NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022918

Metagenome / Metatranscriptome Family F022918

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022918
Family Type Metagenome / Metatranscriptome
Number of Sequences 212
Average Sequence Length 40 residues
Representative Sequence LTKSRLIYLLLIASLFAYFLACFHHPGPTGMSDGGGL
Number of Associated Samples 160
Number of Associated Scaffolds 212

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 85.31 %
% of genes near scaffold ends (potentially truncated) 17.45 %
% of genes from short scaffolds (< 2000 bps) 80.19 %
Associated GOLD sequencing projects 150
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.811 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(8.962 % of family members)
Environment Ontology (ENVO) Unclassified
(22.170 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.321 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 33.85%    β-sheet: 0.00%    Coil/Unstructured: 66.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 212 Family Scaffolds
PF13432TPR_16 36.79
PF03109ABC1 16.98
PF00106adh_short 16.51
PF13560HTH_31 4.72
PF13424TPR_12 3.30
PF07719TPR_2 1.89
PF07690MFS_1 1.42
PF02769AIRS_C 1.42
PF00440TetR_N 0.94
PF00586AIRS 0.94
PF02540NAD_synthase 0.94
PF02628COX15-CtaA 0.94
PF13977TetR_C_6 0.94
PF13561adh_short_C2 0.47
PF13847Methyltransf_31 0.47
PF00581Rhodanese 0.47
PF09754PAC2 0.47
PF00266Aminotran_5 0.47
PF13340DUF4096 0.47
PF01266DAO 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 212 Family Scaffolds
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 16.98
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 0.94
COG1612Heme A synthaseCoenzyme transport and metabolism [H] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.81 %
UnclassifiedrootN/A5.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000953|JGI11615J12901_10006094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1346Open in IMG/M
3300001305|C688J14111_10005343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3543Open in IMG/M
3300001305|C688J14111_10140015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300001305|C688J14111_10165613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300001535|A3PFW1_10121861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae2047Open in IMG/M
3300001686|C688J18823_10084902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2196Open in IMG/M
3300001686|C688J18823_10152247All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300002568|C688J35102_119971697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300002568|C688J35102_120358534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1012Open in IMG/M
3300002568|C688J35102_120989075All Organisms → cellular organisms → Bacteria10030Open in IMG/M
3300003320|rootH2_10103986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1872Open in IMG/M
3300003324|soilH2_10014502All Organisms → cellular organisms → Bacteria2036Open in IMG/M
3300004114|Ga0062593_101182187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300004479|Ga0062595_100021387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2458Open in IMG/M
3300004479|Ga0062595_100165945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1312Open in IMG/M
3300004799|Ga0058863_10026362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1201Open in IMG/M
3300005171|Ga0066677_10442303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria744Open in IMG/M
3300005174|Ga0066680_10514916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300005175|Ga0066673_10244842All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300005176|Ga0066679_10139000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1512Open in IMG/M
3300005187|Ga0066675_10444647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales963Open in IMG/M
3300005327|Ga0070658_10020469All Organisms → cellular organisms → Bacteria5302Open in IMG/M
3300005327|Ga0070658_10059339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3115Open in IMG/M
3300005332|Ga0066388_100152961All Organisms → cellular organisms → Bacteria2888Open in IMG/M
3300005345|Ga0070692_10872554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300005435|Ga0070714_100075546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2923Open in IMG/M
3300005435|Ga0070714_102353553All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300005436|Ga0070713_100035596All Organisms → cellular organisms → Bacteria4009Open in IMG/M
3300005439|Ga0070711_100363208All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300005445|Ga0070708_100167334All Organisms → cellular organisms → Bacteria2051Open in IMG/M
3300005455|Ga0070663_100673247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales877Open in IMG/M
3300005518|Ga0070699_101171790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium705Open in IMG/M
3300005524|Ga0070737_10100310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1338Open in IMG/M
3300005526|Ga0073909_10003994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4357Open in IMG/M
3300005526|Ga0073909_10036472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1717Open in IMG/M
