NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F024117

Metagenome / Metatranscriptome Family F024117

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024117
Family Type Metagenome / Metatranscriptome
Number of Sequences 207
Average Sequence Length 109 residues
Representative Sequence MKAKSILVENLPTTNGVLYTVPPNTRAKWILAFVSNGTGSTISDVHIKIENGSTITVLGSKSLGSGDYIQLEQDGGYVMLESGYEITGDAGSTGVSCILTVEETPFLVSTA
Number of Associated Samples 147
Number of Associated Scaffolds 207

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 83.09 %
% of genes near scaffold ends (potentially truncated) 30.92 %
% of genes from short scaffolds (< 2000 bps) 66.67 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.80

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (42.029 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(31.401 % of family members)
Environment Ontology (ENVO) Unclassified
(53.140 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.686 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 47.48%    Coil/Unstructured: 52.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.80
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.121.7.1: Satellite virusesd1vtz0_1vtz0.74246
b.18.1.33: NPCBM-liked2vnga12vng0.72801
b.121.7.1: Satellite virusesd1stma_1stm0.71027
b.121.5.1: Microviridae-like VPd2bpa1_2bpa0.69376
b.121.4.2: Comoviridae-like VPd1pgl111pgl0.68654


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 207 Family Scaffolds
PF13884Peptidase_S74 2.90
PF05065Phage_capsid 1.93
PF02867Ribonuc_red_lgC 1.45
PF00487FA_desaturase 0.97
PF00268Ribonuc_red_sm 0.97
PF00476DNA_pol_A 0.97
PF16778Phage_tail_APC 0.48
PF13155Toprim_2 0.48
PF13392HNH_3 0.48
PF03237Terminase_6N 0.48
PF136402OG-FeII_Oxy_3 0.48
PF12236Head-tail_con 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 207 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 1.93
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 1.45
COG0208Ribonucleotide reductase beta subunit, ferritin-like domainNucleotide transport and metabolism [F] 0.97
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 0.97
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.97
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.78 %
UnclassifiedrootN/A22.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10022936All Organisms → Viruses → Predicted Viral3592Open in IMG/M
3300000101|DelMOSum2010_c10193924Not Available689Open in IMG/M
3300000116|DelMOSpr2010_c10059860All Organisms → Viruses → Predicted Viral1607Open in IMG/M
3300000116|DelMOSpr2010_c10068700All Organisms → Viruses → Predicted Viral1451Open in IMG/M
3300000116|DelMOSpr2010_c10078581All Organisms → Viruses → Predicted Viral1315Open in IMG/M
3300000116|DelMOSpr2010_c10209031Not Available620Open in IMG/M
3300000117|DelMOWin2010_c10118152All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium932Open in IMG/M
3300004097|Ga0055584_101972134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium599Open in IMG/M
3300004279|Ga0066605_10260060All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium648Open in IMG/M
3300005590|Ga0070727_10041302All Organisms → Viruses → Predicted Viral2825Open in IMG/M
3300006399|Ga0075495_1119368All Organisms → Viruses → Predicted Viral1431Open in IMG/M
3300006752|Ga0098048_1007732All Organisms → Viruses → Predicted Viral3969Open in IMG/M
3300006752|Ga0098048_1017208All Organisms → Viruses → Predicted Viral2458Open in IMG/M
3300006752|Ga0098048_1021970All Organisms → Viruses → Predicted Viral2132Open in IMG/M
3300006789|Ga0098054_1146140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium875Open in IMG/M
3300006793|Ga0098055_1395895Not Available511Open in IMG/M
3300006802|Ga0070749_10027773All Organisms → Viruses → Predicted Viral3551Open in IMG/M
3300006802|Ga0070749_10031981All Organisms → Viruses → Predicted Viral3274Open in IMG/M
3300006802|Ga0070749_10110873All Organisms → Viruses → Predicted Viral1617Open in IMG/M
3300006802|Ga0070749_10238410All Organisms → Viruses → Predicted Viral1033Open in IMG/M
3300006802|Ga0070749_10443362All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium712Open in IMG/M
3300006802|Ga0070749_10463225All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium693Open in IMG/M
3300006810|Ga0070754_10003510Not Available11033Open in IMG/M
3300006810|Ga0070754_10056182All Organisms → Viruses → Predicted Viral2059Open in IMG/M
3300006810|Ga0070754_10082883All Organisms → Viruses → Predicted Viral1614Open in IMG/M
3300006810|Ga0070754_10117509All Organisms → Viruses → Predicted Viral1298Open in IMG/M
3300006810|Ga0070754_10282946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium749Open in IMG/M
3300006867|Ga0075476_10075770All Organisms → Viruses → Predicted Viral1320Open in IMG/M
3300006867|Ga0075476_10154594All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium855Open in IMG/M
3300006874|Ga0075475_10066183All Organisms → Viruses → Predicted Viral1677Open in IMG/M
3300006916|Ga0070750_10114377All Organisms → Viruses → Predicted Viral1242Open in IMG/M
3300006916|Ga0070750_10291983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium699Open in IMG/M
3300006919|Ga0070746_10146537All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1152Open in IMG/M
3300006919|Ga0070746_10202354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium945Open in IMG/M
3300006922|Ga0098045_1078992All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium788Open in IMG/M
3300006922|Ga0098045_1079009All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium788Open in IMG/M
3300006990|Ga0098046_1013722All Organisms → Viruses → Predicted Viral2150Open in IMG/M
3300007229|Ga0075468_10114039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium844Open in IMG/M
3300007229|Ga0075468_10234441Not Available525Open in IMG/M
3300007229|Ga0075468_10247957Not Available505Open in IMG/M
3300007234|Ga0075460_10194480Not Available692Open in IMG/M
3300007276|Ga0070747_1347308Not Available507Open in IMG/M
3300007344|Ga0070745_1037219All Organisms → Viruses → Predicted Viral2057Open in IMG/M
3300007344|Ga0070745_1105055All Organisms → Viruses → Predicted Viral1101Open in IMG/M
3300007345|Ga0070752_1006145All Organisms → cellular organisms → Bacteria6889Open in IMG/M
3300007346|Ga0070753_1003057Not Available8833Open in IMG/M
3300007346|Ga0070753_1322697Not Available548Open in IMG/M
3300007538|Ga0099851_1000354Not Available18969Open in IMG/M
3300007538|Ga0099851_1101124All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1098Open in IMG/M
3300007539|Ga0099849_1000814Not Available14550Open in IMG/M
3300007540|Ga0099847_1037479All Organisms → Viruses → Predicted Viral1546Open in IMG/M
3300007540|Ga0099847_1040129All Organisms → Viruses → Predicted Viral1489Open in IMG/M
3300007540|Ga0099847_1166458Not Available651Open in IMG/M
3300007540|Ga0099847_1203938Not Available576Open in IMG/M
3300007540|Ga0099847_1236321Not Available527Open in IMG/M
3300007640|Ga0070751_1040746All Organisms → Viruses → Predicted Viral2079Open in IMG/M
3300007640|Ga0070751_1088531All Organisms → Viruses → Predicted Viral1293Open in IMG/M
