISSTADDFKQFLLTNSS
Ga0137408_134255713300019789Vadose Zone SoilMKAIGIAPPLPDRLAAYLKRDKLSLPMSGIYDDFKQFLLAH
Ga0137408_140296343300019789Vadose Zone SoilMKAIGTAPPLPDRLAAYSKNADKLSLPISSSYDDFKQFSHTQ
Ga0179594_1035121113300020170Vadose Zone SoilSAPPLPDRLAACLQRPKLSQRISNEYDDFKEFLILH
Ga0179592_1001678353300020199Vadose Zone SoilEIVQQGIGVAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLDH
Ga0210403_1023116213300020580SoilVQKGIGVAPPLPSRLAEYLQRPKLSLLISSKYEDFKQFLLSH
Ga0210403_1043582933300020580SoilDVVTRAIGAAPPLPDRLAAYLQRPKLSQPISSSYDDLRQFLRAQ
Ga0210403_1124621513300020580SoilADVVMKAIGTAPPLPDRLAAYLKREKLSLPISSSYDEFKQFLLSQ
Ga0210399_1017915743300020581SoilGTAPPLPDRLAAYLKREKLSLPMSSSYDDFKQFLLAY
Ga0210399_1055080733300020581SoilIGIAPQLPDRLAAYLKLEKLSLPMSSDYQDFKRFLLAQ
Ga0210399_1072229413300020581SoilDIVQRAIGSAPPLPDRLAAYLKREKLSLPMSSGYDDFKQFLLAH
Ga0210401_1001498313300020583SoilAIGTAPPLPDRLAAYLKREKLSLPMSSAYEDFKQFLLGQ
Ga0179596_1015886913300021086Vadose Zone SoilRAIGTAPPLPDRLAAYLQRPKLSLAMSSLYDDFKQFLLAH
Ga0210406_1037842513300021168SoilEIVQKGIGVAPPLPSRLAEYLHRPKLSLPISSKYEDFKQFLLAH
Ga0210406_1118390423300021168SoilIGTAPPLPDRLAAYLKLDKLSLPISSSYDDFKQFLLSR
Ga0210406_1138702523300021168SoilFAEVVQRAIGVAPPLPDRLAAYLKRPKLSQPMSSKYEAFKKFLLSN
Ga0210400_1005567413300021170SoilAKFAEIVQKGIGVAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLAH
Ga0210400_1150378213300021170SoilIGAAPPLPERLAAHLRLPKLSLPMSAQYDDFKQFLLAG
Ga0210400_1156890613300021170SoilTRAIGTAPPLPDRLAAYLQRPKLSIAMSSLYDDFKEFLLAH
Ga0210408_1001730013300021178SoilAIGAAPPLPDRLAAYLQRPKLSQPISSQYDDFKQFLLAH
Ga0210393_1031595713300021401SoilKGIGLAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLAH
Ga0210393_1169530023300021401SoilKAIGVAPPLPSRLAEYLDRPKLSLPMSSKYDDFKQFLLGH
Ga0210385_1012188933300021402SoilIAPPLPDRLAAYLKRPKLSIPATSKYDDFKQFLLKH
Ga0210383_1019173413300021407SoilEVVQKAIGVAPPLPSRLAEYLDRPKLSLPMSSKYDDFKQFLLGH
Ga0210394_1017085543300021420SoilFAEIVQKGIGVAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLAH
Ga0210394_1065076113300021420SoilEIAPPLPSRLAEYLERKKLSLPMSNKYEDFKQFLLSH
Ga0210384_1002798763300021432SoilAEIVQKGIGVAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLAH
Ga0210384_1020829713300021432SoilKAIGIAPPQPSRLAQYLERKKLSLPMSNKYEDFKQFLLSH
Ga0210392_1125584823300021475SoilIVQKGIGIAPPLPSRLAEYLQRPKLSRAMSSKYEDFKQFLLSH