3300005532|Ga0070739_10011106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia8548Open in IMG/M
3300005532|Ga0070739_10034247All Organisms → cellular organisms → Bacteria3654Open in IMG/M
3300005537|Ga0070730_10004606All Organisms → cellular organisms → Bacteria12041Open in IMG/M
3300005545|Ga0070695_101619104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300005555|Ga0066692_10470449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300005560|Ga0066670_10987278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300005563|Ga0068855_100478526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1356Open in IMG/M
3300005569|Ga0066705_10436932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300005576|Ga0066708_10095239All Organisms → cellular organisms → Bacteria1760Open in IMG/M
3300005586|Ga0066691_10680104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300005764|Ga0066903_100034585All Organisms → cellular organisms → Bacteria5810Open in IMG/M
3300005764|Ga0066903_100043572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5339Open in IMG/M
3300005764|Ga0066903_100589944All Organisms → cellular organisms → Bacteria1921Open in IMG/M
3300005764|Ga0066903_100785215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1700Open in IMG/M
3300005764|Ga0066903_101061317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1489Open in IMG/M
3300005764|Ga0066903_101585406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1241Open in IMG/M
3300005764|Ga0066903_101978983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1119Open in IMG/M
3300005764|Ga0066903_103237738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria880Open in IMG/M
3300005893|Ga0075278_1046078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300006028|Ga0070717_10019063All Organisms → cellular organisms → Bacteria5372Open in IMG/M
3300006028|Ga0070717_10789280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300006032|Ga0066696_10089926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1823Open in IMG/M
3300006034|Ga0066656_10165536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1391Open in IMG/M
3300006059|Ga0075017_100024571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3938Open in IMG/M
3300006175|Ga0070712_101606586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300006578|Ga0074059_10006726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium759Open in IMG/M
3300006604|Ga0074060_11890366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1272Open in IMG/M
3300006755|Ga0079222_10417920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria942Open in IMG/M
3300006755|Ga0079222_11478305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300006791|Ga0066653_10034904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2009Open in IMG/M
3300006794|Ga0066658_10133587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1232Open in IMG/M
3300006797|Ga0066659_10613688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria884Open in IMG/M
3300006797|Ga0066659_11103335Not Available663Open in IMG/M
3300006800|Ga0066660_10431872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1096Open in IMG/M
3300006804|Ga0079221_10616874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300006804|Ga0079221_11126114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300006806|Ga0079220_11648689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300006854|Ga0075425_102230698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300006871|Ga0075434_102459475Not Available522Open in IMG/M
3300006893|Ga0073928_10166259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1763Open in IMG/M
3300009012|Ga0066710_100126938All Organisms → cellular organisms → Bacteria3492Open in IMG/M
3300009093|Ga0105240_11148101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium825Open in IMG/M
3300009137|Ga0066709_100477215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1751Open in IMG/M
3300009143|Ga0099792_10113099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1445Open in IMG/M
3300009148|Ga0105243_12205918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300009177|Ga0105248_11246229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300010043|Ga0126380_11845802All Organisms → cellular organisms → Bacteria → Terrabacteria group548Open in IMG/M
3300010043|Ga0126380_12021755All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300010048|Ga0126373_12275859All Organisms → cellular organisms → Bacteria → Terrabacteria group603Open in IMG/M
3300010048|Ga0126373_12606051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300010146|Ga0126320_1466932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300010147|Ga0126319_1312966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium721Open in IMG/M
3300010152|Ga0126318_10154733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1093Open in IMG/M
3300010152|Ga0126318_10835808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300010152|Ga0126318_10864342All Organisms → cellular organisms → Bacteria → Terrabacteria group596Open in IMG/M
