NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F023934

Metagenome / Metatranscriptome Family F023934

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F023934
Family Type Metagenome / Metatranscriptome
Number of Sequences 208
Average Sequence Length 41 residues
Representative Sequence MKQAYTWSAIAAIVLASTTGDVLLSRAMKQVGDVGELWR
Number of Associated Samples 182
Number of Associated Scaffolds 208

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 88.35 %
% of genes near scaffold ends (potentially truncated) 97.60 %
% of genes from short scaffolds (< 2000 bps) 88.46 %
Associated GOLD sequencing projects 175
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.558 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.269 % of family members)
Environment Ontology (ENVO) Unclassified
(23.077 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.365 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 55.22%    β-sheet: 0.00%    Coil/Unstructured: 44.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 208 Family Scaffolds
PF00892EamA 26.92
PF04055Radical_SAM 18.27
PF13536EmrE 7.69
PF02321OEP 0.96
PF02472ExbD 0.48
PF07642BBP2 0.48
PF02580Tyr_Deacylase 0.48
PF01850PIN 0.48
PF16576HlyD_D23 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 208 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.92
COG0848Biopolymer transport protein ExbDIntracellular trafficking, secretion, and vesicular transport [U] 0.48
COG1490D-aminoacyl-tRNA deacylaseTranslation, ribosomal structure and biogenesis [J] 0.48

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.56 %
UnclassifiedrootN/A1.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100795651All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1341Open in IMG/M
3300000567|JGI12270J11330_10295902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae505Open in IMG/M
3300000789|JGI1027J11758_12736190All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300001545|JGI12630J15595_10052096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter817Open in IMG/M
3300001593|JGI12635J15846_10150295All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300001593|JGI12635J15846_10462093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae755Open in IMG/M
3300001661|JGI12053J15887_10093079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1641Open in IMG/M
3300001867|JGI12627J18819_10468840All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae516Open in IMG/M
3300003505|JGIcombinedJ51221_10244321All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae729Open in IMG/M
3300004080|Ga0062385_10199485All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1079Open in IMG/M
3300004092|Ga0062389_101554054All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter844Open in IMG/M
3300004101|Ga0058896_1402558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1110Open in IMG/M
3300005332|Ga0066388_100606858All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1716Open in IMG/M
3300005436|Ga0070713_101066757All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300005445|Ga0070708_100581188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1056Open in IMG/M
3300005446|Ga0066686_10147519All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1553Open in IMG/M
3300005454|Ga0066687_10492468All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter724Open in IMG/M
3300005471|Ga0070698_102007097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae532Open in IMG/M
3300005542|Ga0070732_10370684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae862Open in IMG/M
3300005554|Ga0066661_10722612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter584Open in IMG/M
3300005587|Ga0066654_10770034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae544Open in IMG/M
3300005602|Ga0070762_10251221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1100Open in IMG/M
3300005718|Ga0068866_11178876All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae552Open in IMG/M
3300005842|Ga0068858_100106617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2615Open in IMG/M
3300005921|Ga0070766_11237440All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae517Open in IMG/M
3300006059|Ga0075017_101490337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae533Open in IMG/M
3300006102|Ga0075015_100471625All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300006162|Ga0075030_101439583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300006173|Ga0070716_101028413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae653Open in IMG/M
3300006176|Ga0070765_101242603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae703Open in IMG/M
3300006354|Ga0075021_10814212All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300006800|Ga0066660_10624707All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300006893|Ga0073928_10738534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae684Open in IMG/M
3300007258|Ga0099793_10011784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3410Open in IMG/M