Ga0210398_1152049113300021477SoilAPPLPDRLAAYLKREKLSLAMSSSYEDFKQFLLSA
Ga0210398_1161098123300021477SoilAEVVKRAIGSAPPLPDRLAAYLTREKLSVPMSSAYDDFKQFLTSR
Ga0210402_1034767613300021478SoilAEIVQKGIGVAPPLPSRLAEYLQRPKLSLLISSKYEDFKQFLLSH
Ga0210402_1038659613300021478SoilVVMKAIGTAPPLPERLAAYLKREKLSLPMSSSYVDFRQFLLSH
Ga0210410_1008078213300021479SoilAKFADVVARAIGKAPLLPERLACYLQRSKLSQPISSKYEDFKQFLLAS
Ga0210409_1130771823300021559SoilRAIGTAPPLPDRLAAYLKREKLSLPMSSAYDDFKQFLLSP
Ga0247691_103793713300024222SoilKFAEIVQKGIGVAPPLPSRLAEYLQRPKLSLPISANYDEFKQFLLAH
Ga0247679_108509013300024251SoilVQKGIGVAPPLPSRLAEYLQRPKLSLPISNKYEDFQQFLIAH
Ga0137417_106836933300024330Vadose Zone SoilVMKAIGTAPPLPDRLAAYLKRDKLSLPVSSSYGEFKEFLLAQ
Ga0137417_141433433300024330Vadose Zone SoilMKAIGMAPPLPERLAAYLKRDKLSLPISNSYDEFKQFLLAQ
Ga0208692_107507213300025472PeatlandIVQKGIGIAPPLPSRLAEYLNRPKLSLPMTTNYDNFKQFLLNH
Ga0207692_1113072723300025898Corn, Switchgrass And Miscanthus RhizosphereHPAKFAEIVQKGIGIAPPLPSRLAEYLQRPKLSRAMSSTYEDFRQFLLSH
Ga0207707_1012253913300025912Corn RhizosphereTAPPLPDRLAAYLKREKLSLPMTSVYDDFKQFLLAQ
Ga0207704_1056543123300025938Miscanthus RhizosphereGIAPPLPDRLANYLKRPKLSVPMTSKYEDFRQFLLAH
Ga0209471_104310643300026318SoilKAIGTAPPLPDRLAAYLKRHKLSLPISSSYHEFKQFLLAP
Ga0209377_124866713300026334SoilADVVTKAIGTAPPLPDRLAAYLKRPKLSLAISRDYEDFRQFLLAH
Ga0257163_108253213300026359SoilIGTAPPLPDRLAAYLKRDKLSLPVSSSYDQFKQFLLAQ
Ga0257173_104851413300026360SoilADVVMNAIGTAPPLPDRLAAYLKRPKLSVPVSSDYDDFKQFLLAH
Ga0257157_103728033300026496SoilEVVKRAIGTAPPLPDRLAAYLTLEKLSVPMSSEYDDFKQFLLAR
Ga0257165_101114613300026507SoilKFAEIVQKGIGVAPPLPARLAEYLQRPKLSLPISGEYEDFKQFLLAH
Ga0209690_108179113300026524SoilAIGAAPPLPDRLAAYLKREKLSLPISNVFDEFKQFLAN
Ga0209648_1028690213300026551Grasslands SoilAAPPLPDRLAAYLQRPKLSQAISSEYNDFRQFLTSY
Ga0179587_1009554913300026557Vadose Zone SoilRAIGMAPPLPDRLAAYLQRAKLSQPISSKYEDFRQFLLAH
Ga0179587_1036920023300026557Vadose Zone SoilAEIVQQGIGVAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLDH
Ga0179587_1046559133300026557Vadose Zone SoilKAIGIAPPLPDRLAAYLKRDKLSLPMSSVYDDFRQFLVAH
Ga0179587_1079188313300026557Vadose Zone SoilIGAAPPLPDRLAAYLKREKLSLPITSAFDDFKQFLLAQ
Ga0207724_102034423300026862Tropical Forest SoilKGIGIAPPLPSRLAEYLHRPKLSKPMTSNYPDFKQFLLAH