3300010152|Ga0126318_10928501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300010154|Ga0127503_10261624All Organisms → cellular organisms → Bacteria → Terrabacteria group599Open in IMG/M
3300010154|Ga0127503_10333765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300010154|Ga0127503_10363519All Organisms → cellular organisms → Bacteria → Terrabacteria group972Open in IMG/M
3300010154|Ga0127503_11175603Not Available760Open in IMG/M
3300010154|Ga0127503_11283802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300010333|Ga0134080_10536797Not Available561Open in IMG/M
3300010335|Ga0134063_10384728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300010361|Ga0126378_10408530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1470Open in IMG/M
3300010362|Ga0126377_11953113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300010371|Ga0134125_10889166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium978Open in IMG/M
3300010376|Ga0126381_100135765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3208Open in IMG/M
3300010376|Ga0126381_102115905Not Available810Open in IMG/M
3300010376|Ga0126381_104385106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300010397|Ga0134124_12268521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300010403|Ga0134123_10200643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1697Open in IMG/M
3300012199|Ga0137383_11185748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300012208|Ga0137376_10502045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1052Open in IMG/M
3300012210|Ga0137378_10362583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1346Open in IMG/M
3300012211|Ga0137377_10691194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium955Open in IMG/M
3300012212|Ga0150985_108311205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1010Open in IMG/M
3300012212|Ga0150985_116458790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300012285|Ga0137370_10113336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1539Open in IMG/M
3300012355|Ga0137369_10788447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300012356|Ga0137371_11341387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300012397|Ga0134056_1319309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1046Open in IMG/M
3300012915|Ga0157302_10065996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1062Open in IMG/M
3300012923|Ga0137359_10978039All Organisms → cellular organisms → Bacteria → Terrabacteria group727Open in IMG/M
3300012948|Ga0126375_10848437Not Available728Open in IMG/M
3300012958|Ga0164299_10363270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300012961|Ga0164302_10209707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1206Open in IMG/M
3300012971|Ga0126369_10436250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1356Open in IMG/M
3300012971|Ga0126369_12947057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300012976|Ga0134076_10535804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300012977|Ga0134087_10160410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria985Open in IMG/M
3300013104|Ga0157370_11211371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300013105|Ga0157369_10811253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria961Open in IMG/M
3300013772|Ga0120158_10076700All Organisms → cellular organisms → Bacteria2124Open in IMG/M
3300013832|Ga0120132_1071990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium696Open in IMG/M
3300014969|Ga0157376_12196039All Organisms → cellular organisms → Bacteria → Terrabacteria group591Open in IMG/M
3300015200|Ga0173480_10992414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300015242|Ga0137412_10309532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1237Open in IMG/M
3300015374|Ga0132255_103765117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300017937|Ga0187809_10043769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1439Open in IMG/M
3300017939|Ga0187775_10289082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300017947|Ga0187785_10098526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1166Open in IMG/M
3300017947|Ga0187785_10452056All Organisms → cellular organisms → Bacteria → Terrabacteria group630Open in IMG/M
3300017947|Ga0187785_10577599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300017959|Ga0187779_10024744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3435Open in IMG/M
3300017959|Ga0187779_10698790All Organisms → cellular organisms → Bacteria → Terrabacteria group686Open in IMG/M
3300017966|Ga0187776_11518819All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300017973|Ga0187780_10016255All Organisms → cellular organisms → Bacteria5392Open in IMG/M
3300018064|Ga0187773_11255652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300018433|Ga0066667_11202823Not Available659Open in IMG/M
3300018433|Ga0066667_12023314All Organisms → cellular organisms → Bacteria → Terrabacteria group530Open in IMG/M
3300018468|Ga0066662_10212326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1542Open in IMG/M
3300018482|Ga0066669_10750533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium861Open in IMG/M