3300007960|Ga0099850_1024723All Organisms → Viruses → Predicted Viral2650Open in IMG/M
3300008012|Ga0075480_10051879All Organisms → Viruses → Predicted Viral2404Open in IMG/M
3300008012|Ga0075480_10233491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium958Open in IMG/M
3300009495|Ga0115571_1007532All Organisms → cellular organisms → Bacteria6259Open in IMG/M
3300009495|Ga0115571_1369369Not Available564Open in IMG/M
3300009507|Ga0115572_10042654All Organisms → Viruses → Predicted Viral2933Open in IMG/M
3300009507|Ga0115572_10704710Not Available549Open in IMG/M
3300009507|Ga0115572_10782694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium514Open in IMG/M
3300010392|Ga0118731_110979414Not Available10915Open in IMG/M
3300010430|Ga0118733_100010497Not Available23913Open in IMG/M
3300010430|Ga0118733_107665489All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium559Open in IMG/M
3300012524|Ga0129331_1266358Not Available604Open in IMG/M
3300012969|Ga0129332_1205301All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium549Open in IMG/M
3300013010|Ga0129327_10042264All Organisms → Viruses → Predicted Viral2305Open in IMG/M
3300013010|Ga0129327_10495548Not Available661Open in IMG/M
3300016733|Ga0182042_1118491All Organisms → cellular organisms → Bacteria5157Open in IMG/M
3300016749|Ga0182053_1385522All Organisms → Viruses → Predicted Viral2586Open in IMG/M
3300017697|Ga0180120_10446613Not Available504Open in IMG/M
3300017706|Ga0181377_1018219All Organisms → Viruses → Predicted Viral1563Open in IMG/M
3300017727|Ga0181401_1028788All Organisms → Viruses → Predicted Viral1607Open in IMG/M
3300017742|Ga0181399_1006989All Organisms → Viruses → Predicted Viral3430Open in IMG/M
3300017742|Ga0181399_1009048All Organisms → Viruses → Predicted Viral2954Open in IMG/M
3300017743|Ga0181402_1086324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium818Open in IMG/M
3300017752|Ga0181400_1010229All Organisms → Viruses → Predicted Viral3265Open in IMG/M
3300017762|Ga0181422_1142244Not Available738Open in IMG/M
3300017824|Ga0181552_10285558All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium818Open in IMG/M
3300017824|Ga0181552_10463026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium600Open in IMG/M
3300017950|Ga0181607_10165721All Organisms → Viruses → Predicted Viral1328Open in IMG/M
3300017986|Ga0181569_10971979Not Available549Open in IMG/M
3300018416|Ga0181553_10671025Not Available544Open in IMG/M
3300018420|Ga0181563_10641772Not Available588Open in IMG/M
3300018424|Ga0181591_10999463Not Available568Open in IMG/M
3300018876|Ga0181564_10454075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium691Open in IMG/M
3300019266|Ga0182061_1588566Not Available537Open in IMG/M
3300019937|Ga0194022_1050664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium543Open in IMG/M
3300020191|Ga0181604_10287020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium754Open in IMG/M
3300020347|Ga0211504_1033757All Organisms → Viruses → Predicted Viral1282Open in IMG/M
3300020385|Ga0211677_10363415Not Available568Open in IMG/M
3300021373|Ga0213865_10156500All Organisms → Viruses → Predicted Viral1163Open in IMG/M
3300021425|Ga0213866_10081038All Organisms → Viruses → Predicted Viral1792Open in IMG/M
3300021960|Ga0222715_10004016All Organisms → cellular organisms → Bacteria12956Open in IMG/M
3300021961|Ga0222714_10071741All Organisms → Viruses → Predicted Viral2292Open in IMG/M
3300021962|Ga0222713_10051736All Organisms → Viruses → Predicted Viral3133Open in IMG/M
3300022065|Ga0212024_1000265Not Available3838Open in IMG/M
3300022067|Ga0196895_1045067Not Available509Open in IMG/M
3300022164|Ga0212022_1025652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium894Open in IMG/M
3300022169|Ga0196903_1008944All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1260Open in IMG/M
3300022183|Ga0196891_1034908All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium937Open in IMG/M
3300022183|Ga0196891_1053997Not Available727Open in IMG/M
3300022187|Ga0196899_1048447All Organisms → Viruses → Predicted Viral1404Open in IMG/M
3300022187|Ga0196899_1096002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium885Open in IMG/M
3300022218|Ga0224502_10051407All Organisms → Viruses → Predicted Viral1547Open in IMG/M
3300022909|Ga0255755_1284150All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium584Open in IMG/M
3300022923|Ga0255783_10381997All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium535Open in IMG/M
3300022929|Ga0255752_10340662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium616Open in IMG/M
(restricted) 3300023210|Ga0233412_10328561All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium678Open in IMG/M
3300023567|Ga0228694_100003All Organisms → cellular organisms → Bacteria14554Open in IMG/M
3300023567|Ga0228694_109006All Organisms → Viruses → Predicted Viral1049Open in IMG/M
3300023699|Ga0228695_1003877All Organisms → Viruses → Predicted Viral1972Open in IMG/M
3300023706|Ga0232123_1041096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium948Open in IMG/M
3300024183|Ga0228603_1007695All Organisms → Viruses → Predicted Viral1357Open in IMG/M
3300024185|Ga0228669_1001301All Organisms → cellular organisms → Bacteria10142Open in IMG/M
3300024185|Ga0228669_1007382All Organisms → Viruses → Predicted Viral3017Open in IMG/M
3300024191|Ga0228636_1007071All Organisms → Viruses → Predicted Viral2755Open in IMG/M
3300024221|Ga0228666_1001491Not Available10080Open in IMG/M
3300024221|Ga0228666_1027761All Organisms → Viruses → Predicted Viral1300Open in IMG/M
3300024223|Ga0228601_1033231All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium675Open in IMG/M
3300024228|Ga0228633_1098660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium683Open in IMG/M
3300024229|Ga0233402_1005741All Organisms → Viruses → Predicted Viral3096Open in IMG/M
3300024231|Ga0233399_1002689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales6267Open in IMG/M
3300024231|Ga0233399_1073385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium837Open in IMG/M
3300024236|Ga0228655_1006637All Organisms → Viruses → Predicted Viral3170Open in IMG/M
3300024242|Ga0228673_1057734All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium687Open in IMG/M
3300024247|Ga0228675_1019822All Organisms → Viruses → Predicted Viral1633Open in IMG/M
3300024247|Ga0228675_1021773All Organisms → Viruses → Predicted Viral1539Open in IMG/M
3300024281|Ga0228610_1006520All Organisms → Viruses → Predicted Viral1131Open in IMG/M
3300024281|Ga0228610_1011471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium950Open in IMG/M
3300024291|Ga0228660_1027926All Organisms → Viruses → Predicted Viral1067Open in IMG/M
3300024293|Ga0228651_1147562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium512Open in IMG/M
3300024294|Ga0228664_1005426All Organisms → cellular organisms → Bacteria5030Open in IMG/M
3300024294|Ga0228664_1057249All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium928Open in IMG/M
3300024314|Ga0228657_1116626Not Available522Open in IMG/M
3300024318|Ga0233400_1010273All Organisms → Viruses → Predicted Viral2852Open in IMG/M
