Metagenome / Metatranscriptome Family F023133

Basic Information
Family ID	F023133
Family Type	Metagenome / Metatranscriptome
Number of Sequences	211
Average Sequence Length	78 residues
Representative Sequence	MVITKLNRSLAKQDPEGTFNNPLVIVDETMFTRGEKIATLDRWRQSILAELTAVGEVKRARLLGEIEEARNRLSR
Number of Associated Samples	154
Number of Associated Scaffolds	211

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	76.30 %
% of genes near scaffold ends (potentially truncated)	34.12 %
% of genes from short scaffolds (< 2000 bps)	91.00 %
Associated GOLD sequencing projects	143
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.63

Most Common Taxonomy
Group	Bacteria (92.891 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (18.483 % of family members)
Environment Ontology (ENVO)	Unclassified (27.488 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (50.711 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.54% β-sheet: 0.00% Coil/Unstructured: 51.46%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 211 Family Scaffolds
PF10590	PNP_phzG_C	6.64
PF03401	TctC	1.90
PF02882	THF_DHG_CYH_C	1.90
PF00364	Biotin_lipoyl	1.42
PF00579	tRNA-synt_1b	1.42
PF01734	Patatin	1.42
PF00892	EamA	1.42
PF02492	cobW	1.42
PF07045	DUF1330	1.42
PF05656	DUF805	1.42
PF03454	MoeA_C	0.95
PF05199	GMC_oxred_C	0.95
PF00067	p450	0.95
PF04752	ChaC	0.47
PF01145	Band_7	0.47
PF05016	ParE_toxin	0.47
PF00571	CBS	0.47
PF01546	Peptidase_M20	0.47
PF01627	Hpt	0.47
PF00982	Glyco_transf_20	0.47
PF10531	SLBB	0.47
PF01842	ACT	0.47
PF04290	DctQ	0.47
PF12728	HTH_17	0.47
PF09361	Phasin_2	0.47
PF06568	DUF1127	0.47
PF01926	MMR_HSR1	0.47
PF03079	ARD	0.47
PF04909	Amidohydro_2	0.47
PF13560	HTH_31	0.47
PF12681	Glyoxalase_2	0.47
PF01613	Flavin_Reduct	0.47
PF02785	Biotin_carb_C	0.47
PF05194	UreE_C	0.47

COG ID	Name	Functional Category	% Frequency in 211 Family Scaffolds
COG0190	5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase	Coenzyme transport and metabolism [H]	1.90
COG0686	Alanine dehydrogenase (includes sporulation protein SpoVN)	Amino acid transport and metabolism [E]	1.90
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.90
COG0162	Tyrosyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	1.42
COG0180	Tryptophanyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	1.42
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	1.42
COG3152	Uncharacterized membrane protein YhaH, DUF805 family	Function unknown [S]	1.42
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	1.42
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	1.42
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	1.42
COG0303	Molybdopterin Mo-transferase (molybdopterin biosynthesis)	Coenzyme transport and metabolism [H]	0.95
COG2124	Cytochrome P450	Defense mechanisms [V]	0.95
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.95
COG0380	Trehalose-6-phosphate synthase, GT20 family	Carbohydrate transport and metabolism [G]	0.47
COG1791	Acireductone dioxygenase (methionine salvage), cupin superfamily	Amino acid transport and metabolism [E]	0.47
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	0.47
COG2371	Urease accessory protein UreE	Posttranslational modification, protein turnover, chaperones [O]	0.47
COG3703	Gamma-glutamylcyclotransferase ChaC2 (glutathione degradation)	Inorganic ion transport and metabolism [P]	0.47
COG5457	Uncharacterized conserved protein YjiS, DUF1127 family	Function unknown [S]	0.47

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.36 %
Unclassified	root	N/A	6.64 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.36 %
Unclassified	root	N/A	6.64 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.89 %
Unclassified	root	N/A	6.64 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.47 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	87.68 %
Unclassified	root	N/A	6.64 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.47 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	83.89 %
Unclassified	root	N/A	6.64 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.47 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.47 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	66.82 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10.90 %
Unclassified	root	N/A	6.64 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.47 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	3.79 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.90 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.47 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	1.42 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Roseococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus	0.47 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.95 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
unclassified Hyphomicrobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium	0.47 %
unclassified Roseococcus	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus	0.47 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	66.82 %
Unclassified	root	N/A	6.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.90 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1.42 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	0.47 %
Hyphomicrobium sp. SCN 65-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	0.47 %
Roseococcus sp. SYP-B2431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	0.47 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.47 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.47 %