3300019361|Ga0173482_10350881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300019361|Ga0173482_10704868Not Available522Open in IMG/M
3300019888|Ga0193751_1021642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3154Open in IMG/M
3300020069|Ga0197907_10118806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1210Open in IMG/M
3300020069|Ga0197907_10177811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1395Open in IMG/M
3300020070|Ga0206356_11679712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1363Open in IMG/M
3300020075|Ga0206349_1395714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1140Open in IMG/M
3300020076|Ga0206355_1371284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300020081|Ga0206354_10082768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium789Open in IMG/M
3300021478|Ga0210402_11774092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300021560|Ga0126371_10100121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2885Open in IMG/M
3300022467|Ga0224712_10145088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1048Open in IMG/M
3300022533|Ga0242662_10194322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088636Open in IMG/M
3300024181|Ga0247693_1061905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300024182|Ga0247669_1077019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300024187|Ga0247672_1046782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300024187|Ga0247672_1060758All Organisms → cellular organisms → Bacteria → Terrabacteria group635Open in IMG/M
3300024254|Ga0247661_1029106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium985Open in IMG/M
3300024279|Ga0247692_1031041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300024323|Ga0247666_1049447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria852Open in IMG/M
3300025912|Ga0207707_10625421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria909Open in IMG/M
3300025914|Ga0207671_10495782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria974Open in IMG/M
3300025918|Ga0207662_10086774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1918Open in IMG/M
3300025922|Ga0207646_10065782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3236Open in IMG/M
3300025924|Ga0207694_10112463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2167Open in IMG/M
3300025944|Ga0207661_11274254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300026300|Ga0209027_1033825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1931Open in IMG/M
3300026300|Ga0209027_1037084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1839Open in IMG/M
3300026306|Ga0209468_1104996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria896Open in IMG/M
3300026547|Ga0209156_10056467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2063Open in IMG/M
3300026552|Ga0209577_10262452Not Available1300Open in IMG/M
3300027371|Ga0209418_1003480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2090Open in IMG/M
3300027560|Ga0207981_1094786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300027773|Ga0209810_1011683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia6542Open in IMG/M
3300027857|Ga0209166_10003026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12355Open in IMG/M
3300027903|Ga0209488_10029988All Organisms → cellular organisms → Bacteria3962Open in IMG/M
3300028802|Ga0307503_10006950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3111Open in IMG/M
3300028881|Ga0307277_10040496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1879Open in IMG/M
3300030336|Ga0247826_10736299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium768Open in IMG/M
3300030917|Ga0075382_11774544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium676Open in IMG/M
3300031231|Ga0170824_104452872All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300031231|Ga0170824_112448426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300031231|Ga0170824_112809847Not Available682Open in IMG/M
3300031231|Ga0170824_121331186All Organisms → cellular organisms → Bacteria → Terrabacteria group669Open in IMG/M
3300031446|Ga0170820_12200205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300031446|Ga0170820_14663962All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300031474|Ga0170818_101802156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300031474|Ga0170818_105970765All Organisms → cellular organisms → Bacteria → Terrabacteria group509Open in IMG/M
3300031474|Ga0170818_111856086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium863Open in IMG/M
3300031544|Ga0318534_10023178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3324Open in IMG/M
3300031716|Ga0310813_11563678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300031740|Ga0307468_102355039All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300031938|Ga0308175_100000083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria74915Open in IMG/M
3300031938|Ga0308175_100183636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2043Open in IMG/M