3300024318|Ga0233400_1035403All Organisms → Viruses → Predicted Viral1331Open in IMG/M
3300024318|Ga0233400_1048007All Organisms → Viruses → Predicted Viral1091Open in IMG/M
3300024319|Ga0228670_1013837All Organisms → Viruses → Predicted Viral2198Open in IMG/M
3300024319|Ga0228670_1013838All Organisms → Viruses → Predicted Viral2198Open in IMG/M
3300024320|Ga0233398_1000642Not Available16605Open in IMG/M
3300024320|Ga0233398_1013090All Organisms → Viruses → Predicted Viral2471Open in IMG/M
3300024326|Ga0228652_1108704All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium631Open in IMG/M
3300024328|Ga0228635_1025232All Organisms → Viruses → Predicted Viral1824Open in IMG/M
3300024329|Ga0228631_1021159All Organisms → Viruses → Predicted Viral2079Open in IMG/M
3300024428|Ga0233396_1124460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium592Open in IMG/M
3300025070|Ga0208667_1000125Not Available34602Open in IMG/M
3300025070|Ga0208667_1001501All Organisms → cellular organisms → Bacteria8451Open in IMG/M
3300025070|Ga0208667_1018775All Organisms → Viruses → Predicted Viral1377Open in IMG/M
3300025084|Ga0208298_1008972All Organisms → Viruses → Predicted Viral2543Open in IMG/M
3300025084|Ga0208298_1060857All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium724Open in IMG/M
3300025085|Ga0208792_1010470All Organisms → Viruses → Predicted Viral2114Open in IMG/M
3300025098|Ga0208434_1009721All Organisms → Viruses → Predicted Viral2708Open in IMG/M
3300025543|Ga0208303_1062636All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium868Open in IMG/M
3300025626|Ga0209716_1002226Not Available13024Open in IMG/M
3300025646|Ga0208161_1000561Not Available20928Open in IMG/M
3300025652|Ga0208134_1000660All Organisms → cellular organisms → Bacteria22362Open in IMG/M
3300025658|Ga0209659_1152006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium693Open in IMG/M
3300025671|Ga0208898_1061295All Organisms → Viruses → Predicted Viral1301Open in IMG/M
3300025674|Ga0208162_1005520All Organisms → Viruses5833Open in IMG/M
3300025674|Ga0208162_1007169All Organisms → Viruses → Predicted Viral4968Open in IMG/M
3300025705|Ga0209374_1101386All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium880Open in IMG/M
3300025759|Ga0208899_1009354Not Available5570Open in IMG/M
3300025769|Ga0208767_1055787All Organisms → Viruses → Predicted Viral1810Open in IMG/M
3300025849|Ga0209603_1010866Not Available6474Open in IMG/M
3300025853|Ga0208645_1090158All Organisms → Viruses → Predicted Viral1301Open in IMG/M
3300025889|Ga0208644_1000417Not Available35600Open in IMG/M
3300025889|Ga0208644_1118973All Organisms → Viruses → Predicted Viral1265Open in IMG/M
3300026423|Ga0247580_1041095All Organisms → Viruses → Predicted Viral1012Open in IMG/M
3300026426|Ga0247570_1024693All Organisms → Viruses → Predicted Viral1286Open in IMG/M
3300026434|Ga0247591_1019579All Organisms → Viruses → Predicted Viral1228Open in IMG/M
3300026437|Ga0247577_1022650All Organisms → Viruses → Predicted Viral1377Open in IMG/M
3300026453|Ga0228644_1002308All Organisms → cellular organisms → Bacteria5089Open in IMG/M
3300026460|Ga0247604_1058152All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium924Open in IMG/M
3300026466|Ga0247598_1038362All Organisms → Viruses → Predicted Viral1351Open in IMG/M
3300026470|Ga0247599_1024954All Organisms → Viruses → Predicted Viral1254Open in IMG/M
3300026479|Ga0228622_1084576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium664Open in IMG/M
3300026483|Ga0228620_1010853All Organisms → Viruses → Predicted Viral2534Open in IMG/M
3300026504|Ga0247587_1122028All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium642Open in IMG/M
3300026505|Ga0228647_1015083All Organisms → Viruses → Predicted Viral2082Open in IMG/M
3300026505|Ga0228647_1072870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium841Open in IMG/M
3300026505|Ga0228647_1081526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium786Open in IMG/M
3300026505|Ga0228647_1117675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium624Open in IMG/M
3300026506|Ga0228604_1028682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium827Open in IMG/M
3300026511|Ga0233395_1000688All Organisms → cellular organisms → Bacteria17297Open in IMG/M
3300027790|Ga0209273_10001699Not Available18574Open in IMG/M
3300027917|Ga0209536_100668228All Organisms → Viruses → Predicted Viral1291Open in IMG/M
3300028008|Ga0228674_1000767Not Available20866Open in IMG/M
3300028008|Ga0228674_1007510All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium5250Open in IMG/M
3300028008|Ga0228674_1253320All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium547Open in IMG/M
3300028099|Ga0247576_1022472All Organisms → Viruses → Predicted Viral1365Open in IMG/M
3300028102|Ga0247586_1116137Not Available501Open in IMG/M
3300028125|Ga0256368_1042111All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium811Open in IMG/M
3300028129|Ga0228634_1034551All Organisms → Viruses → Predicted Viral1387Open in IMG/M
3300028131|Ga0228642_1044846All Organisms → Viruses → Predicted Viral1214Open in IMG/M
3300028134|Ga0256411_1070376All Organisms → Viruses → Predicted Viral1199Open in IMG/M
3300028196|Ga0257114_1252852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium627Open in IMG/M
3300028280|Ga0228646_1111024All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium669Open in IMG/M
3300028287|Ga0257126_1017026All Organisms → Viruses → Predicted Viral3617Open in IMG/M
3300028599|Ga0265309_11051346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium563Open in IMG/M
3300032274|Ga0316203_1119277All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium739Open in IMG/M
3300034418|Ga0348337_149223Not Available664Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous31.40%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater30.92%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.73%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.73%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.38%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.38%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.90%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.93%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.45%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.45%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.48%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.48%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.48%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.48%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.48%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.48%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.48%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.48%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.48%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.48%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016733Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019937Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MGEnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022909Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaGEnvironmentalOpen in IMG/M