3300007982|Ga0102924_1245486All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300009137|Ga0066709_104270985All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300009143|Ga0099792_10783772All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300009156|Ga0111538_11109110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1000Open in IMG/M
3300009168|Ga0105104_10215827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1044Open in IMG/M
3300009628|Ga0116125_1063045All Organisms → cellular organisms → Bacteria → Acidobacteria956Open in IMG/M
3300009645|Ga0116106_1034927All Organisms → cellular organisms → Bacteria → Acidobacteria1715Open in IMG/M
3300009683|Ga0116224_10511589All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300009764|Ga0116134_1104277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1025Open in IMG/M
3300009824|Ga0116219_10265825All Organisms → cellular organisms → Bacteria → Acidobacteria971Open in IMG/M
3300010336|Ga0134071_10389582All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300010343|Ga0074044_11090129All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300010366|Ga0126379_10161839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2102Open in IMG/M
3300010366|Ga0126379_13569986All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300010376|Ga0126381_101850635All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300010376|Ga0126381_104078465All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300010379|Ga0136449_100428973All Organisms → cellular organisms → Bacteria → Acidobacteria2330Open in IMG/M
3300010379|Ga0136449_101600344All Organisms → cellular organisms → Bacteria → Acidobacteria989Open in IMG/M
3300010398|Ga0126383_12733557All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300011269|Ga0137392_10913682All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300012189|Ga0137388_10945698All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300012200|Ga0137382_10547133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae824Open in IMG/M
3300012203|Ga0137399_10727231All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae836Open in IMG/M
3300012205|Ga0137362_11557930All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300012582|Ga0137358_10301928All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1087Open in IMG/M
3300012923|Ga0137359_11119751All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300012924|Ga0137413_11683516All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300012929|Ga0137404_10792101All Organisms → cellular organisms → Bacteria → Acidobacteria861Open in IMG/M
3300012986|Ga0164304_10787936All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300012989|Ga0164305_10074115All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2092Open in IMG/M
3300013308|Ga0157375_10536210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1333Open in IMG/M
3300014159|Ga0181530_10265032All Organisms → cellular organisms → Bacteria → Acidobacteria914Open in IMG/M
3300014162|Ga0181538_10277119All Organisms → cellular organisms → Bacteria → Acidobacteria917Open in IMG/M
3300014489|Ga0182018_10512227All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300014498|Ga0182019_10570392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis791Open in IMG/M
3300014657|Ga0181522_10751552All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300014968|Ga0157379_10390951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1277Open in IMG/M
3300015054|Ga0137420_1232300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis985Open in IMG/M
3300016341|Ga0182035_11634454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300016404|Ga0182037_11659984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae569Open in IMG/M
3300016445|Ga0182038_10466271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1072Open in IMG/M
3300016702|Ga0181511_1133006All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300017792|Ga0163161_11717188All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300017822|Ga0187802_10100195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1089Open in IMG/M
3300017937|Ga0187809_10178191All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300017941|Ga0187850_10015686All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4560Open in IMG/M
3300017946|Ga0187879_10671508All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300017966|Ga0187776_10145339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1453Open in IMG/M
3300017972|Ga0187781_10113035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1890Open in IMG/M
3300017975|Ga0187782_11636858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300017995|Ga0187816_10106414All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1206Open in IMG/M
3300017995|Ga0187816_10215431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae836Open in IMG/M