3300031938|Ga0308175_100792049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1036Open in IMG/M
3300031938|Ga0308175_101384880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria784Open in IMG/M
3300031939|Ga0308174_10102431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2055Open in IMG/M
3300032068|Ga0318553_10676721All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300032089|Ga0318525_10527496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium604Open in IMG/M
3300032180|Ga0307471_102568928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300032770|Ga0335085_10375651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1658Open in IMG/M
3300032893|Ga0335069_10272776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2024Open in IMG/M
3300032897|Ga0335071_10365023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1398Open in IMG/M
3300033290|Ga0318519_10719184All Organisms → cellular organisms → Bacteria → Terrabacteria group611Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.13%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil5.19%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.19%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.72%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.36%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.42%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.47%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.47%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.47%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.47%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.47%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.47%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.47%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.47%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.47%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.47%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.47%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003320Sugarcane root Sample H2Host-AssociatedOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030917Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11615J12901_1000609423300000953SoilLTRSRLFYLLLIASLFAYFLACFRFSGFSPLGMSDGGGLL*
C688J14111_1000534323300001305SoilLTRSRLIYLLLIASLFAYFLACMHMRFGGFGMSDGGGL*
C688J14111_1014001523300001305SoilLTKSRLIYLLLIASLFAYFLACLRVHGMNGIDGMSDGGGFLHL*
C688J14111_1016561323300001305SoilLTKTRLIYLLLIASLFAYILACGHFGGFGMSDGGGL*
A3PFW1_1012186123300001535PermafrostMTKARLIYLLLIASLFACLLGGMSDGGGFRPHPW*
C688J18823_1008490223300001686SoilLTKAKLIYLMLFASLFAYTLACFRVPGLSGIYGMSDGGGFL*
C688J18823_1015224723300001686SoilLTKARLIYLLLIASLFAYILACGRFGGFGMSDGGGLL*
C688J35102_11997169723300002568SoilLTKSRLIYLLLIASLFAYFLACLRVHGMNGIDGMSDGGGFL
C688J35102_12035853423300002568SoilLTKGRLIYVLLIASLFAYMLACLNLGHLIGGHGMSDGGGH*
C688J35102_12098907543300002568SoilVTNLTKAKLIYLMLFASLFAYTLACFRVPGLSGIYGMSDGGGFL*
rootH2_1010398623300003320Sugarcane Root And Bulk SoilLTKARLIYVLLIASLFAYMLACLRLPGLFGGHGMSDGGGH*
soilH2_1001450223300003324Sugarcane Root And Bulk SoilLTKSRLIYLLLIASLFAYFLACFRLPSLNPWGMSDGGGLL*
Ga0062593_10118218723300004114SoilFLLLIASLFAYSLAWFHLPGLHGIPGLSGTDGMSDGGGLL*
Ga0062595_10002138743300004479SoilLTKGRLIYLLLIASLFASMFACLNLGWLFGGHGMSDGGGH*
Ga0062595_10016594523300004479SoilLTKARLIYVLLIASLFAYMLACIRIPSLFGGHGMSDGGGH*
Ga0058863_1002636213300004799Host-AssociatedLTKARLITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV*
Ga0066677_1044230323300005171SoilLTKGRLIYVLLIASLFAYMLACLNLGHLFGGHGMSDGGGH*
Ga0066680_1051491613300005174SoilVTNLTKSRLIYLLLIASLCAYFLAHMPAFGHGMSDGGGL*
Ga0066673_1024484223300005175SoilVTNLTKSRLIYLLLIASLCAYFLARLPAFGHGMSDGGGL*
Ga0066679_1013900023300005176SoilLTKGRLIYVLLIASLFAYMLACVRLPLDHFGHGMSDGGGH*
Ga0066675_1044464723300005187SoilLTKSRLIYLLLIASLFAYFLACFRLSGFNPAGMSDGGGLLHL*
Ga0070658_1002046913300005327Corn RhizosphereVTNLTKARLITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV*
Ga0070658_1005933923300005327Corn RhizosphereVNRSRLIFLLLIASLFAYSLAWFHLPGLHGIPGLSGTDGMSDGGGLL*
Ga0066388_10015296123300005332Tropical Forest SoilLTKARLISLLLIASLFAYILACLHGFHGGGFGMSDGGGF*
Ga0070692_1087255423300005345Corn, Switchgrass And Miscanthus RhizosphereLTKTRLITVLLIASLFAYSLAWFRIPGLHGIPGLNGIDGMSDGGG
Ga0070714_10007554623300005435Agricultural SoilVNDLTKARLISLLLIASLFATVFACGSGGVLGGWLGMSSGGGF*
Ga0070714_10235355323300005435Agricultural SoilLTKGRLIYVLLIASLFAYMLACLRLPGPFGHGMSDGGGH*
Ga0070713_10003559643300005436Corn, Switchgrass And Miscanthus RhizosphereVTKLTKSRLIYLLLIASLCAYFLACFRLPVGHGMSDGGGL*
Ga0070711_10036320823300005439Corn, Switchgrass And Miscanthus RhizosphereLTKSRLIYLLLIASLFAYFLACFRVHGLHGLNGIDGMSDGGGLL*
Ga0070708_10016733433300005445Corn, Switchgrass And Miscanthus RhizosphereRKGVNDLTKTRLMYVLLIASLFAYILAYCHGGIGMSSGGGF*
Ga0070663_10067324723300005455Corn RhizosphereLTKSRLIYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL*
Ga0070699_10117179023300005518Corn, Switchgrass And Miscanthus RhizosphereVKDLTKTRLTYVLLIASLLAFALACMHGHGGGIGMSSGGGF*
Ga0070737_1010031023300005524Surface SoilLTKSRLIYALLIASLFAYLLGCLPGLWHITGMSDGGGL*
Ga0073909_1000399423300005526Surface SoilLTKSRLIYLLLIASLFAYFLACFRYHGHNGIDGMSDGGGLL*