bacterium ADurb.Bin132	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	0.47 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003319\|soilL2_10314482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1108	Open in IMG/M
3300004114\|Ga0062593_100203607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1579	Open in IMG/M
3300004114\|Ga0062593_100762336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	955	Open in IMG/M
3300004156\|Ga0062589_100509023	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin132	1017	Open in IMG/M
3300004156\|Ga0062589_101030873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	772	Open in IMG/M
3300004156\|Ga0062589_101233983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	718	Open in IMG/M
3300004157\|Ga0062590_101225165	Not Available	733	Open in IMG/M
3300004463\|Ga0063356_101929393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	891	Open in IMG/M
3300004463\|Ga0063356_103060684	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	720	Open in IMG/M
3300004479\|Ga0062595_100579643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	868	Open in IMG/M
3300004479\|Ga0062595_100966617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	727	Open in IMG/M
3300004480\|Ga0062592_100502098	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1002	Open in IMG/M
3300005093\|Ga0062594_100013928	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3070	Open in IMG/M
3300005093\|Ga0062594_100523712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1011	Open in IMG/M
3300005093\|Ga0062594_102987245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	528	Open in IMG/M
3300005330\|Ga0070690_100295860	Not Available	1159	Open in IMG/M
3300005332\|Ga0066388_102387153	All Organisms → cellular organisms → Bacteria → Proteobacteria	959	Open in IMG/M
3300005336\|Ga0070680_101734959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	541	Open in IMG/M
3300005340\|Ga0070689_100892268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	786	Open in IMG/M
3300005343\|Ga0070687_100726038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	696	Open in IMG/M
3300005345\|Ga0070692_11412185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	503	Open in IMG/M
3300005347\|Ga0070668_101709593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	578	Open in IMG/M
3300005438\|Ga0070701_10371994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	898	Open in IMG/M
3300005440\|Ga0070705_100643490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	826	Open in IMG/M
3300005440\|Ga0070705_101042940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	666	Open in IMG/M
3300005441\|Ga0070700_101425458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	586	Open in IMG/M
3300005441\|Ga0070700_101456714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	581	Open in IMG/M
3300005441\|Ga0070700_101660043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	547	Open in IMG/M
3300005529\|Ga0070741_10213496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1867	Open in IMG/M
3300005529\|Ga0070741_11345918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	595	Open in IMG/M
3300005544\|Ga0070686_100906124	All Organisms → cellular organisms → Bacteria → Proteobacteria	718	Open in IMG/M
3300005549\|Ga0070704_100701265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	898	Open in IMG/M
3300005564\|Ga0070664_101656529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	606	Open in IMG/M
3300005569\|Ga0066705_10294482	Not Available	1029	Open in IMG/M
3300005614\|Ga0068856_100644425	All Organisms → cellular organisms → Bacteria	1080	Open in IMG/M
3300005718\|Ga0068866_11369633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	516	Open in IMG/M
3300005719\|Ga0068861_100429539	Not Available	1179	Open in IMG/M
3300005719\|Ga0068861_101871706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	596	Open in IMG/M
3300005764\|Ga0066903_100191480	Not Available	3039	Open in IMG/M
3300005841\|Ga0068863_100422773	All Organisms → cellular organisms → Bacteria	1306	Open in IMG/M
3300005843\|Ga0068860_101025971	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	843	Open in IMG/M
3300005937\|Ga0081455_10252620	All Organisms → cellular organisms → Bacteria	1289	Open in IMG/M
3300005985\|Ga0081539_10040626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2729	Open in IMG/M
3300005985\|Ga0081539_10142955	All Organisms → cellular organisms → Bacteria	1160	Open in IMG/M
3300006041\|Ga0075023_100577317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	519	Open in IMG/M
3300006046\|Ga0066652_101100330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	753	Open in IMG/M
3300006047\|Ga0075024_100496554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	639	Open in IMG/M
3300006057\|Ga0075026_100608600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	643	Open in IMG/M
3300006196\|Ga0075422_10029800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1895	Open in IMG/M
3300006196\|Ga0075422_10148546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	935	Open in IMG/M
3300006755\|Ga0079222_12203979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	548	Open in IMG/M
3300006791\|Ga0066653_10150314	Not Available	1133	Open in IMG/M
3300006791\|Ga0066653_10527340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	597	Open in IMG/M
3300006800\|Ga0066660_10318571	All Organisms → cellular organisms → Bacteria	1249	Open in IMG/M
3300006844\|Ga0075428_100074865	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3698	Open in IMG/M
3300006844\|Ga0075428_100079085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3589	Open in IMG/M