3300018003|Ga0187876_1274975All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300018006|Ga0187804_10319421All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300018013|Ga0187873_1244699All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300018032|Ga0187788_10470656Not Available539Open in IMG/M
3300018085|Ga0187772_11209721All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300018086|Ga0187769_10007428All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6828Open in IMG/M
3300018088|Ga0187771_10519952All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1008Open in IMG/M
3300018090|Ga0187770_11477200All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300020004|Ga0193755_1192365All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300020015|Ga0193734_1011979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1631Open in IMG/M
3300020579|Ga0210407_10331444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1190Open in IMG/M
3300020579|Ga0210407_11150638All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300020581|Ga0210399_10132848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2049Open in IMG/M
3300020582|Ga0210395_10986394All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300020582|Ga0210395_11128501All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300020583|Ga0210401_10194581All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1885Open in IMG/M
3300021080|Ga0210382_10559263All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300021170|Ga0210400_11399248All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300021171|Ga0210405_10275013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1332Open in IMG/M
3300021178|Ga0210408_10579274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae890Open in IMG/M
3300021178|Ga0210408_11042428All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300021181|Ga0210388_10467007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1108Open in IMG/M
3300021403|Ga0210397_10016983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4428Open in IMG/M
3300021403|Ga0210397_10817849All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300021403|Ga0210397_10825903All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300021403|Ga0210397_11365738All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300021405|Ga0210387_10114877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2267Open in IMG/M
3300021405|Ga0210387_10346912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1311Open in IMG/M
3300021405|Ga0210387_10595770All Organisms → cellular organisms → Bacteria → Acidobacteria982Open in IMG/M
3300021405|Ga0210387_11535995All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300021406|Ga0210386_10411419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1166Open in IMG/M
3300021420|Ga0210394_10128594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum2195Open in IMG/M
3300021432|Ga0210384_10112310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2442Open in IMG/M
3300021433|Ga0210391_11301745All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300021474|Ga0210390_10003855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae12791Open in IMG/M
3300021474|Ga0210390_10992112All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300021474|Ga0210390_11439534All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300021477|Ga0210398_10462396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1034Open in IMG/M
3300021479|Ga0210410_10184188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1868Open in IMG/M
3300021861|Ga0213853_10034927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae866Open in IMG/M
3300022527|Ga0242664_1152583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300022531|Ga0242660_1060921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae848Open in IMG/M
3300022532|Ga0242655_10030362All Organisms → cellular organisms → Bacteria → Acidobacteria1228Open in IMG/M
3300022724|Ga0242665_10096192All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae872Open in IMG/M
3300022724|Ga0242665_10255967All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300022726|Ga0242654_10098535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae915Open in IMG/M
3300025412|Ga0208194_1075944All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300025453|Ga0208455_1024990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1406Open in IMG/M
3300025454|Ga0208039_1011898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium2077Open in IMG/M
3300025576|Ga0208820_1083007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae815Open in IMG/M
3300025627|Ga0208220_1021969All Organisms → cellular organisms → Bacteria → Acidobacteria2036Open in IMG/M
3300025921|Ga0207652_11608318All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300025929|Ga0207664_11763883All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300026322|Ga0209687_1101419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae934Open in IMG/M
3300026480|Ga0257177_1003224All Organisms → cellular organisms → Bacteria1838Open in IMG/M