Ga0207762_104759213300027063Tropical Forest SoilAEIVQKGIGIAPPLPSRLAEYLHRPKLSKPMTSNYPDFKQFLLAH
Ga0209220_112956323300027587Forest SoilRAIGAAPPLPDRLAAYLQRPKLSQPISSRYDDFKQFLLAH
Ga0209329_106967323300027605Forest SoilAPPLPDRLAAYLKRDKLSLPVSSSYDEFKQFILAQ
Ga0208981_113009623300027669Forest SoilVMKVIGTAPPLPDRLAAYLKREKLSLPISNSYDEFKQFLLTQ
Ga0209118_112275023300027674Forest SoilIGAAPPLPDRLAAYLQRPKLSQAISSHYDDFKQFLLAH
Ga0209328_1021869013300027727Forest SoilVGAGALSGAIGAAPPLPERLAAYLQRRKLSLPISSAYEDFKQFLLTH
Ga0208989_1011336813300027738Forest SoilGTAPPLPDRLAAYLKREKLSLPISNSYDEFKQFLLTQ
Ga0209073_1052031113300027765Agricultural SoilRKAIGSAPPLPDRLAAYLKREKLSLPMSSSYDDFKQFLLGN
Ga0209448_1022348213300027783Bog Forest SoilAIGTAPPLPDRLAAYLKREKLSLPMSSAYDDLKQFLLAS
Ga0209274_1005537513300027853SoilAEVVKRAIGIAPPLPDRLAAYLQRPKLSLPFSSRYDEFKQFLLTH
Ga0209701_1039570223300027862Vadose Zone SoilLDEAIGIAPRLPDRLAAYLKRDKLSVPISSNYDDLKQFLLAH
Ga0209579_1075695823300027869Surface SoilRAIGTSPPLPDRLAAYLKREKLSLPMSSAYDDFKQFLLTS
Ga0209275_1012600033300027884SoilVKRAIGVAPPLPDRLAAYLQRPKLSVPISSGYDDFKQFLMLH
Ga0209068_1008792233300027894WatershedsVVKRAIGTAPQLPDRLAAYLELEKLSLPISSDYHDFKQFLLAR
Ga0209068_1023091933300027894WatershedsIAPPLPSRLAEYLERKKLSLPMSNKYEDFKQFLLSH
Ga0209624_1004047013300027895Forest SoilEVVKRAIGIAPPLPDRLAAYLQRPKLSLPFSSRYDEFKQFLLTH
Ga0209488_1020207923300027903Vadose Zone SoilPAKFADVVARAIGSAPLLPERLATHLRQPKLSLPMSAEYDAFRHFLLMH
Ga0209526_1036306443300028047Forest SoilAIGIAPPLPDRLAAYLQRPKLSLPLSSKYGDFKQFLLSH
Ga0302233_1031552813300028746PalsaDVVRRAIGTAPPLPERLAACLTRPKLSAPLSSNYDDLRQFLMVC
Ga0075386_1199925313300030916SoilKFAEIVQKGIGIAPPLPSLLAEYLPRPKLSRAMSSKYEDFKQFLLSH
Ga0170823_1635698913300031128Forest SoilLVARAIGAAPPLPDRLAAYLQRPKLSQPISGHYDDFKQFLLAR
Ga0170818_11312341723300031474Forest SoilAKFADVVMKAIGTAPPLPDRLAACLKRPKLSVPVSSGYEEFKQFLLAR
Ga0318516_1004707643300031543SoilVRKAIGSAPPLPERLAACLKREKLSLPMSRDYEDFKQFLLAH
Ga0318555_1009832413300031640SoilSAPPLPERLAACLKREKLSLPMSRDYEDFKQFLLAH
Ga0318574_1012338113300031680SoilAPPLPERLAACLKREKLSLPMSRDYEDFKQFLLAH
Ga0310686_11723601533300031708SoilAPPLPDRLAAYLKREKLSLPMSSAYDDFKQFLLSA
Ga0307476_1086767013300031715Hardwood Forest SoilAPTLPDRLAAYLKRPKLSVAMSSRYEDFRQFLLAR
Ga0318500_1021362013300031724SoilGITPPLPERLARYLQRPKLSRPMTSRYDDFKQFLLAH