3300006844\|Ga0075428_100117872	All Organisms → cellular organisms → Bacteria → Proteobacteria	2892	Open in IMG/M
3300006844\|Ga0075428_100488594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1317	Open in IMG/M
3300006844\|Ga0075428_100805381	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	998	Open in IMG/M
3300006844\|Ga0075428_100963867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	904	Open in IMG/M
3300006845\|Ga0075421_100657855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	1223	Open in IMG/M
3300006845\|Ga0075421_101908862	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	635	Open in IMG/M
3300006847\|Ga0075431_100155101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	2356	Open in IMG/M
3300006852\|Ga0075433_10733102	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	865	Open in IMG/M
3300006854\|Ga0075425_101661791	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	719	Open in IMG/M
3300006865\|Ga0073934_10803819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431	536	Open in IMG/M
3300006871\|Ga0075434_100973096	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	863	Open in IMG/M
3300006876\|Ga0079217_11246298	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	570	Open in IMG/M
3300006880\|Ga0075429_100214472	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1686	Open in IMG/M
3300006881\|Ga0068865_101430692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	618	Open in IMG/M
3300006914\|Ga0075436_101154943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	584	Open in IMG/M
3300006969\|Ga0075419_10373170	All Organisms → cellular organisms → Bacteria → Proteobacteria	973	Open in IMG/M
3300006969\|Ga0075419_10479949	All Organisms → cellular organisms → Bacteria	861	Open in IMG/M
3300006969\|Ga0075419_10536656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	816	Open in IMG/M
3300006969\|Ga0075419_10580094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	786	Open in IMG/M
3300007004\|Ga0079218_10317752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1276	Open in IMG/M
3300009094\|Ga0111539_11123983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	913	Open in IMG/M
3300009098\|Ga0105245_11343734	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	764	Open in IMG/M
3300009100\|Ga0075418_10270790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1809	Open in IMG/M
3300009100\|Ga0075418_10431748	Not Available	1411	Open in IMG/M
3300009100\|Ga0075418_11910206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	646	Open in IMG/M
3300009146\|Ga0105091_10660129	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	545	Open in IMG/M
3300009147\|Ga0114129_10507453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1574	Open in IMG/M
3300009147\|Ga0114129_11547381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	813	Open in IMG/M
3300009148\|Ga0105243_10478289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1175	Open in IMG/M
3300009148\|Ga0105243_12615453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	544	Open in IMG/M
3300009156\|Ga0111538_10008945	All Organisms → cellular organisms → Bacteria	13405	Open in IMG/M
3300009156\|Ga0111538_11139262	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	986	Open in IMG/M
3300009176\|Ga0105242_12253746	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	590	Open in IMG/M
3300009553\|Ga0105249_10648226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1113	Open in IMG/M
3300009609\|Ga0105347_1348302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	631	Open in IMG/M
3300009610\|Ga0105340_1323800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	677	Open in IMG/M
3300009837\|Ga0105058_1149371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	567	Open in IMG/M
3300010166\|Ga0126306_10604494	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	874	Open in IMG/M
3300010371\|Ga0134125_11935106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	641	Open in IMG/M
3300010375\|Ga0105239_13139204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	538	Open in IMG/M
3300010397\|Ga0134124_12680213	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	542	Open in IMG/M
3300010397\|Ga0134124_12969788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	518	Open in IMG/M
3300010399\|Ga0134127_10150393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2113	Open in IMG/M
3300010399\|Ga0134127_11105347	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	857	Open in IMG/M
3300010400\|Ga0134122_11907734	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	629	Open in IMG/M
3300010401\|Ga0134121_10509825	All Organisms → cellular organisms → Bacteria	1109	Open in IMG/M
3300011003\|Ga0138514_100134842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	546	Open in IMG/M
3300011119\|Ga0105246_10379118	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1168	Open in IMG/M
3300011119\|Ga0105246_10859136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	810	Open in IMG/M
3300011119\|Ga0105246_11852010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	578	Open in IMG/M
3300011415\|Ga0137325_1024230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1221	Open in IMG/M
3300011430\|Ga0137423_1135725	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	738	Open in IMG/M
3300011440\|Ga0137433_1265357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	559	Open in IMG/M
3300011445\|Ga0137427_10284316	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	694	Open in IMG/M