3300026482|Ga0257172_1049659All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300026551|Ga0209648_10230292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1389Open in IMG/M
3300026551|Ga0209648_10629851All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300027063|Ga0207762_1005456All Organisms → cellular organisms → Bacteria → Acidobacteria2558Open in IMG/M
3300027565|Ga0209219_1040505All Organisms → cellular organisms → Bacteria → Acidobacteria1161Open in IMG/M
3300027625|Ga0208044_1076125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1014Open in IMG/M
3300027641|Ga0208827_1037421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1694Open in IMG/M
3300027695|Ga0209966_1071660All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300027696|Ga0208696_1219257All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300027738|Ga0208989_10148935All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300027829|Ga0209773_10020639All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum2582Open in IMG/M
3300027854|Ga0209517_10239875All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1092Open in IMG/M
3300027854|Ga0209517_10719652All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300027884|Ga0209275_10728313All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300027895|Ga0209624_10016573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4686Open in IMG/M
3300027911|Ga0209698_10549973All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae891Open in IMG/M
3300028047|Ga0209526_10854605All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300028047|Ga0209526_10970330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300028776|Ga0302303_10016407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3304Open in IMG/M
3300028780|Ga0302225_10323078All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300028792|Ga0307504_10481504All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300029636|Ga0222749_10591159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300029903|Ga0247271_108955All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1535Open in IMG/M
3300029917|Ga0311326_10518552All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300029943|Ga0311340_11036437All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300029943|Ga0311340_11256331All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300029944|Ga0311352_10966630All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300029955|Ga0311342_10030114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6730Open in IMG/M
3300029985|Ga0302280_1095158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1151Open in IMG/M
3300030004|Ga0302186_10203811All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300030053|Ga0302177_10600364All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300030339|Ga0311360_10744336All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae780Open in IMG/M
3300030494|Ga0310037_10103881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1316Open in IMG/M
3300030494|Ga0310037_10442189All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300030618|Ga0311354_10463092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1263Open in IMG/M
3300030730|Ga0307482_1015698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1490Open in IMG/M
3300031090|Ga0265760_10107220All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300031231|Ga0170824_102435280All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300031231|Ga0170824_106403586All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300031241|Ga0265325_10471084All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300031525|Ga0302326_10648815All Organisms → cellular organisms → Bacteria → Acidobacteria1556Open in IMG/M
3300031715|Ga0307476_10521075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae881Open in IMG/M
3300031715|Ga0307476_11406512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300031720|Ga0307469_10981984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium787Open in IMG/M
3300031753|Ga0307477_10593187All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300031754|Ga0307475_10430527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1060Open in IMG/M
3300031754|Ga0307475_11296947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300031797|Ga0318550_10426286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300031823|Ga0307478_10209186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1572Open in IMG/M
3300031902|Ga0302322_101472269All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae831Open in IMG/M
3300031962|Ga0307479_11898943All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300032174|Ga0307470_11558074All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300032180|Ga0307471_100058105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3244Open in IMG/M
3300032180|Ga0307471_100417986All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1473Open in IMG/M