Ga0307477_1011479813300031753Hardwood Forest SoilAIGSAPPLPERLAACLKREKLSLPMSSDYEDLKQFLLAP
Ga0307475_1065817513300031754Hardwood Forest SoilRAIGAAPPLPDRLAAYLQRPKLSQPISSHYDDFKQFLLAH
Ga0318537_1023264413300031763SoilGITPPLPERLARYLERAKLSGPMTSRYDDFKQFLLAH
Ga0318509_1037759313300031768SoilGIGIAPPLPSRLAEYLNRPKLSVPMRSNYDDLKQFLLLH
Ga0318526_1034630013300031769SoilKGMGITPPLPERLARYLQRPKLSRPMSSRYDDFKQFLLAH
Ga0318543_1045751913300031777SoilKAIGSAPPLPDRLGVCLTRQKLSLPIAGEYEDFKQFLLSH
Ga0318547_1039159333300031781SoilKFAEIVQKGIGIAPPLPSRLAEYLNRPKLSVPMRSNYDDLKQFLLLH
Ga0318552_1029882313300031782SoilAIGSAPPLPERLAACLKREKLSLPMSRDYEDFKQFLLAH
Ga0318503_1003544713300031794SoilVVRKAIGSAPPLPERLAACLQREKLSLPMSRDYEDFKQFLLAH
Ga0310917_1115704623300031833SoilISPPLPERLARYLQRPKLSRPMTSRYDDFKQFLLAH
Ga0318527_1048726813300031859SoilGIGINPPLPERLARYLERAKLSRPITSRYDDFKQFLLAH
Ga0306923_1067129533300031910SoilDIVQKGMGITPPLPERLARYLQRPKLSRPMTSRYDDFKQFLLAH
Ga0306921_1089892533300031912SoilGITPPLPERLARYLERAKLSRPMTSRYDDFKQFLLAH
Ga0310913_1013862413300031945SoilKGMGISPPLPERLARYLQRPKLSRPMTSRYDDFKQFLLAH
Ga0310910_1055923723300031946SoilAPPLPSRLAEYLNRGKLSLPLSTNYDDLKQFLLRH
Ga0306922_1065882413300032001SoilEIVEKAIGIRPPLPDRLAAYLSRPKLSLPISCEYEDFKGFLLSR
Ga0318563_1027615413300032009SoilIAPPLPDRLANYLKRPKLSVPMTSRYEDFKEFLLR
Ga0318507_1052002613300032025SoilEKGIGVAPPLPERLARYLQRPKLSRPMTAHYDDFKQFLLAH
Ga0318556_1045432723300032043SoilAKFAEIVESAMGIRPPLPDRLAAYLSRPKLSLPISSEYQDFKGFLLSR
Ga0318577_1026576213300032091SoilFADIVQKGMGITPPLPERLARYLQRPKLSRPMASRYDDFKQFLLAH
Ga0311301_1017722353300032160Peatlands SoilADVVKRAIGTAPPLPDRLAAYLKREKLSVPMSSDYEDFKEFLLGQ
Ga0307470_1001421913300032174Hardwood Forest SoilAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLAH
Ga0307471_10033109343300032180Hardwood Forest SoilEIVQKGIGVAPPLPSRLAEYLQRPKLSLPISSKYEDFKQFLLAH
Ga0307471_10046537033300032180Hardwood Forest SoilVVARAIGAAPPLPDRLAAYLQRPKLSQAISSHYDDFKQFLLAH
Ga0307471_10231555213300032180Hardwood Forest SoilAIGTAPPLPDRLAAYLKRPKLSVPMSSGYEGFKQFLLAH
Ga0306920_10003713493300032261SoilIVEKAIGSAPPLPDRLGVCLTRQKLSLPIAGEYEDFKQFLLSH
Ga0335079_1086753233300032783SoilKGIGIAPPLPSRLAEYLQRPKLSRPMSSKYDDFKQFLLAH
Ga0370483_0366842_1_1413300034124Untreated Peat SoilFAEVVKRAIGTAPPLPDRLAAYLQRPKLSLPFSSSYDDFKQFLLTH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.