3300022923Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023567Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023699Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 81R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023706Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024183Seawater microbial communities from Monterey Bay, California, United States - 3DEnvironmentalOpen in IMG/M
3300024185Seawater microbial communities from Monterey Bay, California, United States - 84DEnvironmentalOpen in IMG/M
3300024191Seawater microbial communities from Monterey Bay, California, United States - 45DEnvironmentalOpen in IMG/M
3300024221Seawater microbial communities from Monterey Bay, California, United States - 80DEnvironmentalOpen in IMG/M
3300024223Seawater microbial communities from Monterey Bay, California, United States - 1DEnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024229Seawater microbial communities from Monterey Bay, California, United States - 54DEnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024236Seawater microbial communities from Monterey Bay, California, United States - 67DEnvironmentalOpen in IMG/M
3300024242Seawater microbial communities from Monterey Bay, California, United States - 91DEnvironmentalOpen in IMG/M
3300024247Seawater microbial communities from Monterey Bay, California, United States - 36D_rEnvironmentalOpen in IMG/M
3300024281Seawater microbial communities from Monterey Bay, California, United States - 11DEnvironmentalOpen in IMG/M
3300024291Seawater microbial communities from Monterey Bay, California, United States - 74DEnvironmentalOpen in IMG/M
3300024293Seawater microbial communities from Monterey Bay, California, United States - 63DEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024314Seawater microbial communities from Monterey Bay, California, United States - 70DEnvironmentalOpen in IMG/M
3300024318Seawater microbial communities from Monterey Bay, California, United States - 46DEnvironmentalOpen in IMG/M
3300024319Seawater microbial communities from Monterey Bay, California, United States - 85DEnvironmentalOpen in IMG/M
3300024320Seawater microbial communities from Monterey Bay, California, United States - 38DEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024328Seawater microbial communities from Monterey Bay, California, United States - 44DEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300024428Seawater microbial communities from Monterey Bay, California, United States - 32DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025705Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026423Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026426Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 23R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026437Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 34R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026453Seawater microbial communities from Monterey Bay, California, United States - 56DEnvironmentalOpen in IMG/M
3300026460Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026479Seawater microbial communities from Monterey Bay, California, United States - 26DEnvironmentalOpen in IMG/M
3300026483Seawater microbial communities from Monterey Bay, California, United States - 23DEnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026505Seawater microbial communities from Monterey Bay, California, United States - 59DEnvironmentalOpen in IMG/M
3300026506Seawater microbial communities from Monterey Bay, California, United States - 4DEnvironmentalOpen in IMG/M
3300026511Seawater microbial communities from Monterey Bay, California, United States - 27DEnvironmentalOpen in IMG/M
3300027790Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028099Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 33R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028129Seawater microbial communities from Monterey Bay, California, United States - 42DEnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028280Seawater microbial communities from Monterey Bay, California, United States - 58DEnvironmentalOpen in IMG/M
3300028287Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120mEnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1002293623300000101MarineMKAKTILKENLALTAASLADRTLYTVPPNIRAKWVLAFVSNGAGSTVSDVRVRIEGDETITVIGSKSLGAGDYIELKQDGGYVMLESGYKITGSANATGISCMLTFEETPYLVSTA*
DelMOSum2010_1019392413300000101MarineMKARTILIENLPTTTSTLYTVPPNTRAKWVLAFVSNGTGSTINGVHINIENDATITVLGSKSLGSGDYIQLKQDGGYVMLESGYQITGDAGSTGV
DelMOSpr2010_1005986023300000116MarineMKAKTILKDSLALTGASAADKVLYTVPPNVRAKWILAFVSNGTGSTISNVHLQISNGSTITVLGAKSLGSGDYIQLNQDGGYVMLESGYEIIGDADSTGVSCILTFEETPFLVSTA*
DelMOSpr2010_1006870023300000116MarineMKAKTILIDSLPTTNDVLYTVPPNVRAKWVLAFVSNGTNSTISNVHIKIENGSTITVIGSKTLNSGDFIQLETDGGYVMLESGYQITGDAGSTGVSCILTFEETPFLVSTA*
DelMOSpr2010_1007858143300000116MarineMKSKTVLVESLATSWATIYTVPPNTRAKWILAFISNGTGSSINNAGLRIVNDDTITVLGAKSLNSGDYIQFGQAGIYVMLEPGYTIEAQAGTTG
DelMOSpr2010_1020903113300000116MarineMRAKSILTENLTTAALTDSTALLYTVPPNTKAKWVLAFVSNGTGSTISDVHLQISNGVDIVVLGSKSLGSGDYIQLKQDGGYVMLEAGYEIRGNAGSTGVSCILTVEETSSTVTYNG*
DelMOWin2010_1011815223300000117MarineMKARSILTENLPTSIATLYTVPDNIRAKWVLAFVSNGSGSTISNVVLQISNGVTIKVLGSKSLGSGDFIQLESNGGYVMLESGTTIQGSAGSTGVSCILTVEELPFIVSTV*
Ga0055584_10197213423300004097Pelagic MarineMKARSILTANLPTSIGTLYTVPDNIRAKWVLAFVSNGTGSTISNVVLQISNGVTIKVLGSKSLGAGDFIQLESNGGYVMLESGTTIQGSAASTGVSCILTVEELPFIVSTV*
Ga0066605_1026006023300004279MarineLFGMKARTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDAGSTGVSCMLTFEETPYLVSTV*
Ga0070727_1004130233300005590Marine SedimentMKSKTVLVENLATSWATIYTVPANTRAKWVLAFVSNGSGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEGQAGTTGVSCILTLEETSFVVSTS*
Ga0075495_111936843300006399AqueousMKARTILIENLPTTTSTLYTVPPNTRAKWVLAFVSNGTGSTINGVHINIENDATITVLGSKSLGSGDYIQLKQDGGYVMLESGYQITGDAGSTGVSCILTVEETPFLVSTA*
Ga0098048_100773253300006752MarineMKAKTILIENLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHLKIENGSTITVIGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCILTFEETPFLVSTA*
Ga0098048_101720873300006752MarineMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGAGSTVSNVHLEISNDVDIVVLGSKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG*
Ga0098048_102197063300006752MarineMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTVSDVHIKIENGSTITVLGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCIL
Ga0098054_114614023300006789MarineMKAKTILIDNLPTTNDVLYTVPPNTRAKWLLAFVSNGTGSTVSDVHIKIENGSTITVLGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCILTFEETPFLVSTA*
Ga0098055_139589513300006793MarineMKAKTILIENLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHLKIENGSTITVIGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCILTFEETP
Ga0070749_1002777323300006802AqueousMKSKTVLVESLETTWTTLYTVPDNTRVKWVMAFASNGTGSTINDVGIRIVNSDTITVVGAKSLTSSDYILFGQAGIYVMLEPGYVIQGQAGSAGVSCILTLEETGYIVSTS*
Ga0070749_1003198123300006802AqueousMKSKTVLVENLATSWATIYEVPANTRAKWILAFVSNGTGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPTYTIEAQAGSTGVSCILTLEETSFVVSTS*