3300032205|Ga0307472_102355719All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300032783|Ga0335079_10744010All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300032805|Ga0335078_10691577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1265Open in IMG/M
3300032828|Ga0335080_11051540All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300032892|Ga0335081_10782826All Organisms → cellular organisms → Bacteria → Acidobacteria1143Open in IMG/M
3300033475|Ga0310811_11305180All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300033561|Ga0371490_1091739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae817Open in IMG/M
3300033887|Ga0334790_055223All Organisms → cellular organisms → Bacteria1457Open in IMG/M
3300033891|Ga0334811_067390All Organisms → cellular organisms → Bacteria → Acidobacteria942Open in IMG/M
3300033982|Ga0371487_0018606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4892Open in IMG/M
3300034163|Ga0370515_0461349All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.27%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.25%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.85%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.37%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.40%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.40%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.40%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.40%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.92%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.44%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.44%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.96%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.96%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.48%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.48%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.48%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.48%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.48%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.48%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.48%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.48%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.48%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.48%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.48%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004101Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022527Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029903Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703EnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029985Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1EnvironmentalOpen in IMG/M
3300030004Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10079565113300000364SoilMKHVYTWGAITAIVLASVAGDILLARAMKQIGDVGPLWRKSGL
JGI12270J11330_1029590223300000567Peatlands SoilMKDIYAWAAIGLIVLTSTTGDVLLSHSMKRVGDVGEL
JGI1027J11758_1273619033300000789SoilMTHVYTWGAITAIVLASVAGDILLARAMKQIGDVGPLWRKSGL
JGI12630J15595_1005209613300001545Forest SoilMKHLYANLYTWSAILAVVFASVVGDVLLSRAMKQVGDVGALRRRQGLW
JGI12635J15846_1015029513300001593Forest SoilMKNAYTWGGILVVVFASVVGDVLLARAMKQVGDVHDLWRRAGLWA
JGI12635J15846_1046209313300001593Forest SoilVKDLYAWSAIGLIVLASTTGDVLLSYSMKRVGDVG
JGI12053J15887_1009307913300001661Forest SoilMKHLYANLYIWSAILAVVFASVVGDVLLSRAMKQVGDVGALRRRRGLWT
JGI12627J18819_1046884023300001867Forest SoilVKHAYTWAAILLMVTASVTGDVLLSKAMKQVGDVGDLWKSHGIFRVI
JGIcombinedJ51221_1024432123300003505Forest SoilMKQAYAWSAIAAIVLASTTGDVLLSRAMKQVGDVGELWQRS
Ga0062385_1019948533300004080Bog Forest SoilMRSLYTWCGILVIVLASVVGDVLLARAMKQVGDVHDVWER
Ga0062389_10155405433300004092Bog Forest SoilMKSLYAWSAIAVIVLTSTAGDVLLSRGMKQVGDVGELRRRIGLLAV
Ga0058896_140255813300004101Forest SoilMKHAYTWAAIAFIVTASVTGDVLLSRAMKQTGDVGELRRRSSLLAVV
Ga0066388_10060685813300005332Tropical Forest SoilMKEIYTWGAIFAIVIASTTGDVLLSRAMKRVGDVGELRRREGLLAVA
Ga0070713_10106675713300005436Corn, Switchgrass And Miscanthus RhizosphereMKHLYIWSAIFAIACGSVIGDVLLSRAMKQVGDVGVLLRR
Ga0070708_10058118833300005445Corn, Switchgrass And Miscanthus RhizosphereMKDLYAWAAIGLIVLASTTGDVLLSYSMKRVGDVGELWKRRG
Ga0066686_1014751913300005446SoilVKHLYTWSAIAAIVVASVSGDVFLSRAMKQVGDVGALRRRLGSL
Ga0066687_1049246813300005454SoilMKHAYTWAAIVFIVTASVAGDVLLSRAMKQVGDVGELRRRSGIS
Ga0070698_10200709723300005471Corn, Switchgrass And Miscanthus RhizosphereVKDLYAWSAIGLIVLASTSGDVLLSYSMKRVGDVGELWKRRG
Ga0070732_1037068433300005542Surface SoilMKHAYTWAAIAFIVTASVTGDVLLSRAMKQTGDVGELRRRSSLLAVVA
Ga0066661_1072261223300005554SoilMRDIYAWSAIGLIILASTTGDVLLSYSMKRVGDVGEL
Ga0066654_1077003423300005587SoilMKHLYTWSAIVAVSLASVVGDVLLARAMKQVGDMHEIWTRFGPWTVVG
Ga0070762_1025122133300005602SoilMKQAYTWSAIAAIVLASTTGDVLLSRAMKQVGDVG
Ga0068866_1117887623300005718Miscanthus RhizosphereMKHAYTLGAIMAVVLASTTGDVLLSRAMKKVGDVGQVW
Ga0068858_10010661743300005842Switchgrass RhizosphereMKHAYTWGAIMVVVLASTTGDVLLSRAMKKVGDVGNLWRRSGL
Ga0070766_1123744023300005921SoilMKGIYTWSAILAIVFASVVGDVLLARAMKQVGDVGALWRRAGLGTV
Ga0070717_1109196933300006028Corn, Switchgrass And Miscanthus RhizosphereMKHLYANLYTWSAILAVVFASVVGDVLLSRAMKQVGDVGALRRRR