Ga0073909_1003647223300005526Surface SoilLTKARLIHLLLIASLFAYFLACTRGHGGWGMSDGGGF*
Ga0070739_1001110623300005532Surface SoilVTNLTKTRLIYLLLIASLFAYFLACLHGPGWNGMSDGGGLFR*
Ga0070739_1003424723300005532Surface SoilLTKARLIYLVVIASLCAYLLATVLAGGMSDGGGL*
Ga0070730_10004606133300005537Surface SoilLTKGRLIYVLLTASLFAYMLSCLRLWHIGGGFGMSDGGGH*
Ga0070695_10161910423300005545Corn, Switchgrass And Miscanthus RhizosphereTEGGDDLTKARLIHLLLIASLFAYFLACTRGHGGWGMSDGGGF*
Ga0066692_1047044913300005555SoilMTKTRLTYLLLIASLFAYFLACTRGLGTAGMSDGGGLL*
Ga0066670_1098727823300005560SoilVTDLTKARLIYLLLIASLFAYFLACMGFGGMSDGGGFR*
Ga0068855_10047852623300005563Corn RhizosphereLTKGRLIYVLLIASLFAYMLACYRGGHGMSDGGGH*
Ga0066705_1043693223300005569SoilLTKGRLIYVLLIASLFAYMLACFNLGHLFGGHGMSDGGGH*
Ga0066708_1009523923300005576SoilLTKSRLIYLLLIASLCAYFLARMPAFGHGMSDGGGL*
Ga0066691_1068010413300005586SoilMTKSRLTYLLLIASLFAYFLASMGFGGMSDGGGFH*
Ga0066903_10003458523300005764Tropical Forest SoilMTKSRLIYVLLIASLLAFFLAHAHGGHGMSDGGGLL*
Ga0066903_10004357223300005764Tropical Forest SoilVTKLTKARLIYLLLIASLFAYFLACIRHSGTNGMSDGGGLL*
Ga0066903_10058994433300005764Tropical Forest SoilVTDLTKARFIYLLVLASLFAYFLACQGWWGMSDGGGFH*
Ga0066903_10078521523300005764Tropical Forest SoilMSASKQGREVTTLSKSRLIYLLLIASLFAYFLACLPGLVHISGMSDGGGL*
Ga0066903_10106131723300005764Tropical Forest SoilVTDLTKARLIYLLLIASLFAYFLACFGVGFGMSDGGGFH*
Ga0066903_10158540623300005764Tropical Forest SoilVTNLTKARLIYLLLIASLFAYILACVRHPGPTGMSDGGGLF*
Ga0066903_10197898323300005764Tropical Forest SoilLTKARLIYLLLIASLFAYVLACVRHSGTSGMSDGGGLL*
Ga0066903_10323773823300005764Tropical Forest SoilLTKARLIYLLLIASLFAYMLACLRGPVWTGMSDGGGLL*
Ga0075278_104607813300005893Rice Paddy SoilLTKARFIYLLLIASLFAFFLGCLKSGGFGMSDGGGFF*
Ga0070717_1001906363300006028Corn, Switchgrass And Miscanthus RhizosphereLTKSRLIYVLLIASLCAYFLAGFHLRGGFGMSDGGGL*
Ga0070717_1078928013300006028Corn, Switchgrass And Miscanthus RhizosphereKEVNDLTKSRLIYVLLIASLCAYFLACFHPRGGFGMSDGGGL*
Ga0066696_1008992633300006032SoilLTKARLIYLLLMAALFAYMLACIRPGMSDGGGFR*
Ga0066656_1016553623300006034SoilLTKSRLIYLLLIASLCAYFLAHMPAFGHGMSDGGGL*
Ga0075017_10002457143300006059WatershedsLTKARLIYLLLIASLFAYVLACVHGRGIYGMSDGGGFL*
Ga0070712_10160658623300006175Corn, Switchgrass And Miscanthus RhizosphereLTKARLIYLLLIASLFAYTLASCRFGSFGMSDGGGL*
Ga0074059_1000672613300006578SoilISLLLVASLFAYLLACARGVVPVGMSDGGGLHLL*
Ga0074060_1189036623300006604SoilMTKSRLISLLLVASLFAYLLACARGVVPVGMSDGGGLHLL*
Ga0079222_1041792023300006755Agricultural SoilLTSSRLIYVLLIASLFAYSLACFRYHGQNGIDGFSDGGGLL*
Ga0079222_1147830523300006755Agricultural SoilLLIASLFAYSLAWFRIPGLHGIPGLNGIDGMSDGGGLL*
Ga0066653_1003490423300006791SoilLTKSRLIYLLLIASLFAYFLACFRLSGFNPSGMSDGGGLLHL*
Ga0066658_1013358723300006794SoilLTKGRLIYVLLIASLFAYMLACVRLPLDHFGHGMSDG
Ga0066659_1061368823300006797SoilVTKLTKSRLIYLLLIASLFAYFLACFRLSGFSPTGMSDGGGLL*
Ga0066659_1110333513300006797SoilVTKLTKSRLIYLLLIASLFAYILACSHVGFGMSDGGGLI*
Ga0066660_1043187213300006800SoilLTKARFIYLLVIASLLAYFLACGHPHGGMSSGGGF*
Ga0079221_1061687423300006804Agricultural SoilVTNLTKTRLITVLLIASLFAYSLAWFRIPGLHGIPGLNGIDGMSDGGGLL*
Ga0079221_1112611413300006804Agricultural SoilKGRLIYVLLIASLFAYMFACLNLGHLFGFGHGMSDGGGH*
Ga0079220_1164868923300006806Agricultural SoilLTKSRLIYLLLIASLFAYTLACFRVSLPGIGTSGMSDGGGLL*
Ga0075425_10223069823300006854Populus RhizosphereLTKTRLIHLLLIASLFAYFLACLHPRLLGGSGMSDGGGF*
Ga0075434_10245947523300006871Populus RhizosphereVNGLTKTRLMYVLLIASLFAYILAYCHHGIGMSGGGGF*
Ga0073928_1016625923300006893Iron-Sulfur Acid SpringLTKARFIYLLLIASLFAYLLACVRIPGLDGMSDGGGFF*
Ga0066710_10012693823300009012Grasslands SoilVTNLTKSRLIYLLLIASLCAYFLARLPAFGHGMSDGGGL
Ga0105240_1114810123300009093Corn RhizosphereLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV*
Ga0066709_10047721523300009137Grasslands SoilLTKSRLIYLLLIASLFAYFLACFRLSGFNPSGMSDGGGLL*
Ga0099792_1011309943300009143Vadose Zone SoilHGKEVTILTKSRLIYVLLIASLCAYFLAHMLSFGHGMSDGGGL*
Ga0105243_1220591813300009148Miscanthus RhizosphereLTKSRLIYLVLLASLFAYFLACFRYHGHNGIDGMSDGGGLL*
Ga0105248_1124622913300009177Switchgrass RhizosphereLTKSRLVYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL*
Ga0126380_1184580213300010043Tropical Forest SoilTKARFIYLLLIASLFAYLLACIRVPGLDGMSDGGGFHFL*
Ga0126380_1202175523300010043Tropical Forest SoilMTKSRIIYLLLIASLLAYFLACAHIPIGGHGMSDGGGL*
Ga0126373_1227585913300010048Tropical Forest SoilLNKTRFIYLLLIASLFAYLLACLGLPGVDGMSDGGGFMGL*
Ga0126373_1260605123300010048Tropical Forest SoilLTKARFIYLLLIASLFAYFLACIRGPGWNGMSDGGGFF*
Ga0126320_146693223300010146SoilLTKSRLIYLLLIASLFAYLLAGYGFFGGFGMCDGGGL*
Ga0126319_131296613300010147SoilVTNLTKSRLIYVLLIASLCAYFLARMPSFGHGMSDGGGL*
Ga0126318_1015473323300010152SoilLTKSRLIYLLLIASLFAYTLACFRISLPGIGTSGMSDGGGLL*
Ga0126318_1083580823300010152SoilVTDLTKARLIYLLLIASLFAYFLACMGHGGMSDGGGLH*
Ga0126318_1086434223300010152SoilLTKARLIYVLLIASLFAYMLACLRLPGHFGGHGMSDGGGH*
Ga0126318_1092850123300010152SoilLTKGRLIYVLLIASLFAYAFACLNLGHFIHPGWGMSDGGGH*
Ga0127503_1026162423300010154SoilLTKAKLTYLLLIASLFAYLLAGAIGPGAAGMSSGGGF*
Ga0127503_1033376523300010154SoilMTKTRLTYLLLIASLFAYFLACIHGIGTGGMSDGGGLL*
Ga0127503_1036351923300010154SoilVTNLTKARLTYLLLIASLFAYLLAGAIGPGAAGMSSGGGF*