Ga0070749_1011087343300006802AqueousMKARTVLIENLPTTTGTLYTVPPNIRAKWILAFVSNGTGSTISNIYINIENDVTITVLGSKSLGSGDYVQLEQNGGYVMLESGYKITGSASSTGISCILTFEELPFLVSTA*
Ga0070749_1023841023300006802AqueousMKAKTILKDSLALTGASAADKVLYTVPPNVRAKWILAFVSNGTGSTISNVHLQISNGNTITVLGAKSLGSGDYIQLNQDGGYVMLESGYEIIGDADSTGVSCILTFEETPFLVSTA*
Ga0070749_1044336213300006802AqueousILKENLALTAASLADRTLYTVPPNIRAKWVLAFVSNGAGSTVSDVRVRIEGDETITVIGSKSLGAGDYIELKQDGGYVMLESGYKITGSANATGISCMLTFEETPYLVSTA*
Ga0070749_1046322523300006802AqueousMKAKTILIDSLPTTNQPLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEFIQLETDGGYVMLESGYQITGDAATSGVSCILTFEETPFLV
Ga0070754_1000351093300006810AqueousMKARSILTENLPTSIATLYTVPDNIRAKWILAFVSNGTGSTISNVVLQISNGVTIKVLGSKSLGSGDFIQLESNGGYVMLESGTTIQGSAGSTGVSCILTVEELPFIVSTV*
Ga0070754_1005618233300006810AqueousMKSKTVLVENLATSWATIYTVPPNTRAKWILAFVSNGTGSTISNVGIRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEGQAGTTGVSCILTLEETSFVVSTS*
Ga0070754_1008288323300006810AqueousMKAKTILIDSLPTTNGVLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEFIQLETDGGYVMLESGYTITGDAGSTGVSCILTFEETPFLVSTA*
Ga0070754_1011750933300006810AqueousMKAKSILVENLPTTNGVLYTVPPNTRAKWILAFVSNGTGSTISDVHIKIENGSTITVLGSKSLGSGDYIQLEQDGGYVMLESGYEITGDAGSTGVSCILTVEETPFLVSTA*
Ga0070754_1028294623300006810AqueousMKAKSILVENLPTTNGVLYTVPPNTRAKWILAFVSNGTGSTISDVHIKIENGSTITVLGSKSLGSGDFIQLKQDGGYVMLESGYEITGDAGSAGVSCILTVEETPFLVSTA*
Ga0075476_1007577023300006867AqueousMQLNTRRKVFGMKARSILTENLPTSIATLYTVPDNIRAKWVLAFVSNGTGSTISNVVLQISNGVTIKVLGSKSLGSGDFIQLESNGGYVMLESGTTIQGSAGSTGVSCILTVEELPFIVSTV*
Ga0075476_1015459423300006867AqueousMKAKTILIDSLPTTNDVLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEFIQLETDGGYVMLESGYQITGDAGTAGVSCILTFEETPFLVSTA*
Ga0075475_1006618343300006874AqueousMKARTILIESLPTTNGVLYTVPPNVRAKWVLAFVSNGTNSTISNVHIKIENGSTITVIGSKTLNSGEFIQLETDGGYVMLESGYQITGDAGSTGV*
Ga0070750_1011437723300006916AqueousMKAKTILIDSLPTTNGVLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEFIQLETDGGYVMLESGYQITGDAATSGVSCILTFEETPFLVSTA*
Ga0070750_1029198323300006916AqueousMKSRTVLVENLAASWATIYTVPANTRAKWILSFVSNGTGSTISDVGIRIVNDDTITVLGAKSLGSGDYIQFGQAGIYVMLEPGYTIEAQAGSTGVSCILTLEETSFVVSTS*
Ga0070746_1014653723300006919AqueousMKSKTVLVENLATSWATIYEVPANTRAKWILAFVSNGTGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEAQAGTTGVSCILTLEETSFVVSTS*
Ga0070746_1020235413300006919AqueousTNGVLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKTLNSGDFIQLETDGGYVMLESGYQITGDAGSTGVSCILTFEETPFLVSTA*
Ga0098045_107899223300006922MarineMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTVSDVHIKIENGSTITVLGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCILTFEETPFL
Ga0098045_107900923300006922MarineMKAKTILIENLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHLKIENGSTITVIGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCILTFEETPFL
Ga0098046_101372213300006990MarineMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTVSDVHIKIENGSTITVLGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCILTFEETP
Ga0075468_1011403923300007229AqueousMKARTILIENLPTTTSTLYTVPPNTRAKWVLAFVSNGTGSTINGVHINIENDATITVLGSKSLGSGDYIQLKQDGGYVMLESGYQITGD
Ga0075468_1023444123300007229AqueousMKAKTILTESLALTGATQSERTIYTVPDNTRAKWILAFVVNSTGSTVSDVRLRIENDATITVIGSKSLGAGDYIELEMNGGYVMLESGYSITGSANSTGISCMLTFEETPYLVSTA*
Ga0075468_1024795713300007229AqueousMKARTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISDVHIKIENGSTITVIGSKSLGSGDFIQLKQDGGYVMLESGYEITGDAGSTGVSCILTVEETPFLVSTA*
Ga0075460_1019448013300007234AqueousMKSKTVLVENLATSWDTIYEVPANTRAKWILAFVSNGTGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEAQAGSTGVSCILTLEE
Ga0070747_134730823300007276AqueousMKARTILTESLALTGATQAERTIYTVPDNVRAKWILAFVSNSANSSISNVRLRIENDETITVIGSKSLGAGNYIQLEQNGGYVMLESGYSITGSANSTGVSCILTFEETPYLVSTA*
Ga0070745_103721923300007344AqueousMKARSILTENLPTSIATLYTVPDNIRAKWVLAFVSNGTGSTISNVVLQISNGVTIKVLGSKSLGSGDFIQLESNGGYVMLESGTTIQGSAGSTGVSCILTVEELPFIVSTV*
Ga0070745_110505523300007344AqueousMKARTVLIENLPTTTGTLYTVPPNIRAKWILAFVSNGTGSTISNIHINIENGVTIAVLGSKSLGSGDYVQLEQNGGYVMLESGYMITGSAGSTGISCILTFEELPFLVSTA*
Ga0070752_100614533300007345AqueousMKSKTVLVENLATSWATIYTVPPNTRAKWILAFVSNGTGSTISNVGIRIVNDDTITVLGAKSLGSGDYIQFGQAGIYVMLEPGYTIEAQAGTTGVSCILTLEETSFVVSTS*
Ga0070753_100305783300007346AqueousAKHILKDSLALTGASAADKILYTVPPNVRAKWILAFVSNGTGSTISNVHLQISNGNTITVLGAKSLGSGDYIQLNQDGGYVMLESGYEIIGDADSTGVSCILTFEETPFLVSTA*
Ga0070753_132269723300007346AqueousMKAKTILIDSLPTTNDVLYTVPPNVRAKWILAFITNGTGSTISNVNLKIENDVTITVLGSKSLGSGDYIQLEQNGGYVMLESGYQITGDAGSTGVSCILTFEETPFLVSTA*
Ga0099851_100035453300007538AqueousMKARTVLIENLPTTTGTLYTVPPNIRAKWILAFVSNGTGSTISNIHINIENGVTITVLGSKSLGSGDYVQLEQNGGYVMLESGYKITGSASSTGISCILTFEELPFLVSTA*
Ga0099851_110112423300007538AqueousMKARSILTANLPTSIGTLYTVPDNIRAKWILAFVSNGTGSTISNVVLQISNGVTIKVLGSKSLGAGDFIQLESDGGYVMLESGTTIEGSAGSTGVSCILTVEELPFIVSTV*
Ga0099849_100081493300007539AqueousMKAKTILIENLPTTNDVLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEFIQLEQDGGYVMLESGYQITGDAGSTGVSCILTFEETPFLVSTA*
Ga0099847_103747943300007540AqueousMKARTILIENLPTTTSTLYTVPPNTRAKWVLAFVSNGTGSTINGVHINIENDATITVLGSKSLGSGDYIQLKQDGGYVMLESGYSIT
Ga0099847_104012923300007540AqueousMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVVNGTGSTISGVHLEISNGVDIVVLGSKSLGSSEYIELEMNGGYVILESGYELRGNAGSTGVSCILTVEETSSTVTYNG*
Ga0099847_116645823300007540AqueousMKARTILVENLPTTTSTLYTVPPNTRAKWVLAFVSNGTGSTINGVHINIENDATITVLGSKSLGSGDYIQLKQDGGYVMLESGYQITGDAGSTGVSCILTVEETPFLVSTA*
Ga0099847_120393823300007540AqueousMKAKSILVENLPTTNGVLYTVPPNTRAKWILAFVSNGTGSTISDVHIKIENGATVTVLGSKSLGSGDYIELEMNGGYVMLESGYEITGDAGSTGVSCILTFEETPFLVSTA*
Ga0099847_123632123300007540AqueousMKARTILKESLADTAASLEDRTLYTVPPNTRAKWILAFVANSTGSTVTGVRVRIENDETITVVGSKSLGAGDFIQLEQNGGYVMLESGYSITGSANSTGISCMLTFEETPYLVSTA*
Ga0070751_104074623300007640AqueousMKARTVLIENLPTTTGTLYTVPPNIRAKWILAFVSNGTGSTISNIHINIENGVTISVLGSKSLGSGDYIQLEQNGGYVMLESGYKITGSAGSTGISCILTFEELPFLVSTA*
Ga0070751_108853123300007640AqueousMKAKTILIDSLPTTNGVLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEFIQLETDGGYVMLESGYQITGDAGTAGVSCILTFEETPFLVSTA*
Ga0099850_102472313300007960AqueousMKARTVLIENLPTTTGTLYTVPPNIRAKWILAFVSNGTGSTISNIHINIENGVTITVLGSKSLGGGDYIQLEQNGGYVMLESGYIITGSAGSTGVSCILTFEELPFLVSTA*
Ga0075480_1005187923300008012AqueousMKSKTVLVEYLATSWATIYTVPANTRAKWVLAFVSNGTGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEAQAGTTGVSCILTLEETSFVVSTS*
Ga0075480_1023349123300008012AqueousMKARTILIESLPTTNGVLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEFIQLETDGGYVMLESGYQITGDAGTAGVSCILTFEETPFLVSTA*
Ga0115571_100753223300009495Pelagic MarineMRAKSVMTENLTTAALTDSTALLYTVPPNARAKWVLAFVSNGSGSTVSGVHLEISNGVDIVVLGSKSLGSGDYIELEMNGGYVILESGYELRGNAGSTGVSCILTVEETSSTVTYNG*
Ga0115571_136936913300009495Pelagic MarineMRAKTVMTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGTTIGNVHLEISNGVDIVVLGSKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG*
Ga0115572_1004265443300009507Pelagic MarineMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTVSNVHLEISNGVDIVVLGSKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG*
Ga0115572_1070471013300009507Pelagic MarineMRAKSVMTENLTTAALTDSTALLYTVPPNTRAKWVLAFVSNGSGSTVSGVHLEISNGVDIVVLGSKSLGSGDYIELEMNGGYVILESGYELRGNAGSTGVSCILTVEETSSTVTYNG*
Ga0115572_1078269423300009507Pelagic MarineLLYTVPPNTRAKWILAFVSNGSGTTIGNVHLEISNGVDIVVLGSKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG*
Ga0118731_110979414103300010392MarineMRAKTVLVENLSTAVISDSTALIYTVPPNTKAKWILAFVSNGSGTTKSGIDLEISNGVDITVIGAKSLGSGEYLELKTNGGYIMLESGYEIRGRANATGVSCILTFEETSSTVTYNG*
Ga0118733_100010497343300010430Marine SedimentMRAKTVLVENLSTAVISDSTALIYTVPPNTKSKWILAFVSNGSGTTKSGIDLEISNGVDITVIGAKSLGSGEYLELKTNGGYIMLESGYEIRGRANATGVSCILTFEETSSTVTYNG*
Ga0118733_10766548923300010430Marine SedimentMRAKTVMTENLTTAALTDSTALLYTVPPNTRAKWILAFVSKGSGSTVSNVHLEISNDVDIVVLGAKSLGSSDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG*
Ga0129331_126635813300012524AqueousMKARTILVENLPTTTSTLYTVPPNTRAKWVLAFVSNGTGSTINGVHISIENDATITVLGSKSLGSGDYIQLKQDGGYVMLESGYQITGDAGSTGVSCILTVEETPFLV
Ga0129332_120530113300012969AqueousSGMKARTILIENLPTTTGTLYTVPPNTRAKWVLAFVSNGTGSTINGVHINIENDATITVLGSKSLTSGDYIQLKQDGGYVMLESGYQITGDAGSTGVSCILTVEETPFLVSTA*
Ga0129327_1004226433300013010Freshwater To Marine Saline GradientMKARTILIENLPTTTSTLYTVPPNTRAKWVLAFVSNGTGSTINGVHINIENDATITVLGSKSLGSGDYIQLKQDGGYVMLESGYSITGDAGSTGVSCILTVEETPFLVSTA*
Ga0129327_1049554823300013010Freshwater To Marine Saline GradientMKARTILKESLADTAASLEDRTLYTVPPNTRAKWILAFVANSTGSTVAGVRVRIENDETITVIGSKSLGAGNYIQLEQNGGYVMLESGYSITGSANSTGVSCILTFEETPYLVSTA*
Ga0182042_111849143300016733Salt MarshMKSKTVLVENLATSWATIYTVPANTRAKWVLAFVSNGTGSTISDVGIRIVNDDTITVLGAKSLHSGDYIQFGQAGIYVMLEPGYTIEAQADATGVSCILTLEETSFVVSTS
Ga0182053_138552223300016749Salt MarshMKSKTVLVENLATSWATIYTVPANTRAKWVLAFVSNGTGSTISDVGIRIVNDDTITVLGAKSLGSGDYIQFGQAGIYVMLEPGYTIEAQADTTGVSCILTLEETSFVVSTS
Ga0180120_1044661313300017697Freshwater To Marine Saline GradientTQRRLSGMKARTILIENLPTTTSTLYTVPPNTRAKWVLAFVSNGTGSTINSVHINIENDATITVLGSKSLGSGDYIQLKQDGGYVMLESGYSITGDAGSTGVSCILTVEETPFLVSTA
Ga0181377_101821923300017706MarineMKAKSILVENLPTTNGVLYTVPPNIRAKWILAFVSNGTGSTVSDVHIKIQNGSTITVLGSKSLGSGDFIQLKQDGGYVMLESGYEITGDAGSTGVSCILTVEETPFLVSTA
Ga0181401_102878823300017727SeawaterMKAKTILIDNLPTTNGVLYTVPPNTRSKWVLAFVSNGTGSTISDVHIKIENGSTITVIGSKSLTSGEFIQLETDGGYVMLESGYTITGDAGSTGVSCILTFEETPFLVSTA
Ga0181399_100698933300017742SeawaterMKAKTILIDNLPTTNDVLYTVPPNTRSKWVLAFVSNGTGSTISDVHIKIENGSTITVIGSKSLGSGEYIQLETDGGYVMLESGYTITGDAGSTGVSCILTFEETPFLVSTA
Ga0181399_100904843300017742SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTKAKWVLAFVSNGTGSTVSNVHLEISNDVDIVVLGSKSLGSGEYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0181402_108632423300017743SeawaterMKAKTILIDNLPTTNDVLYTVPPNTRSKWILAFVSNGTGSTISDVHIKIENGSTITVIGSKSLGSGEYIQLETDGGYVMLESGYTITGDAGSTGVSCILTFEETPFLVSTA
Ga0181400_101022933300017752SeawaterMKAKTILIDNLPTTNGVLYTVPPNTRAKWVLAFVSNGTGSTISDVHIKIENGSTITVIGSKSLGSGEYIQLETDGGYVMLESGYTITGDAGSTGVSCILTFEETPFLVSTA
Ga0181422_114224423300017762SeawaterMKAKTILIDNLPTTNGVLYTVPPNTRAKWVLAFVSNGTGSTISDVHIKIENGSTITVIGSKSLGSGEYIQLETDGGYVMLESGYEITGDAGSTGVSCILTFEETPFLVSTA
Ga0181552_1028555823300017824Salt MarshMKARTILVESLPATITTLYTVPPNTRAKWVLAFVSNSTGSSVSGVSIEISNSETITVFGAKVLQSGDFIRLEQDGGYVILDPGYSIQGKANSPGVSCILTLEETSFVVSTS
Ga0181552_1046302623300017824Salt MarshMKSKTVLVENLATSWATIYTVPANTRAKWVLAFVSNGTGSTISDVGIRIVNDDTITVLGAKSLHSGDYIQFGQAGIYVMLEPGYTIEAQADTTGVSCILTLEETSFVVSTS
Ga0181607_1016572123300017950Salt MarshMKSKTVLVENLATSWATIYTVPANTRAKWILAFVSNGTGSTISDVGIRIVNDDTITVLGAKSLHSGDYIQFGQAGIYVMLEPGYTIEAQADTTGVSCILTLEETSFVVSTS
Ga0181569_1097197913300017986Salt MarshQRRQSGMKAKSILVENLPTTNGVLYTVPPNTRAKWILAFVSNGTGSTISDVHIKIDNGSTITVLGSKSLGSGEFIELKQDGGYVMLESGYTITGDAGSTGVSCILTFEETPFLVSTA
Ga0181553_1067102513300018416Salt MarshMKSKTVLVENLATSWATIYTVPANTRAKWILAFVSNGTGSTISNVGIRIVNDDTITVLGAKSLGSGDFIRLEQDGGYVMLEPGYTIEAQAHSLGVSCILTLEETSFVVSTS
Ga0181563_1064177223300018420Salt MarshMKSKTILVENLATSWATIYTVPANTRAKWVLAFVSNGTGSTISNVGIRIVNDDTITVLGAKSLGSGDFIRLEQDGGYVMLEPGYTIEAQAHSLGVSCILTLEETSFVVSTS
Ga0181591_1099946313300018424Salt MarshMKAKTILIDSLPTTNQPLYTVPPNVRAKWILAFVSNGTGSTISNVHLQVSNGTVITVLGAKSLGSGDYIQLNQDGGYVMLESGYEIIGDADSTGVSCILTFEETPFLVSTA
Ga0181564_1045407513300018876Salt MarshMKSKTVLVENLATSWATIYTVPANTRAKWILAFVSNGTGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEAQAGTTGVSCILTFEETSFVVSTS
Ga0182061_158856623300019266Salt MarshMKARSILTDNLPTSTGTLYTVPDNIRAKWVLAFVSNGTGSTISNVVIQISNGVTIKVLGSKSLGAGDFVQLESNGGYVMLEPGTTIEGSAGATGVSCILTVEE
Ga0194022_105066413300019937FreshwaterMKAKTILKDSLALTGASAADKVLYTVPPNVRAKWILAFVSNGTGSTISNVHLQISNGNTITVLGAKSLGSGDYIQLNQDGGYVML
Ga0181604_1028702023300020191Salt MarshILVENLATSWATIYTVPANTRAKWVLAFVSNGTGSTISDVGIRIVNDDTITVLGAKSLHSGDYIQFGQAGIYVMLEPGYTIEAQADTTGVSCILTLEETSFVVSTS
Ga0211504_103375723300020347MarineMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWVLAFVSNGSGSTVSNVHLEISNDVDIVVLGSKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0211677_1036341513300020385MarineMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTVSNVHLEISNGVDIVVLGSKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0213865_1015650023300021373SeawaterMKSKTVLVENLATSWATIYTVPANTRAKWILAFVSNGTGSTISNVGIRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEAQAGTTGVSCILTFEETSFVVSTS
Ga0213866_1008103813300021425SeawaterMKSKTVLVENLATSWATIYTVPPNTRAKWILAFVSNGTGSTISNVGIRIVNDDTITVLGAKSLGSGDYIQFGQAGIYVMLEPGYTIEAQAGTTGVSCILTFEETSFVVSTS
Ga0222715_1000401663300021960Estuarine WaterMKSKTVLVENLATSWATIYTVPANTRAKWILAFVSNGTGSTISNVGIRIVNDDTITVLGAKSLGSGDYIQFGQAGIYVMLEPGYTIEAQAGTTGVSCILTFEETSFVVSTS
Ga0222714_1007174163300021961Estuarine WaterMKARTVLIENLPTTTGTLYTVPPNIRAKWILAFVSNGTGSTISNIHINIENGVTITVLGSKSLGSGDYIQLEQNGGYVMLESGYKITGSANSTGISCILTFEELPFLVSTA
Ga0222713_1005173623300021962Estuarine WaterMKARTVLIENLPTTTGTLYTVPPNIRAKWILAFVSNGTGSTISNIHINIENDVTITVLGSKSLGSGDYVQLEQNGGYVMLESGYKITGSASSTGISCILTFEELPFLVSTA
Ga0212024_100026523300022065AqueousMKSRTVLVENLAASWATIYTVPANTRAKWILSFVSNGTGSTISDVGIRIVNDDTITVLGAKSLGSGDYIQFGQAGIYVMLEPGYTIEAQAGSTGVSCILTLEETSFVVSTS
Ga0196895_104506713300022067AqueousMKARSILTENLPTSIATLYTVPDNIRAKWVLAFVSNGTGSTISNVVLQISNGVTIKVLGSKSLGSGDFIQLESNGGYVMLESGTTIQGSAGSTGVSCILTVEELPFIVSTV
Ga0212022_102565223300022164AqueousMKAKTILKENLALTAASLADRTLYTVPPNIRAKWVLAFVSNGAGSTVSDVRVRIEGDETITVIGSKSLGAGDYIELKQDGGYVMLESGYKITGSANATGISCMLTFEETPYLVSTA
Ga0196903_100894423300022169AqueousMKARTILVENLPTTTSTLYTVPPNTRAKWVLAFVSNGTGSTINGVHINIENDATITVLGSKSLGSGDYIQLKQDGGYVMLESGYQITGDAGSTGVSCILTVEETPFLVSTA
Ga0196891_103490823300022183AqueousMKSKTVLVENLATSWATIYEVPANTRAKWILAFVSNGTGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPTYTIEAQAGSTGVSCILTLEETSFVVSTS
Ga0196891_105399723300022183AqueousMKSKTVLVENLATSWDTIYEVPANTRAKWILAFVSNGTGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPTYTIEAQAG
Ga0196899_104844713300022187AqueousMKSKTVLVENLATSWATIYTVPPNTRAKWILAFVSNGTGSTISNVGIRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEGQAGTTGVSCILTLEETSFVVSTS
Ga0196899_109600213300022187AqueousSLPTTNDVLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEFIQLETDGGYVMLESGYQITGDAGTAGVSCILTFEETPFLVSTA
Ga0224502_1005140723300022218SedimentMRAKSILTENLTTAALTDSTALLYTVPPNTKAKWVLAFVSNGTGSTVSNVHLEISNDVDIVVLGSKSLGSGDFIQLKQDGGYVMLEAGYEIRGNAGSTGVSCILTVEETSSTVTYNG
Ga0255755_128415013300022909Salt MarshESLPATITTLYTVPPNTRAKWVLAFVSNSTGSSVSGVSIEISNSETITVFGAKVLQSGDFIRLEQDGGYVILDPGYSIQGKANSPGVSCILTLEETSFVVSTS
Ga0255783_1038199713300022923Salt MarshLYTVPPNTRAKWVLAFVSNSTGSSVSGVSIEISNSETITVFGAKVLQSGDFIRLEQDGGYVILDPGYSIQGKANSPGVSCILTLEETSFVVSTS