Ga0075017_10149033723300006059WatershedsMKHAYTWGAILAVVLASTTGDVLLSRAMKRVGDVG
Ga0075015_10047162513300006102WatershedsVSDLYAWAAIALITLSATTGDVLLAYSMKRVGHVGELWKNHG
Ga0075030_10143958323300006162WatershedsMSQFYAWSAVAAIVLASTTGDVLLSRAMKEVGDVGQLWRCHGLFTILK
Ga0070716_10102841323300006173Corn, Switchgrass And Miscanthus RhizosphereMKQLYTWGAVAAIVLASTIGDVLLSRAMKQVGDVGELWRSHGLLAVVG
Ga0070765_10124260313300006176SoilMKHAHAWAAIAAIVLASTTGDVLLSRAMKQVGDVGELRRRGGALTVV
Ga0075021_1081421213300006354WatershedsMKQAYAWSAIAAIVLASTTGDVLLSRAMKQVGDVGALWRRSGLWTVMG
Ga0066660_1062470713300006800SoilVRDLYAWLSIAAIVLASTTGDVLLSRAMKRIGDLGQLRRREGL
Ga0073928_1073853423300006893Iron-Sulfur Acid SpringMKNAYTWGGIGVVVFASVVGDVLLARAIKQVGDVHELWRRAGLWP
Ga0099793_1001178443300007258Vadose Zone SoilVRQAYTWAAIAVIVSASVTGDVLLARAMKQVGDVGE
Ga0102924_124548613300007982Iron-Sulfur Acid SpringMKQTYAWGAIAAIVLSSTTGDVLLSRAMKQVGDVGA
Ga0066709_10427098513300009137Grasslands SoilMKDLYTWLAITAIVLTSTIGDVLLSRAMKQIGDLGEL
Ga0099792_1078377223300009143Vadose Zone SoilMKQLYTWGAVAAIVLASTIGDVLLSRAMKQVGDVGELWRSH
Ga0111538_1110911013300009156Populus RhizosphereMKHAYTWAAIGAIVVASTTGDVLLSRAMKQVGDVGDLWRRRGM
Ga0105104_1021582733300009168Freshwater SedimentMKHAYTWAAIGAIVVASTTGDVLLSRAMKQVGDVGD
Ga0116125_106304533300009628PeatlandMSDLYAWAAIGLVSLASTTGDVLLSYSMKRVGDVGDLWQR
Ga0116106_103492713300009645PeatlandMKDIYAWAAIGLVVLASTTGDVLLSYSMKRVGDVGELWKRRGVLA
Ga0116224_1051158923300009683Peatlands SoilMNEIYAWAAIGLIILASTTGDVLLSYTMKRVGDV*
Ga0116134_110427713300009764PeatlandMKDLYAWAAIGLIILASTTGDVLLSYSMKRVGHVGELWQRRGLLAV
Ga0116219_1026582513300009824Peatlands SoilMNEIYAWAAIALIILASTTGDVLLSYSMKQVGHVG
Ga0134071_1038958213300010336Grasslands SoilVKHLYTWSAIAAIVVASVSGDVFLSRAMKQVGDVGALRRRLGSLA
Ga0074044_1109012913300010343Bog Forest SoilMNEIYAWAAIGLIILASTTGDVLLSYSMKRVGDVGELWKRR
Ga0126379_1016183913300010366Tropical Forest SoilMRLIYAWGAIAAIVLASTTGDVLLSLAMKQVGDVGDLWRDHGL
Ga0126379_1356998613300010366Tropical Forest SoilVKHAYTWAAILLMVTASVTGDVLLSKAMKQVGDVGDLWKNHGVFR
Ga0126381_10185063533300010376Tropical Forest SoilVKHAYTWAAILLMVTASVTGDVLLSKAMKQVGDVGD
Ga0126381_10407846523300010376Tropical Forest SoilVKHAYTWAAILLMVTASVTGDVLLSKAMKQVGDVGDLWR
Ga0136449_10042897343300010379Peatlands SoilMKDIYAWAAIGLVVLTSTTGDVLLSYSMKRVGDVGELWKRRGV
Ga0136449_10160034413300010379Peatlands SoilVNDLYAWAAIALITLAATTGDVLLAYSMKRVGDVGEIWK
Ga0126383_1273355713300010398Tropical Forest SoilMKHAYTWGAILIIVVASVTGDVLLSHAMKTVGDVG
Ga0137392_1091368213300011269Vadose Zone SoilVREIYAWSAIGLIVLASTTGDVLLSYSMKRVGDVGELWKRRGVLAVV
Ga0137388_1094569833300012189Vadose Zone SoilMKDIYAWAAIGLIVLASTTGDVLLSYSMKRVGDVGELW
Ga0137382_1054713313300012200Vadose Zone SoilMYTWGAIVAVAFASVVGDILLARAMKQVGDVHELWRRAGLWTVVG
Ga0137399_1072723133300012203Vadose Zone SoilVKEAYTWAAIGLIVIASATGDVLLSYAMKRDGDVGELWRR
Ga0137362_1155793023300012205Vadose Zone SoilMKEIYAWSAIGIIVLASTTGDILLSYSMKRVGDVGELW
Ga0137358_1030192813300012582Vadose Zone SoilVRQAYTWAAIAVIVSASVTGDVLLARAMKQVGDVGELWRHRGVLA
Ga0137359_1111975113300012923Vadose Zone SoilMKHAYTWGAILAVVLASTIGDVLLSRAMKRVGDVGELWRRSGLLTVA
Ga0137413_1168351613300012924Vadose Zone SoilLKEAYTWAAIGLIVIASTTGDVLLSYAMKKVGDVGELWRRHGLVK
Ga0137404_1079210113300012929Vadose Zone SoilMKHAYTWGAILAVVLASTTGDVLLSRAMKRVGDVGELWRR
Ga0164304_1078793613300012986SoilMKHAYTWGAIMAVVLASTTGDVLLSRAMKKVGDVGQVWRNSG
Ga0164305_1007411513300012989SoilMRHAYTWGAILVIVIASVTGDVLLSRAMKQVGDVDE
Ga0157375_1053621033300013308Miscanthus RhizosphereMKHAYTWGAIMAVVLASTTGDVLLSRAMKKVGDVGQVWR
Ga0181530_1026503213300014159BogMSELYAWAAIALIILASTTGDVLLSYSMKRVGDVGELWKRR
Ga0181538_1027711923300014162BogMSELYAWAAIGLIILASTTGDVLLSYSMKRVGDVGELW
Ga0182018_1051222713300014489PalsaVRSLYAWSAIAAIVLTSAIGDLLLARAMKQVGDVGALWR
Ga0182019_1057039233300014498FenMTNHAYTWGAIAAIVVASTTGDVLLSRAMKQVGDVGQLWRELGLPA
Ga0181522_1075155223300014657BogMKGVYTWGAILVIVFASVVGDVLLARAMKQVGDVGE
Ga0157379_1039095113300014968Switchgrass RhizosphereMKHVYTWGAITAIVLASVAGDILLARAMKQIGDVGALWRKSGLF
Ga0137420_123230033300015054Vadose Zone SoilVKHAYTWGAIAVIVTTSVTGDVLLSRAMKQVGDVGELWRHRGVLTVIG
Ga0182035_1163445423300016341SoilMKPVYTWAAIVAIVTASVTGDVLLSRAMKQVGDVGEQWRR
Ga0182037_1165998423300016404SoilVNELYAWGAIALITLAATAGDVLLAYSMKRVGDVGELLKQQGLFVVA
Ga0182038_1046627113300016445SoilMKPVYTWAAIVAIVTASVTGDVLLSRAMKQVGDVGEQWRRKGVLGVVA
Ga0181511_113300623300016702PeatlandMKEIHAWAAIGIIGLAATTGDVLLSYSMKRVGDVG
Ga0163161_1171718823300017792Switchgrass RhizosphereLSHHAYTWGGITAIVLASTTGDVLLSRAMKQVGDVGQVWRQHGLL
Ga0187802_1010019533300017822Freshwater SedimentEESAMKQAYAWSAIAAIVLASTTGDVLLSRAMKQVGDVGALWRQSGL
Ga0187809_1017819123300017937Freshwater SedimentMKPLFTWSAIFAIAIASVVGDVLLSRAMKQVGDVHHLWNRSGLWT
Ga0187850_1001568653300017941PeatlandMNELNAWAAIGFIILASTTGDVLLSYSMKQVGDVGELWRR
Ga0187879_1067150823300017946PeatlandMKDVYTWGGILAITLASVVGDVLLAHAMKQVGDVGDLWRK
Ga0187776_1014533933300017966Tropical PeatlandVKHAYTWGAIVIIVLVSTAGDVLLARAMKTVGDVGM
Ga0187781_1011303513300017972Tropical PeatlandMTQLYAWGAVATIVSTSTCGDVLLSRAMKQVGDVGELRRR