3300012198\|Ga0137364_11411629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	515	Open in IMG/M
3300012212\|Ga0150985_107863833	Not Available	542	Open in IMG/M
3300012212\|Ga0150985_115677844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1336	Open in IMG/M
3300012672\|Ga0137317_1032144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	527	Open in IMG/M
3300012893\|Ga0157284_10308546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	521	Open in IMG/M
3300012901\|Ga0157288_10216495	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	621	Open in IMG/M
3300012904\|Ga0157282_10193581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	652	Open in IMG/M
3300012912\|Ga0157306_10259402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	617	Open in IMG/M
3300012948\|Ga0126375_11926088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	520	Open in IMG/M
3300012951\|Ga0164300_10110287	All Organisms → cellular organisms → Bacteria	1225	Open in IMG/M
3300012955\|Ga0164298_10582965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	764	Open in IMG/M
3300012955\|Ga0164298_11261477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	564	Open in IMG/M
3300012957\|Ga0164303_10092222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1477	Open in IMG/M
3300012958\|Ga0164299_11357741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	547	Open in IMG/M
3300012971\|Ga0126369_10832473	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1006	Open in IMG/M
3300012984\|Ga0164309_11247876	Not Available	626	Open in IMG/M
3300012986\|Ga0164304_11317995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	589	Open in IMG/M
3300012988\|Ga0164306_10574135	Not Available	879	Open in IMG/M
3300012989\|Ga0164305_11405702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	615	Open in IMG/M
3300013296\|Ga0157374_11183287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	786	Open in IMG/M
3300013308\|Ga0157375_12230154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	652	Open in IMG/M
3300014326\|Ga0157380_10332255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1414	Open in IMG/M
3300014326\|Ga0157380_10416927	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1279	Open in IMG/M
3300014326\|Ga0157380_10691268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1024	Open in IMG/M
3300014652\|Ga0134319_105362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	872	Open in IMG/M
3300014745\|Ga0157377_11285365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	571	Open in IMG/M
3300014968\|Ga0157379_11351065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	689	Open in IMG/M
3300015077\|Ga0173483_10454469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	672	Open in IMG/M
3300015077\|Ga0173483_10624381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	596	Open in IMG/M
3300015077\|Ga0173483_10628362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	595	Open in IMG/M
3300015195\|Ga0167658_1013517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2424	Open in IMG/M
3300015242\|Ga0137412_10540714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	888	Open in IMG/M
3300015245\|Ga0137409_11231575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	590	Open in IMG/M
3300015258\|Ga0180093_1056968	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	893	Open in IMG/M
3300015371\|Ga0132258_11432762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1745	Open in IMG/M
3300015371\|Ga0132258_12797317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1215	Open in IMG/M
3300015373\|Ga0132257_101678869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	814	Open in IMG/M
3300015374\|Ga0132255_104320204	Not Available	603	Open in IMG/M
3300017936\|Ga0187821_10075344	Not Available	1226	Open in IMG/M
3300018072\|Ga0184635_10097513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1161	Open in IMG/M
3300018072\|Ga0184635_10166714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	880	Open in IMG/M
3300018072\|Ga0184635_10193233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	812	Open in IMG/M
3300018072\|Ga0184635_10305639	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	621	Open in IMG/M
3300018073\|Ga0184624_10222221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	845	Open in IMG/M
3300018081\|Ga0184625_10245088	All Organisms → cellular organisms → Bacteria → Proteobacteria	939	Open in IMG/M
3300018081\|Ga0184625_10336844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	785	Open in IMG/M
3300018083\|Ga0184628_10346534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	779	Open in IMG/M
3300018083\|Ga0184628_10629626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	540	Open in IMG/M
3300018422\|Ga0190265_10107547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2632	Open in IMG/M
3300018429\|Ga0190272_10100798	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1855	Open in IMG/M
3300018429\|Ga0190272_12389425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	572	Open in IMG/M
3300018431\|Ga0066655_10491250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	812	Open in IMG/M
3300018469\|Ga0190270_12319276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	598	Open in IMG/M
3300018469\|Ga0190270_13377561	All Organisms → cellular organisms → Bacteria → Proteobacteria	506	Open in IMG/M
3300018481\|Ga0190271_11717755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	741	Open in IMG/M
3300018482\|Ga0066669_10688807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	900	Open in IMG/M
3300019356\|Ga0173481_10508532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	615	Open in IMG/M