Ga0127503_1117560323300010154SoilVTNLTKARLTYLLIIASLFAYLLAGAVGAAGMSSGGGF*
Ga0127503_1128380223300010154SoilVTNLTKARLIYLLLIASLFAYFLACFHHPGPTGMSDGG
Ga0134080_1053679713300010333Grasslands SoilVTDLTKARLIYLLLIASLFAYFLACMGFGGMSDCGGFR*
Ga0134063_1038472823300010335Grasslands SoilVTNLTRSRLIYLLLIASLFAYFLACMHMRFGGFGMSDGGGL*
Ga0126378_1040853023300010361Tropical Forest SoilLNKTRFIYLLLIASLFAYLLACLGLPGIDGMSDGGGFMGL*
Ga0126377_1195311313300010362Tropical Forest SoilRLISLLLIASLFAYILACLHGFHGGGFGMSDGGGF*
Ga0134125_1088916623300010371Terrestrial SoilVTNLTKTKLIYLVLLASLFAYSLACFRMLGLIGIHGMSDGGGFM*
Ga0126381_10013576523300010376Tropical Forest SoilVTDLTKARLIYLLLLAALFAYFLASMGWGGMSDGGGLH*
Ga0126381_10211590523300010376Tropical Forest SoilLTKARLIYLLLLVSLFAYFLACMGWGGMSDGGGFH*
Ga0126381_10438510613300010376Tropical Forest SoilVNELTKSRLIYVLLIASLCAYFLACFHLRIGFGMSDGGG
Ga0134124_1226852113300010397Terrestrial SoilLTKSRLIYLVLLASLFAYFLACFRVHGLHGLNGFDGMSDGGGLL*
Ga0134123_1020064323300010403Terrestrial SoilLTKSRLIYLLLIASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL*
Ga0137383_1118574823300012199Vadose Zone SoilVTDLTKARLIYLLLIASLFAYFLACTRGLGTAGMSDGGGLL*
Ga0137376_1050204523300012208Vadose Zone SoilVNELTKGRLIYVLLIASLFAYMLACFNLGHLFGGHGMSDGGGH*
Ga0137378_1036258333300012210Vadose Zone SoilQRPFRTSVSKEGGDDLTKARFMYLLVIASLLAYFLACGHPHGGMSSGGGF*
Ga0137377_1069119423300012211Vadose Zone SoilLTKARFIYLLVIASLLAYFLACGYPHGGMSSGGGF*
Ga0150985_10831120523300012212Avena Fatua RhizosphereLTKGRLIYVLLIASLFAYMLACLNLGHLIGGRGMSDGGGH*
Ga0150985_11645879013300012212Avena Fatua RhizosphereVTNLTKTRLISVLLIASLFAYVLAFARVLGHIGINGMCDGGGLL*
Ga0137370_1011333623300012285Vadose Zone SoilVTNLTKSRLIYLLLIASLCAYFLARMPAFGHGMSDGGGL*
Ga0137369_1078844713300012355Vadose Zone SoilVTNLTKSRLIYLLLIVSLCAYFLARMPAFGHGMSDGGGL*
Ga0137371_1134138713300012356Vadose Zone SoilTEGGDELTKGRLIYVLLIASLFAYMLACFNLGHLFGGHGMSDGGGH*
Ga0134056_131930923300012397Grasslands SoilLTKSRLIYLLLIASLCAYFLAHMPAFGHGMSDGGGLL*
Ga0157302_1006599623300012915SoilMEGGDELTKSRLIYLLLIASLFAYFLACFRFHGLNGIDGMSDGGGLL*
Ga0137359_1097803923300012923Vadose Zone SoilMTKTRLTYLLLIASLLAYFLACTRGLGTAGMSDGGGLL*
Ga0126375_1084843723300012948Tropical Forest SoilLNKARLIYLLLIASLFAYVLACVRHSGPTGMSDGGGLF*
Ga0164299_1036327013300012958SoilLTKSRLIYLLLIASLFAYFLACFRYHGQHGIDGMSDGGGLL*
Ga0164302_1020970723300012961SoilLTKSRLIYLLLIASLFAYFLACFRVHGHNGIDGFSDGGGLL*
Ga0126369_1043625023300012971Tropical Forest SoilVTDLTKARLIYLLLIASLFAYFLACIRHSGTNGMSDGGGLL*
Ga0126369_1294705723300012971Tropical Forest SoilLTKARFIYLLLIASLFAYLLACIRVPGLDGMSDGGGFHFL*
Ga0134076_1053580423300012976Grasslands SoilELTRSRLIYLLLVASLFAYFLACFRVPGLNGIFGMSDGGGLL*
Ga0134087_1016041023300012977Grasslands SoilLTKSRFIYLLLIASLCAYFLAHMPAFGHGMSDGGGL*
Ga0157370_1121137113300013104Corn RhizosphereQRKGGDEVNRSRLIFLLLIASLFAYSLAWFHLPGLQGIPGLSGTDGMSDGGGFR*
Ga0157369_1081125313300013105Corn RhizosphereTRLITVLLIASLFAYSLAWFRIPGLHGIPGLNGIDGMSDGGGLL*
Ga0120158_1007670023300013772PermafrostVNDLTKARFIQVLLIASLFAYIFACMHIPGMSDGGGW*
Ga0120132_107199023300013832PermafrostLTKARLIYLLVIASLFAYILACVRLPGTDGMSDGGGLL*
Ga0157376_1219603913300014969Miscanthus RhizosphereELTKSRLIYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL*
Ga0173480_1099241413300015200SoilLTKSRLIYLVLLASLFAYFLACFRFHGLNGIDGMSDGGGLL*
Ga0137412_1030953213300015242Vadose Zone SoilLTKSRLIYVLLIASLCAYFLAHMPSFGHGMSDGGGL*
Ga0132255_10376511713300015374Arabidopsis RhizosphereKSRLIYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL*
Ga0187809_1004376923300017937Freshwater SedimentLTKARLIYLLLIASLFAYLLACVRVPGLDGMSDGGGFHFL
Ga0187775_1028908223300017939Tropical PeatlandLTKARLISLLLIASLFAYFLACLHGIHGWHGMSDGGGF
Ga0187785_1009852623300017947Tropical PeatlandMTKARLIYLLLIASLFAYMLACVRHHGPTGMSDGGGLLL
Ga0187785_1045205633300017947Tropical PeatlandLTKARLIYLLLLVSLFAYFLACMGWGGMSDGGGFH
Ga0187785_1057759923300017947Tropical PeatlandLTKSRLIYLLLIASLFAYFLSCVPGLWHITGMSDGGGLR
Ga0187779_1002474433300017959Tropical PeatlandLTKTRFIYLLLIASLLAYFLACSHGHGIFGMSDGGGLL
Ga0187779_1069879023300017959Tropical PeatlandMTKSRLIYLLLVASLFAYLLACVRFHGLDGMSDGGGL
Ga0187776_1107020613300017966Tropical PeatlandGGDDVTKARLMYLLVIAAIFALALASLRPIGMSDGGGLLFR
Ga0187776_1151881923300017966Tropical PeatlandVTDLTKARLITLLLMASLFAYILACIQFPGMSDGGGFR
Ga0187780_1001625553300017973Tropical PeatlandLTKARFIYLLLIASLFAYFLACLRGPGWSGMSDGGGLF
Ga0187773_1125565213300018064Tropical PeatlandLTKARLIYLLLMASLFAYILACMRAPGMSDGGGFR
Ga0066667_1120282313300018433Grasslands SoilVTDLTKARLIYLLLIASLFAYFLACMGFGGMSDGGGFR
Ga0066667_1202331423300018433Grasslands SoilLTKGRLIYVLLIASLFAYMLACFNLGHLFGGHGMSDGGGH
Ga0066662_1021232623300018468Grasslands SoilLTKGRLIYVLLIASLFAYMLACVRLPLDHFGHGMSDGGGH
Ga0066669_1075053323300018482Grasslands SoilLTKSRLIYLLLIASLFAYFLACFRLSGFNPSGMSDGGGLLHL
Ga0173482_1035088123300019361SoilLTKSRLIYLVLLASLFAYFLACFRVHGLHGLNGIDGMSDGGGLL
Ga0173482_1070486813300019361SoilLTKSRLIYLLLIASLFAYFLACFRVHGLHGLNGIDGMSDG
Ga0193751_102164233300019888SoilVNDLTKARFIQVLLIASLFAYIFACLHIPGMSDGGGW
Ga0197907_1011880623300020069Corn, Switchgrass And Miscanthus RhizosphereLTKGRLIYVLLIASLFAYMLACYRGGHGMSDGGGH
Ga0197907_1017781123300020069Corn, Switchgrass And Miscanthus RhizosphereVTNLTKARLITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV
Ga0206356_1167971223300020070Corn, Switchgrass And Miscanthus RhizosphereVNRSRLIFLLLIASLFAYSLAWFHLPGLQGIPGLSGTDGMSDGGGLL
Ga0206349_139571423300020075Corn, Switchgrass And Miscanthus RhizosphereVNRSRLIFLLLIASLFAYSLAWFHLPGLHGIPGLSGTDGMSDGGGLL
Ga0206355_137128423300020076Corn, Switchgrass And Miscanthus RhizosphereLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV
Ga0206354_1008276823300020081Corn, Switchgrass And Miscanthus RhizosphereLTKSRLIYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL
Ga0210402_1177409223300021478SoilVTTLTKSRLIYLLLIASLFAYFLACLPGLWQVSGMSDGGGL
Ga0126371_1010012133300021560Tropical Forest SoilLTKSRLIYVLLIASLCAYFLACFHLRIGFGMSDGGGL
Ga0224712_1014508823300022467Corn, Switchgrass And Miscanthus RhizosphereVTNLTKTRLITVLLIASLFAYSLAWFRIPGLHGIPGLNGIDGMSDGGGLL
Ga0242662_1019432233300022533SoilMTKSRLISVLLVASLFAYLLACARGVVPVGMSDGGGLHLL
Ga0247693_106190513300024181SoilLTKSRLIYLLLIASLFAYFLACFRLSGFNPSGMSDGGGLL
Ga0247669_107701913300024182SoilNLTKARLITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV
Ga0247672_104678223300024187SoilVTDLTKARLIYLLLIASLFAYFLASMGWGGMSDGGGFH
Ga0247672_106075823300024187SoilGKEVTKLTKSRLIYLLLIASLCAYFLACFRLPVGHGMSDGGGL
Ga0247661_102910613300024254SoilGDDLTKARLIHLLLIASLFAYFLACTRGHGGWGMSDGGGF
Ga0247692_103104113300024279SoilLTKSRLIYLLLIASLCAYFLACFRLPVGHGMSDGGGL
Ga0247666_104944713300024323SoilARLITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV
Ga0207707_1062542113300025912Corn RhizosphereVNRSRLIFLLLIASLFAYSLAWFHLPGLQGIPGLSGTDGMSD
Ga0207671_1049578213300025914Corn RhizosphereVNRSRLIFLLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV
Ga0207662_1008677423300025918Switchgrass RhizosphereLTKSRLIYLLLIASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL
Ga0207646_1006578243300025922Corn, Switchgrass And Miscanthus RhizosphereVTNLTKVRLISLLLIASLFAYSLAYLGGFGMCDGGGLF
Ga0207694_1011246323300025924Corn RhizosphereLTKSRLVYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL
Ga0207661_1127425413300025944Corn RhizosphereLTKSRLIYLVLLASLFAYFLACFRFHGLHGLNGID
Ga0209027_103382523300026300Grasslands SoilLTKSRLIYLLLTASLFAYFLACFRLSGFNPSGMSDGGGLL
Ga0209027_103708423300026300Grasslands SoilLTKSRLIYLLLIASLCAYFLARIPAFGHGMSDGGGL
Ga0209468_110499623300026306SoilDELTKSRLIYLLLIASLFAYFLACFRLSGFNPSGMSDGGGLL
Ga0209156_1005646723300026547SoilLTKSRLIYLLLIASLCAYFLAHMPAFGHGMSDGGGL
Ga0209577_1026245213300026552SoilEGGDDLTKARFMYLLVIASLLAYFLACGHPHGGMSSGGGF
Ga0209418_100348033300027371Forest SoilLTKARLTYLLLIASLFAYFLACTRGHGGLGMSDGGGF
Ga0207981_109478623300027560SoilLTKSRLIYLLLIASLFAYFLACFHHPGPTGMSDGGGL
Ga0209810_101168373300027773Surface SoilLTKTRLIYLLLIASLFAYFLACLHGPGWNGMSDGGGLFR
Ga0209166_1000302663300027857Surface SoilLTKGRLIYVLLTASLFAYMLSCLRLWHIGGGFGMSDGGGH
Ga0209488_1002998833300027903Vadose Zone SoilVTNLTKSRLIYLLLIASLCAYFLARMPSFGHGMSDGGGL
Ga0307503_1000695013300028802SoilVTNLTKSRLIYLVLMASLLAYFLACFRHPIGGFGMSDGGGL
Ga0307277_1004049623300028881SoilLTKSRLIYLLLIASLFAYFLACFRVHGLNGIDGMSDGGGFLHL
Ga0247826_1073629923300030336SoilLTKSRLIYLVLLASLFAYFLACFRVHGLHGLNGFDGMSDGGGLL
Ga0075382_1177454423300030917SoilLTKSRLIYLLLIASLLAYFLACFRHPIGGFGMSDGGGL
Ga0170824_10445287223300031231Forest SoilLTKARLIYLLLIASLFAYFLACIHPKYGGSGMSDGGGF
Ga0170824_11244842623300031231Forest SoilLTKSRLIYLLLIASLFAYFLACFRLSGLSPSGMSDGGGLL
Ga0170824_11280984723300031231Forest SoilMTNLTKARLMYLLLIASLFAYLLAGAIGPGAFGMSSGGGF
Ga0170824_12133118623300031231Forest SoilLTKGRLIYVLLIASLFAYMLACLHIGQLFGGHGMSDGGGH
Ga0170820_1220020523300031446Forest SoilMTKSRLTYLLLIASLFAYLLASARGVVPVGMSDGGGLL
Ga0170820_1466396213300031446Forest SoilLTKARLIHLLIIASLFAYFLACTRGHGGFGMSDGGGF
Ga0170818_10180215613300031474Forest SoilMTKSRLTYLLLIASLLAFFLASARGVVPVGMSDGGGLL
Ga0170818_10597076513300031474Forest SoilLTKARLIYLLIIASLFAYILACTRGHGGFGMSDGGGF
Ga0170818_11185608613300031474Forest SoilVTNLTKSRLIYLLLIASLLAYFLACFRHPIGGFGMSDGGGL
Ga0318534_1002317823300031544SoilLTKARFIYLLLIASLFAYFLACIRGPGWSGMSDGGGFF
Ga0310813_1156367823300031716SoilITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV
Ga0307468_10235503923300031740Hardwood Forest SoilVTNLTKARLMYLLLIASLFAYLLACLGGPVGAGMSSGGGF
Ga0308175_100000083673300031938SoilLTKARFIYLLLIASLFAYFLACFHGGWGGMSNGGGF
Ga0308175_10018363623300031938SoilLTKTRLISVLLIASLFAYVLAFARVLGHIGINGMCDGGGLL
Ga0308175_10079204913300031938SoilVTDLTKAKLIYLVLLASLFAYTLACFRVPGLSGIYGMSDGGGFF
Ga0308175_10138488023300031938SoilLTKSRLIYLLLIASLFAYFLACFRVHGFSPSGMSDGGGLLYL
Ga0308174_1010243123300031939SoilLTKSRLIYLLLIASLFAYLLAGYGFFGGFGMCDGGGL
Ga0318553_1067672113300032068SoilGKEVTTLKARLIYLLLIASLFAYLLACLHQRGPTGMSDGGGLY
Ga0318525_1052749623300032089SoilLTKARFIYLLLIASLFAYFLACIRGPGWTGMSDGGGFL
Ga0307471_10256892823300032180Hardwood Forest SoilGKEVTDLTKHRLINLLLIASLFAFILASLYGPGQLGMSDGGGLI
Ga0335085_1037565123300032770SoilVNELTKSRLIYVLLIASLCAYFLACFHFRGGFGMSDGGGLL
Ga0335069_1027277623300032893SoilVNELTKSRLIYVLLIASLCAYFLACFHSRGGFGMSDGGGLL
Ga0335071_1036502313300032897SoilLTKARLIYLLLIASLFAYILACSRHAGPSGMSDGGGFF
Ga0318519_1071918423300033290SoilLTKARLMYLLVIASLFAYLLACSRGPGGFGMSDGGGF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.