Ga0187782_1163685813300017975Tropical PeatlandVTQLYAWGAVATIVSTSTCGDVLLSRAMKQVGDVGELHRRSGWAMV
Ga0187816_1010641413300017995Freshwater SedimentVNDLYAWASIALITLAATTGDVLLAYSMKRVGHVG
Ga0187816_1021543113300017995Freshwater SedimentVKDAQAWLAIGLITLAATTGDVLQAHSMKRVGDVHE
Ga0187876_127497523300018003PeatlandMSELYAWAAIGLIILASTTGDVLLSYSMKRVGDVGELWKR
Ga0187804_1031942113300018006Freshwater SedimentMNELYAWAAIALIILASTTGDVLLSYSMKRVGNVGE
Ga0187873_124469933300018013PeatlandMNELYAWAAIGIIILASTTGDVLLSYSMKRVGDVEELWK
Ga0187788_1047065623300018032Tropical PeatlandMTQLYAWGAVATIVSTSTCGDVLLSRAMKQVGDVGELQR
Ga0187772_1120972113300018085Tropical PeatlandMKHVYTWSAILVVTLASVTGDVLIARAMKQVGDVHALWRK
Ga0187769_1000742813300018086Tropical PeatlandMKHLYAWGAVACIVLTSTAGDVLLSRAMKQVGDVAELRRRSGLSHV
Ga0187771_1051995213300018088Tropical PeatlandMSEVYAWAAIALITLAATAGNVLLAHAMKRVGDVGELWKSRG
Ga0187770_1147720023300018090Tropical PeatlandMRETYAWAAIAVITLAATTGNVLLAHAMKRVGDVGKLWKRH
Ga0193755_119236523300020004SoilMKHAYTWGAILAIVLASTTGDVLLSRAMKRVGDVGEL
Ga0193734_101197933300020015SoilMKNAHTWGAILAVVLASTTGDVLLSRAMKRVGDVGE
Ga0210407_1033144413300020579SoilMKQAYAWGAIAAIVLASTTGDVLLSRAMKQVGDVGTLWRRSGLWTVL
Ga0210407_1115063823300020579SoilMRHAYTWGAILVIVVASVAGDVLLSRAMKQVGNVDELRKRSGLFAVI
Ga0210399_1013284833300020581SoilMKQAYTWSAIAVIVLASTTGDVLLSRAMKQVGDVGALWRRSGLWTL
Ga0210395_1098639423300020582SoilMKQIYAWSAVVAIVLASTTGDVLLSRAMKQVGDVGE
Ga0210395_1112850113300020582SoilMKQAYAWSAIAAIVLASTTGDVLLSRAMKQVGDVGELWRQSGLW
Ga0210401_1019458133300020583SoilMKQAYAWSAIVAIVLASTTGDVLLSRAMKQVGDVGALWRQSGLWT
Ga0210382_1055926323300021080Groundwater SedimentMSHHAYTWGAIAAIVLASTTGDVLLSRAMKQVGHVGQV
Ga0210400_1139924813300021170SoilVKTLYTWSAILAVVIASVVGDVLLAHAMKRVGDVADLWKNKGLLAV
Ga0210405_1027501313300021171SoilMKQAYAWGAIAAIVLSSTTGDVLLSRAMKQVGDVGELR
Ga0210408_1057927413300021178SoilMKDLYAWSAIGLIVLASTTGDVLLSYSMKRVGDVGELWKRRGALAVI
Ga0210408_1104242823300021178SoilMKQAYTWSAIAVIVLASTTGDVLLSRAMKQVGDVGALW
Ga0210388_1046700733300021181SoilMKGIYTWSAILAIVFASVIGDVLLARAMKQVGDVGALWRRA
Ga0210397_1001698353300021403SoilMKHAYTWAAIAFIVTASVTGDVLLSRAMKQTGDVGE
Ga0210397_1081784923300021403SoilMKGVYTWGAILVIVFASVVGDVLLARAMKQVGDVGALRRR
Ga0210397_1082590313300021403SoilMKQAYAWSAIAAIVLASTTGDVLLSRAMKQVGDVGELWRQSGLWTVIG
Ga0210397_1136573823300021403SoilMKQAYTWSAIAVIVLASTTGDVLLSRAMKQVGAVGAV
Ga0210387_1011487733300021405SoilMNQVHTWLGILVVAFASVVGDVLLARAMREVGDVHDLWRR
Ga0210387_1034691233300021405SoilVKHLYTWSAIFVIAFGSVVGDVLLSRAMKQVGDVGVVLRRS
Ga0210387_1059577023300021405SoilMKQAYAWSAIAAIVLASTTGDVLLSRAMKQVGDVGELWRQSGL
Ga0210387_1153599523300021405SoilMKDLYAWAAIGAVILASTTGDVLLSYSMKRVGDVG
Ga0210386_1041141933300021406SoilVKHAYTWAAILVMVTASVTGDVLLSKAMKQVGDVGDLWKNHGMFRV
Ga0210394_1012859413300021420SoilMKQAYTWSAIAAIVLASTTGDVLLSRAMKQVGDVGELWR
Ga0210384_1011231033300021432SoilMKHAYTWGAILAIVLASTTGDVLLSRAMKRVGDVGELWRRAG
Ga0210391_1130174513300021433SoilMKQIYAWSAVVAIVLASTTGDVLLSRAMKQVGDVG
Ga0210390_10003855143300021474SoilMKQAYAWSAITAIVLTSTIGDVLLSRAMKQVGDVGELWRRSGLWAV
Ga0210390_1099211233300021474SoilMNHLYTWGGILVIVITSVTGDVLLSHAMKSVGDVGER
Ga0210390_1143953423300021474SoilVKHAYTWAAILVMVTASVTGDVLLSKAMKQVGDVGDLW
Ga0210398_1046239613300021477SoilMKSLYTWSAILAIVFASVVGDVLLARAMKQVGDVGALWRRSGLGTV
Ga0210410_1018418813300021479SoilMKALYTWGAILAIVFASVVGDVLLARAMRQVGDVGALRRRSGLGIVIG
Ga0213851_147094313300021860WatershedsVNHIPVVSTWGGILVVVLASVVGDILLARAMKQVGD
Ga0213853_1003492713300021861WatershedsMRDVYAWLAIGLITIAATGGDILLSYSMKRVGDVHEL
Ga0242664_115258313300022527SoilMNQVHTWLGILAVAFASVVGDVLLARAMREVGDVHDL
Ga0242660_106092133300022531SoilVRHAYTWAAIAVIVSASVTGDVLLARAMKQVGDVGELWR
Ga0242655_1003036213300022532SoilMRHAYTWAAIAVIVLASVTGDVLLSRAMKQVGDVGELRKRSSIMS
Ga0242665_1009619213300022724SoilMKSAYTWGGILIIVLASVVGDILLARAMKQVGDVHAFLRRA
Ga0242665_1025596723300022724SoilMKQAYAWSAIAAIVLASTTGDVLLSSAMKQVGDVGALFRQSGLW
Ga0242654_1009853533300022726SoilVKHAYTWAAILVMVTASVTGDVLLSKAMKQVGDVGDLWKNHGMFRA
Ga0208194_107594423300025412PeatlandMKTLYTWGSILAIVFASVIGDVLLARAMKQVGDVGALWRRSGLG
Ga0208455_102499013300025453PeatlandMNEIYAWAAIGLIILASTTGDVLLSYSMKRVGDVEELWKR
Ga0208039_101189813300025454PeatlandMKDIYAWAAIGLVVLASTTGDVLLSYSMKRVGDVGELWKRR
Ga0208820_108300713300025576PeatlandMNELYAWAAIGIIILASTTGDVLLSYSMKRVGNVGELWKRRGVL
Ga0208220_102196913300025627Arctic Peat SoilMTRQIIYTWSSVAAIVITSCAGDVLLSRAMKQVGDV
Ga0207652_1160831813300025921Corn RhizosphereMKHAYTWGAIMVVVLASTTGDVLLSRAMKKVGDVGNLWRRSGLTTVVW
Ga0207664_1176388323300025929Agricultural SoilMKHAYTWTAIAFIVSASVAGDVLLSRAMKQVGDVGE
Ga0209687_110141933300026322SoilMKQLYTWGAVAAIVLASTIGDVLLSRAMKQVGDVGEL
Ga0257177_100322413300026480SoilMKDIYAWAAIGLIVLASTTGDVLLSYSMKRVGDVGELWKQRGAL
Ga0257172_104965933300026482SoilMKHLYANLYTWSAILAVVLASVIGDVLLSRAMKHVGDVGALRRRRGL
Ga0209648_1023029213300026551Grasslands SoilMKDLYAWSAIGLIVLASTTGDVLLSYSMKRVGDVGELWKRRGAL
Ga0209648_1062985113300026551Grasslands SoilMKDLYAWAAIGLIILASTTGNVLLSYSMKRVGDVGELWKRCGVLA
Ga0207762_100545643300027063Tropical Forest SoilMRHLYTWCAIVAVALASVVGDVLLARAMKQVGDVHALLRRSGVWTV
Ga0209219_104050513300027565Forest SoilMKNLYTWGGILVVVFASVVGDVLLARAMKQVGDVHDLWQRAGLWAVV