3300019377\|Ga0190264_10236625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1045	Open in IMG/M
3300019884\|Ga0193741_1089852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	788	Open in IMG/M
3300020020\|Ga0193738_1103372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	812	Open in IMG/M
3300021082\|Ga0210380_10044776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1904	Open in IMG/M
3300021082\|Ga0210380_10390339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	636	Open in IMG/M
3300025901\|Ga0207688_10589572	Not Available	700	Open in IMG/M
3300025923\|Ga0207681_11352110	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	598	Open in IMG/M
3300025932\|Ga0207690_11034459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	684	Open in IMG/M
3300025935\|Ga0207709_11502197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	559	Open in IMG/M
3300025936\|Ga0207670_11023036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	696	Open in IMG/M
3300025961\|Ga0207712_10560008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	984	Open in IMG/M
3300026075\|Ga0207708_11486539	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	595	Open in IMG/M
3300026325\|Ga0209152_10195708	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	759	Open in IMG/M
3300026498\|Ga0257156_1105296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	587	Open in IMG/M
3300027873\|Ga0209814_10102199	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. SCN 65-11	1216	Open in IMG/M
3300027880\|Ga0209481_10029401	Not Available	2477	Open in IMG/M
3300027880\|Ga0209481_10745605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	509	Open in IMG/M
3300027907\|Ga0207428_10002063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	20271	Open in IMG/M
3300027907\|Ga0207428_10006081	All Organisms → cellular organisms → Bacteria	11164	Open in IMG/M
3300027907\|Ga0207428_10134060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1894	Open in IMG/M
3300027909\|Ga0209382_10007072	All Organisms → cellular organisms → Bacteria → Proteobacteria	14360	Open in IMG/M
3300027909\|Ga0209382_10008704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	12769	Open in IMG/M
3300027909\|Ga0209382_10010629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	11451	Open in IMG/M
3300027909\|Ga0209382_10087516	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3663	Open in IMG/M
3300027909\|Ga0209382_12231684	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	517	Open in IMG/M
3300027915\|Ga0209069_11042444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	504	Open in IMG/M
3300028381\|Ga0268264_10264106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1605	Open in IMG/M
3300028381\|Ga0268264_11465855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	693	Open in IMG/M
3300028596\|Ga0247821_10190551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1208	Open in IMG/M
3300030903\|Ga0308206_1036466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	920	Open in IMG/M
3300031198\|Ga0307500_10201150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	595	Open in IMG/M
3300031562\|Ga0310886_10953846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	548	Open in IMG/M
3300031573\|Ga0310915_10824500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	652	Open in IMG/M
3300031740\|Ga0307468_100756654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	822	Open in IMG/M
3300031740\|Ga0307468_102343490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	520	Open in IMG/M
3300031858\|Ga0310892_10860542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	632	Open in IMG/M
3300032013\|Ga0310906_11233442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	545	Open in IMG/M
3300032075\|Ga0310890_10607473	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	847	Open in IMG/M
3300032122\|Ga0310895_10639106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	549	Open in IMG/M
3300033551\|Ga0247830_11665644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	511	Open in IMG/M
3300033815\|Ga0364946_037677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	976	Open in IMG/M
3300034147\|Ga0364925_0240586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	672	Open in IMG/M
3300034149\|Ga0364929_0290455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	557	Open in IMG/M
3300034155\|Ga0370498_000094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	31875	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	61.14%
Host-Associated	Host-Associated	38.86%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	48.34%
Plants	Host-Associated → Plants	38.86%
Aquatic	Environmental → Aquatic	12.80%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	46.45%
Rhizosphere	Host-Associated → Plants → Rhizosphere	28.91%
Sediment	Environmental → Aquatic → Sediment	9.95%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.95%
Freshwater	Environmental → Aquatic → Freshwater	1.90%
Floodplain	Environmental → Terrestrial → Floodplain	1.42%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.95%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.47%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.44%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	27.01%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	9.95%