Ga0255752_1034066223300022929Salt MarshRTILVESLPATITTLYTVPPNTRAKWVLAFVSNSTGSSVSGVSIEISNSETITVFGAKVLQSGDFIRLEQDGGYVILDPGYSIQGKANSPGVSCILTLEETSFVVSTS
(restricted) Ga0233412_1032856123300023210SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSSNNVSDVHLEISGGVDIVVLGAKTLHSSDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0228694_100003143300023567SeawaterMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEYIQLETDGGYVMLESGYEITGDAGSTGVSCILTFEETPFLVSTA
Ga0228694_10900623300023567SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDAGSTGVSCILTFEETPYLVSTV
Ga0228695_100387723300023699SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDAGSTGVSCILTFEETPY
Ga0232123_104109613300023706Salt MarshSTQRRHCSMKSKTVLVENLATSWATIYTVPANTRAKWVLAFVSNGTGSTISDVGIRIVNDDTITVLGAKSLHSGDYIQFGQAGIYVMLEPGYTIEAQADTTGVSCILTLEETSFVVSTS
Ga0228603_100769523300024183SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTVGNIHLEISNGVDIVVLGAKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGISCILTVEETSSTVTYNG
Ga0228669_100130123300024185SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTKAKWVLAFISNGSGSTISNVHLEISNGVDIVVLGSKSLGSGDFIQLKQDGGYVMLEAGYEIRGNAGSTGVSCILTVEETSSTVTYNG
Ga0228669_100738243300024185SeawaterMKARTILVENLPTTNAVLYTVPPNTRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEYIQLETDGGYVMLESGYTITGDAGSTGVSCILTFEETPFLVSTA
Ga0228636_100707183300024191SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGTGSTVSGVHLEISNGVDIVVLGAKSLGSGEYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0228666_100149113300024221SeawaterALLYTVPPNTKAKWVLAFISNGSGSTISNVHLEISNGVDIVVLGSKSLGSGDFIQLKQDGGYVMLEAGYEIRGNAGSTGVSCILTVEETSSTVTYNG
Ga0228666_102776133300024221SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISNVHLKIENNETITVLGSKSLGSGDFVQLKQDGGYVMLESGYKITGDAGATGVSCMLTFEETP
Ga0228601_103323113300024223SeawaterTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEYIQLETDGGYVMLESGYEITGDAGSTGVSCILTFEETPFLVSTA
Ga0228633_109866013300024228SeawaterMRAKSIFTENLTTAALTDSTALLYTVPPNTKAKWVLAFISNGSGSTISNVHLEISNGVDIVVLGSKSLGSGDFIQLKQDGGYVMLEAGYEIRGNAGSAGVSC
Ga0233402_100574123300024229SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTVGNIHLEISNGVDIVVLGAKSLGSGEYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0233399_100268973300024231SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTVGNIHLEISNGVDIVVLGAKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0233399_107338513300024231SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGAGSTVSGVHLEISNGVDIVVLGAKSLGSGEYIELEMNGGYVMLESGYELRGNAGST
Ga0228655_100663723300024236SeawaterMKARTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYKITGDAGSTGVSCMLTFEETPYLVSTA
Ga0228673_105773423300024242SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTVGNIHLEISNGVDIVVLGAKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTV
Ga0228675_101982223300024247SeawaterMKARTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYKITGDAGSTGVSCMLTFEETPYLVSTA
Ga0228675_102177333300024247SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFIQLKQDGGYVMLESGYSITGDAGSTGVSCILTFEETPYLVSTV
Ga0228610_100652023300024281SeawaterMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEYIQLETDGGYVMLESGYTITGDAGSTGVSCILTFEETPFLVSTA
Ga0228610_101147123300024281SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFVQLKQDGSYVMLESGYSITGDAGSTGVSCILTFEETPY
Ga0228660_102792623300024291SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGAGSTVSGVHLEISNGVDIVVLGAKSLGSGEYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0228651_114756213300024293SeawaterGGSLMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTVGNIHLEISNGVDIVVLGAKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYN
Ga0228664_1005426113300024294SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGTGSTVSNVHLEISNDADIVVLGAKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0228664_105724923300024294SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISNVHLKIENDETITVLGSKSLGSGDFIQLKQDGGYVMLESGYTITGDAGSTGVSCILTFEETPYLVSTV
Ga0228657_111662613300024314SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFIQLKQDGGYVMLESGYSITGDAGSTGVS
Ga0233400_101027323300024318SeawaterMKARTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFIQLKQDGGYVMLESGYSITGDAGSTGVSCILTFEETPYLVSTV
Ga0233400_103540323300024318SeawaterMKAKTVLIENLPTTTGTLYTVPPNTRAKWILAFVSNGTGSTVGNVHLNIENGSTITVLGSKSLGSGDYIQLEQDGGYVMLESGYQITGDAGSTGISCILTFEETPFLVSTA
Ga0233400_104800713300024318SeawaterTGASAADKVLYTVPPNTRAKWILAFITNGAGSTTSNVNLKIENGVTITVLGSKSLGSGDYIQLEQDGGYVMLEPGYQITGSAGSTGISCILTFEETPFLVSTA
Ga0228670_101383733300024319SeawaterMRAKSIFTENLTTAALTDSTALLYTVPPNTKAKWVLAFISNGSGSTISNVHLEISNGVDIVVLGSKSLGSGDFIQLKQDGGYVMLEAGYEIRGNAGSTGVSCILTVEETSSTVTYNG
Ga0228670_101383823300024319SeawaterMRAKSIFTENLTTAALTDSTALLYTVPPNTKAKWVLAFVSNGSGSTISNVHLEISNGVDIVVLGSKSLGSGDFIQLKQDGGYVMLEAGYEIRGNAGSTGVSCILTVEETSSTVTYNG
Ga0233398_100064233300024320SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYKITGDAGSTGVSCMLTFEETPYLVSTA
Ga0233398_101309023300024320SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDAGSTGVSCILTFEETPYLVSTV
Ga0228652_110870413300024326SeawaterMKARTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYKITGDAGST
Ga0228635_102523213300024328SeawaterMKARTVLVENLPTTNAVLYTVPDNIRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFIQLKQDGGYVMLESGYSITGDAGSTGVSCILTFEETPYLVSTV
Ga0228631_102115923300024329SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGTGSTVSNVHLEISNDVDIVVLGAKSLGSGEYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0233396_112446023300024428SeawaterMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEYIQLETDGGYVMLESGYEITGDAGSTGVSCILTFE
Ga0208667_1000125163300025070MarineMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTVSDVHIKIENGSTITVLGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCILTFEETPFLVSTA
Ga0208667_100150173300025070MarineMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGAGSTVSNVHLEISNDVDIVVLGSKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0208667_101877523300025070MarineMKAKTILIENLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHLKIENGSTITVIGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCILTFEETPFLVSTA
Ga0208298_100897213300025084MarineMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTVSDVHIKIENGSTITVLGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCILTFEETPFLV
Ga0208298_106085723300025084MarineMKAKTILIENLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHLKIENGSTITVIGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCILTFEETPFLV
Ga0208792_101047063300025085MarineMKAKTILIENLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHLKIENGSTITVIGSKSLGSGDYIQLKQDGGYVMLESGYEITGDAGSTGVSCIL
Ga0208434_100972163300025098MarineMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTVSDVHIKIENGSTITVLGSKSLGSGDYIQLKQDGGYVMLESGYEIT
Ga0208303_106263623300025543AqueousTENLTTAALTDSTALLYTVPPNTRAKWILAFVVNGTGSTISGVHLEISNGVDIVVLGSKSLGSSEYIELEMNGGYVILESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0209716_1002226153300025626Pelagic MarineMRAKSVMTENLTTAALTDSTALLYTVPPNARAKWVLAFVSNGSGSTVSGVHLEISNGVDIVVLGSKSLGSGDYIELEMNGGYVILESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0208161_100056163300025646AqueousMKARTVLIENLPTTTGTLYTVPPNIRAKWILAFVSNGTGSTISNIHINIENGVTITVLGSKSLGSGDYVQLEQNGGYVMLESGYKITGSASSTGISCILTFEELPFLVSTA
Ga0208134_1000660273300025652AqueousMKARTILIENLPTTTSTLYTVPPNTRAKWVLAFVSNGTGSTINGVHINIENDATITVLGSKSLGSGDYIQLKQDGGYVMLESGYQITGDAGSTGVSCILTVEETPFLVSTA
Ga0209659_115200613300025658MarineMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSSNNVSDVHLEISGGVDIVVLGAKTLHSSDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSS
Ga0208898_106129523300025671AqueousMKAKTILIDSLPTTNDVLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEFIQLETDGGYVMLESGYQITGDAGTAGVSCILTFEETPFLVSTA
Ga0208162_100552023300025674AqueousMKAKTILIENLPTTNDVLYTVPPNVRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEFIQLEQDGGYVMLESGYQITGDAGSTGVSCILTFEETPFLVSTA
Ga0208162_100716963300025674AqueousMKARSILTANLPTSIGTLYTVPDNIRAKWILAFVSNGTGSTISNVVLQISNGVTIKVLGSKSLGAGDFIQLESDGGYVMLESGTTIEGSAGSTGVSCILTVEELPFIVSTV
Ga0208019_115323313300025687AqueousMKARTVLIENLPTTTGTLYTVPPNIRAKWILAFVSNGTGSTISNIHINIENGVTITVLGSKSLGSGDYVQLEQNGGYVMLES
Ga0209374_110138623300025705MarineMKARTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDAGSTGVSCMLTFEETPYLVSTV
Ga0208899_100935483300025759AqueousMKSKTVLVENLATSWATIYEVPANTRAKWILAFVSNGTGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEAQAGTTGV
Ga0208767_105578733300025769AqueousMKSKTVLVENLATSWATIYEVPANTRAKWILAFVSNGTGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEAQAGTTGVSCILTLEETSFVVSTS
Ga0209603_1010866103300025849Pelagic MarineMRAKTVMTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTIGSVHLEISNGVDIVVLGSKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0208645_109015813300025853AqueousMKAKSILVENLPTTNGVLYTVPPNTRAKWILAFVSNGTGSTISNVHLKIENGSTITVLGSKSLGSGDFIQLKQDGGYVMLESGYEITGDAGSAGVSCILTVEETPFLVSTA
Ga0208644_100041773300025889AqueousMKSKTVLVESLETTWTTLYTVPDNTRVKWVMAFASNGTGSTINDVGIRIVNSDTITVVGAKSLTSSDYILFGQAGIYVMLEPGYVIQGQAGSAGVSCILTLEETGYIVSTS
Ga0208644_111897323300025889AqueousMKAKTILKDSLALTGASAADKVLYTVPPNVRAKWILAFVSNGTGSTISNVHLQISNGNTITVLGAKSLGSGDYIQLNQDGGYVMLESGYEIIGDADSTGVSCILTFEETPFLVSTA
Ga0247580_104109523300026423SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETISVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDAGST
Ga0247570_102469323300026426SeawaterMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEYIQLETDGGYVMLESLMRLQVMQVLQAYHVY
Ga0247591_101957923300026434SeawaterALTDSTALLYTVPPNTKAKWVLAFISNGSGSTISNVHLEISNGVDIVVLGSKSLGSGDFIQLKQDGGYVMLEAGYEIRGNAGSTGVSCILTVEETSSTVTYNG
Ga0247577_102265023300026437SeawaterMKARTVLVENLPTTNAVLYTVPDNIRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFIQLKQDGGYVMLESGYSITGDAGSTGVSFILTFEETPYLVSTV
Ga0228644_100230813300026453SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTVGNIHLEISNGVDIVVLGAKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEE
Ga0247604_105815223300026460SeawaterMKARTILKESLALTGATQAQKTLYTVPDNVRAKWILAFVSNGTGSTISNVHLKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDAGSTGVSCILTF
Ga0247598_103836223300026466SeawaterMKARTVLVENLPTTNAVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDACSTGVSCILTFEETPYLVSTV
Ga0247599_102495423300026470SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTVSNVHLEISNGVDIVVLGSKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGISCILTVEETSSTVTYNG
Ga0228622_108457623300026479SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGTGSTVSNVHLEISNDVDIVVLGAKSLGSGEYIELEMNGGYVMLESGYELRGNAGSTGISCILTVE
Ga0228620_101085313300026483SeawaterYTVPPNTRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEYIQLETDGGYVMLESGYEITGDAGSTGVSCILTFEETPFLVSTA
Ga0247587_112202823300026504SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTKAKWVLAFVSNGTGSTISNVHLEISNGVDIVVLGSKSLGSGDFIQLKQDGGYVMLEAGYEIRGNAGSTGVSCILTVEETSSTVTYNG
Ga0228647_101508323300026505SeawaterMKAKTVLIENLPTTTGTLYTVPPNTRAKWILAFVSNGTGSTVGNVHLNIENGSTITVLGSKSLGSSDYIQLEQDGGYVMLESGYQITGDAGSTGISCILTFEETPFLVSTA
Ga0228647_107287023300026505SeawaterNLTTAALTDSTALLYTVPPNTKAKWVLAFISNGSGSTISNVHLEISNGVDIVVLGSKSLGSGDFIQLKQDGGYVMLEAGYEIRGNAGSTGVSCILTVEETSSTVTYNG
Ga0228647_108152623300026505SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGAGSTVSGVHLEISNGVDIVVLGAKSLGSGEYIELEMNGGYVMLESGYELRGNAGSTGVS
Ga0228647_111767513300026505SeawaterMKARTVLVENLPTTNDVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDAGSTGVSCILTFEETPYLVST
Ga0228604_102868223300026506SeawaterMGGSLMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGSTVGNIHLEISNGVDIVVLGAKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0233395_1000688223300026511SeawaterVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDAGSTGVSCILTFEETPYLVSTV
Ga0209273_10001699113300027790Marine SedimentMKSKTVLVENLATSWATIYTVPANTRAKWVLAFVSNGSGSTISNVGLRIVNDDTITVLGAKSLGSGDFIQFGQAGIYVMLEPGYTIEGQAGTTGVSCILTLEETSFVVSTS
Ga0209536_10066822823300027917Marine SedimentMKAKTILIDSLPTTNDVLYTVPPNVRAKWVLAFVSNGTGSTISDVHIKIENGSTITVIGSKSLGSGEFIQLETDGGYVMLESGYQITGDAATSGVSCILTFEETPFLVSTA
Ga0228674_1000767303300028008SeawaterTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYKITGDAGSTGVSCMLTFEETPYLVSTA
Ga0228674_100751043300028008SeawaterMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHLNIENGSTITVIGSKSLGSGEFIQLETDGGYVMLESGYTITGDAGSTGVSCILTFEETPFLVSTA
Ga0228674_125332013300028008SeawaterTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYTITGDAGSTGVSCILTFEETPFLVSTA
Ga0247576_102247213300028099SeawaterMKARTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFIQLKQDGGYVMLESGYTITGDAGSTGVSCILTLEETPYL
Ga0247586_111613713300028102SeawaterMKARTVLVENLPTTNEVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFVQLTQDGGYVMLESGYSITGDAGSTGVSCILTFEETPYLVSTV
Ga0256368_104211123300028125Sea-Ice BrineMRAKTVLVENLSTAVISDSTALIYTVPPNTKSKWVLAFISNGSGTTKSGIDLEISNGVDITVIGAKSLGSGDYLELKTNGGYIMLESGYEIRGRANATGVSCILTFEETSSTVTYNG
Ga0228634_103455133300028129SeawaterMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGTGSTVSNVHLEISNDVDIVVLGAKSLGSGEYIELEMNGGYVMLESGYELRGNAGSTGISCILTVEETSSTVTYNG
Ga0228642_104484633300028131SeawaterMKAKTILIDNLPTTNDVLYTVPPNTRAKWVLAFVSNGTGSTISNVHIKIENGSTITVIGSKSLSSGEYIQLETDGGYVMLESGYEITGDAGSTGV
Ga0256411_107037623300028134SeawaterMKARTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHLKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITGDAGSTGVSCILTFEETPYLVSTV
Ga0257114_125285213300028196MarineMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGAGSTVSGVHLEISNGADIVVLGAKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0228646_111102413300028280SeawaterMKARTVLVENLPTTNGVLYTVPDNVRAKWILAFVSNGTGSTISDVHIKIENDETITVLGSKSLGSGDFVQLKQDGGYVMLESGYSITG
Ga0257126_101702663300028287MarineMRAKSILTENLTTAALTDSTALLYTVPPNTRAKWVLAFVSNGAGSTVSGVHLEISGGADIVVLGAKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGISCILTVEETSSTVTYNG
Ga0265309_1105134623300028599SedimentMRAKTVMTENLTTAALTDSTALLYTVPPNTRAKWILAFVSNGSGTTIGNVHLEISNGVDIVVLGSKSLGSGDYIELEMNGGYVMLESGYELRGNAGSTGVSCILTVEETSSTVTYNG
Ga0316203_111927723300032274Microbial MatTLYTVPDNIRAKWVLAFVSNGTGSTISNVVLQISNGVTIKVLGSKSLGSGDFIQLESNGGYVMLESGTTIQGSAGSTGVSCILTVEELPFIVSTV
Ga0348337_149223_59_3943300034418AqueousMKARTVLIENLPTTTGTLYTVPPNIRAKWILAFVSNGTGSTISNIHINIENGVTISVLGSKSLGSGDYIQLEQNGGYVMLESGYKITGSAGSTGISCILTFEELPFLVSTA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.