Ga0208044_107612513300027625Peatlands SoilMKDIYAWAAIGLIVLTSTTGDVLLAHSMKRVGDVGEL
Ga0208827_103742113300027641Peatlands SoilMKEVCTWSGILVIVLASVIGDVLLARAMKQVGDVHDL
Ga0209966_107166013300027695Arabidopsis Thaliana RhizosphereMSVTTTWSAIGVIVVASTAGDVLTAKAMKQVGDLGEL
Ga0208696_121925723300027696Peatlands SoilMKQAYTWSAIAVIVLASTTGDVLLSRAMKQVGDVGALWRKSGPWTV
Ga0208989_1014893533300027738Forest SoilMRHAYADLYTWGAIAAVVFTSVVGDVMLSRAMKQVGDVDALRRRRGLWTVI
Ga0209773_1002063933300027829Bog Forest SoilMKQAYAWSAIAAIVLASTTGDVLLSRAMKQVGDVGELWRQS
Ga0209517_1023987513300027854Peatlands SoilMKQAYTWSAIAVIVLASTTGDVLLSLAMKQVGDVGALWRR
Ga0209517_1071965223300027854Peatlands SoilMKHIYIWGGILVITLGSVVGDVLLARAMKQVGDVHALLRRAGFWTVVT
Ga0209275_1072831323300027884SoilMNQVHTWLGILVVAFASVVGDVLLARAMREVGDVHDLWRRHGL
Ga0209624_1001657353300027895Forest SoilMKGVYTWGAILVIVFASVVGDVLLARAMKQVGDVGAL
Ga0209698_1054997333300027911WatershedsMSEIYAWAAIALIILASTTGDVLLSYSMKCVGDVADLWKRRGTLAVV
Ga0209526_1085460523300028047Forest SoilMKHAHAWAAIAAIVLASTTGDVLLSRAMKQVGDVG
Ga0209526_1097033023300028047Forest SoilMKSVYTWGAILVIVIASVIGDVLLARAMKQVGDVGELRR
Ga0302303_1001640753300028776PalsaMKTMYTWSAILAIVFASVVGDVLLARAMKQVGDVGALWRRTGL
Ga0302225_1032307823300028780PalsaMKDINAWAAIGVIVLASTTGDVLLSYSMKQVGDVGELWKRRGILAVVA
Ga0307504_1048150423300028792SoilMKLIYAWSAIAVIVLASTTGDVLLSRAMKQVGHVGELWRRAGLLAV
Ga0222749_1059115923300029636SoilVKHLYTWSAIFLIAFGSVIGDVLLSRAMKQVGDVGVLLRRSGA
Ga0247271_10895533300029903SoilMRDLYAWAAIGLIILASTTGDVLLSHAMKRVGDVGE
Ga0311326_1051855213300029917BogVKTLYTWCAILVIVFASVVGDVLLAHAMRQVGDVGALWR
Ga0311340_1103643723300029943PalsaVKHLYTWSAILVIALASVVGDVLISRAMKQVGDVDLLRRR
Ga0311340_1125633123300029943PalsaVKNAYIWGGILAVTLTSVVGDVLLARAMKQVGDVHALWRRCGFWM
Ga0311352_1096663033300029944PalsaVKELYAWAAITLIVVASTTGDVLLSYSMKRVGDVGELWKRR
Ga0311342_1003011473300029955BogMNDFYAWVAIGLIILASTAGDVLLSYSMKRVGDVG
Ga0302280_109515813300029985FenMNDFYAWAAIGLIILASTTGDVLLSHSMKKVGDVGELW
Ga0302186_1020381113300030004BogMNDFYAWAAIGLIILASTTGDVLLSHSMKKVGDVGEL
Ga0302177_1060036413300030053PalsaMKNIYTWSAILAIVFASVVGDVLLARAMKQVGDVGDLRRRAGLG
Ga0311360_1074433633300030339BogLNASYTWAAIAMIVIAATAGDVLVARAMKQVGDVGELWKRHGVLKVIG
Ga0310037_1010388113300030494Peatlands SoilMKDIYAWAAIGLIVLTSTTGDVLLSHSMKRVGDVGELWKRRGVLA
Ga0310037_1044218923300030494Peatlands SoilMKQAYTWSAIVVIVLASTTGDVLLSRAMKQVGDVGA
Ga0311354_1046309213300030618PalsaVKDLYAWAAIGLIVLASTTGDVLLSYSMKRVGDVSELWKRRGILAMI
Ga0307482_101569833300030730Hardwood Forest SoilVRHAYTWAAILLMVTASVTGDVLLSKAMKQVGDVGDLWENQ
Ga0265760_1010722033300031090SoilMKSACTWGGILVVVFASVVGDVLLARAMKQVGDVHEFWRR
Ga0170824_10243528013300031231Forest SoilVKDLYAWSAIGLIVLASTTGDVLLSYSMKRVGHVGELWKRRG
Ga0170824_10640358613300031231Forest SoilMKHVYTWGAILAVVLASATGDVLLSRAMKSVGDVGELW
Ga0265325_1047108413300031241RhizosphereVKHLYTWGAILAIVLGSVIGDVLLARAMKQVGDVGVLLRQ
Ga0302326_1064881513300031525PalsaMKAGYTWSAILAIVFASVVGDVLLARAMAQGGDVGAL
Ga0307476_1052107533300031715Hardwood Forest SoilVKPYADLYTWTSILAVVVASVVGDVLLSRAMKQVGDVHHLWEHSGL
Ga0307476_1140651213300031715Hardwood Forest SoilMKHLYTWGAILAIVLASVIGDILLAHAMKQVGDIHALW
Ga0307469_1098198413300031720Hardwood Forest SoilMKHAYTWAAIAFIVTASVTGDVLLSRAMKQTGDVGDLRRRSGLLT
Ga0307477_1059318713300031753Hardwood Forest SoilMKTIYTWSAILAIVFASVVGDVLLARAMKQVGDVGELRRR
Ga0307475_1043052733300031754Hardwood Forest SoilMKGIYTWSAILAIVFASVIGDVLLARAMKQVGDVGALWQRAGLGVV
Ga0307475_1129694713300031754Hardwood Forest SoilMSHIYTWGGILFVVFFSVVGDVLIARAMKQVGDVHELWDRYGLWK
Ga0318550_1042628613300031797SoilMRHAYTWGAILVIVITSVTGDVLLSHAMKSVGDVGE
Ga0307478_1020918613300031823Hardwood Forest SoilMTTTNLYAWAAIALIILASTTGDVLLAHAMKRVGDVGDLWK
Ga0302322_10147226933300031902FenLNASYTWAAIAMIVIAATAGDVLVARAMKQVGDVGELWERHG
Ga0307479_1189894313300031962Hardwood Forest SoilMKHLYTWGGILVIVSASVVGDILLARAMRQVGDVDALGQRTGL
Ga0307470_1155807413300032174Hardwood Forest SoilMKTAYTWGGILVIVFASVVGDILLARAMKQVGDVHALWSRA
Ga0307471_10005810513300032180Hardwood Forest SoilMRHAYTWASIAFIVVTSVTGDVLLSRAMKQVGDVG
Ga0307471_10041798633300032180Hardwood Forest SoilMKHAYTWGAIMAVVLASTTGVVLLSRAMKKVGDVG
Ga0307472_10235571923300032205Hardwood Forest SoilMRHAYTWGAILVIVIASVAGDVLLSRAMKQVGDVDEL
Ga0335079_1074401013300032783SoilMKFAYTWGAIVAVALASVVGDVLLARAMKQVGDVHELWKRSGLWSVIARI
Ga0335078_1069157713300032805SoilMSSLYAWGAIGCIVVTSTAGDVLVTRAMKQVGDFGELRRRSGVLTV
Ga0335080_1105154023300032828SoilVKHVYTWGAILAVALASVIGDVLLAGAMKQVGDVHALWRRSG
Ga0335081_1078282613300032892SoilVRHLYTWGAIVAIVLASTSGDVLLSRAMKQVGDVGRLW
Ga0310811_1130518013300033475SoilMKSMYTWCAILAVVAASASGDVLLAHAMKTVGDVAAL
Ga0371490_109173933300033561Peat SoilMNELYAWAAIGLIILASTTGDVLLSYSMKRVGDVGELWKRRG
Ga0334790_055223_1_1293300033887SoilMKQAYAWGAIAAIVLASTTGDVLLSRAMKQVGDVGALWRQSGL
Ga0334811_067390_807_9413300033891SoilMKDLHAWAAIAIIGMAATTGDVLLSYSMKRVGDVGELWKRRGVLA
Ga0371487_0018606_4783_48903300033982Peat SoilMKDLQAWAAIGIVALAATTGDVLLSHAMKQVGDVAE
Ga0370515_0461349_404_5353300034163Untreated Peat SoilMKQLYTWCAIAVIVFASTSGDVLLARAMKQVGDVGEFWRKHGLF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.