Loam	Environmental → Terrestrial → Soil → Loam	8.06%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.84%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.90%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.42%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.42%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.47%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.47%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	0.47%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.47%
Sand	Environmental → Terrestrial → Soil → Sand	0.47%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.47%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	27.01%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.85%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	9.95%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	7.58%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.11%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.79%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.32%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.84%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.90%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.90%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.42%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.95%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.47%
Alkaline	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline	0.47%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	0.47%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.47%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.47%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.47%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	18.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	13.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	5.69%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.27%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.27%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	3.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.79%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.84%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.37%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.90%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.90%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.90%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.42%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.42%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.42%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.95%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.95%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.95%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.95%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.95%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.95%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.95%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.95%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.95%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.95%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.95%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.47%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.47%
Alkaline Hot Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Alkaline Hot Spring	0.47%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	0.47%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.47%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.47%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.47%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.47%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.47%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.47%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.47%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.47%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.47%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.47%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011003	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011415	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2	Environmental	Open in IMG/M
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental	Open in IMG/M
3300011440	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2	Environmental	Open in IMG/M
3300011445	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012672	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2	Environmental	Open in IMG/M
3300012893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1	Environmental	Open in IMG/M
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental	Open in IMG/M
3300012904	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014652	Alkaline hot spring microbial communities from Galicia, Spain - Lobios hot spring	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015195	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015258	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300019884	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2	Environmental	Open in IMG/M
3300020020	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300026498	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028596	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14	Environmental	Open in IMG/M
3300030903	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300033815	Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17	Environmental	Open in IMG/M
3300034147	Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M
3300034155	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.63
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.63
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F023133

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign