Metagenome Family F024784

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F024784
Family Type	Metagenome
Number of Sequences	204
Average Sequence Length	38 residues
Representative Sequence	MGRAEKILDVIVWLLIVGGMGWFAYGCYELIDLFFLRG
Number of Associated Samples	129
Number of Associated Scaffolds	204

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	75.98 %
% of genes near scaffold ends (potentially truncated)	18.63 %
% of genes from short scaffolds (< 2000 bps)	76.47 %
Associated GOLD sequencing projects	118
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (70.098 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (20.588 % of family members)
Environment Ontology (ENVO)	Unclassified (61.275 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (60.784 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.52
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 204 Family Scaffolds
PF11753	DUF3310	55.39
PF07486	Hydrolase_2	12.25
PF09588	YqaJ	4.41
PF13482	RNase_H_2	2.94
PF06378	DUF1071	1.47
PF00959	Phage_lysozyme	0.98
PF08281	Sigma70_r4_2	0.98
PF05050	Methyltransf_21	0.98
PF08291	Peptidase_M15_3	0.49
PF00149	Metallophos	0.49
PF13463	HTH_27	0.49
PF05866	RusA	0.49
PF04404	ERF	0.49
PF01507	PAPS_reduct	0.49
PF02945	Endonuclease_7	0.49
PF07102	YbcO	0.49

COG ID	Name	Functional Category	% Frequency in 204 Family Scaffolds
COG3773	Cell wall hydrolase CwlJ, involved in spore germination	Cell cycle control, cell division, chromosome partitioning [D]	12.25
COG4570	Holliday junction resolvase RusA (prophage-encoded endonuclease)	Replication, recombination and repair [L]	0.49

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	88.24 %
Unclassified	root	N/A	11.76 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	85.78 %
Unclassified	root	N/A	11.76 %
cellular organisms	root	All Organisms → cellular organisms	2.45 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	70.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.20 %
Unclassified	root	N/A	11.76 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	2.45 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	70.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.20 %
Unclassified	root	N/A	11.76 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.49 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	70.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.20 %
Unclassified	root	N/A	11.76 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.49 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	70.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.20 %
Unclassified	root	N/A	11.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.49 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.98 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	40.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.20 %
Unclassified	root	N/A	11.76 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.49 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.98 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	40.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.20 %
Unclassified	root	N/A	11.76 %
Treboniaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae	0.49 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.98 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	40.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.20 %
Unclassified	root	N/A	11.76 %
Trebonia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia	0.49 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.98 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	40.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.20 %
Unclassified	root	N/A	11.76 %
Trebonia kvetii	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii	0.49 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.98 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002408\|B570J29032_109501239	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	815	Open in IMG/M
3300003277\|JGI25908J49247_10053592	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1048	Open in IMG/M
3300003852\|Ga0031655_10257291	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	655	Open in IMG/M
3300005527\|Ga0068876_10766614	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	511	Open in IMG/M
3300005528\|Ga0068872_10206008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1121	Open in IMG/M
3300005580\|Ga0049083_10058042	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1361	Open in IMG/M
3300005581\|Ga0049081_10013867	All Organisms → cellular organisms → Bacteria → Proteobacteria	3045	Open in IMG/M
3300005581\|Ga0049081_10048735	All Organisms → Viruses → Predicted Viral	1605	Open in IMG/M
3300005581\|Ga0049081_10133546	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	914	Open in IMG/M
3300005581\|Ga0049081_10298458	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	555	Open in IMG/M
3300005581\|Ga0049081_10346526	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	504	Open in IMG/M
3300005582\|Ga0049080_10041508	All Organisms → Viruses → Predicted Viral	1596	Open in IMG/M
3300005582\|Ga0049080_10309596	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	508	Open in IMG/M
3300005583\|Ga0049085_10020997	All Organisms → cellular organisms → Bacteria	2474	Open in IMG/M
3300005584\|Ga0049082_10077424	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1168	Open in IMG/M
3300005585\|Ga0049084_10246715	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	601	Open in IMG/M
3300005805\|Ga0079957_1022990	Not Available	4292	Open in IMG/M
3300005805\|Ga0079957_1036558	All Organisms → Viruses → Predicted Viral	3174	Open in IMG/M
3300005805\|Ga0079957_1183648	All Organisms → Viruses → Predicted Viral	1025	Open in IMG/M
3300006484\|Ga0070744_10120612	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300006805\|Ga0075464_10041396	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2510	Open in IMG/M
3300006805\|Ga0075464_10154031	All Organisms → Viruses → Predicted Viral	1351	Open in IMG/M
3300006805\|Ga0075464_10204071	All Organisms → Viruses → Predicted Viral	1175	Open in IMG/M
3300006805\|Ga0075464_10756422	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	603	Open in IMG/M
3300006875\|Ga0075473_10218247	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	771	Open in IMG/M
3300007544\|Ga0102861_1105421	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	754	Open in IMG/M
3300007622\|Ga0102863_1090852	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	897	Open in IMG/M
3300007622\|Ga0102863_1119870	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	773	Open in IMG/M
3300007972\|Ga0105745_1263290	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	556	Open in IMG/M
3300007973\|Ga0105746_1365981	Not Available	504	Open in IMG/M
3300008107\|Ga0114340_1023948	All Organisms → Viruses → Predicted Viral	2848	Open in IMG/M
3300008107\|Ga0114340_1075902	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1401	Open in IMG/M
3300008107\|Ga0114340_1076824	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1389	Open in IMG/M
3300008107\|Ga0114340_1112057	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1664	Open in IMG/M
3300008107\|Ga0114340_1163094	All Organisms → Viruses → Predicted Viral	1175	Open in IMG/M
3300008107\|Ga0114340_1242696	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	558	Open in IMG/M
3300008266\|Ga0114363_1103573	Not Available	1019	Open in IMG/M
3300008267\|Ga0114364_1112473	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	825	Open in IMG/M
3300008448\|Ga0114876_1068410	All Organisms → Viruses → Predicted Viral	1520	Open in IMG/M
3300008448\|Ga0114876_1147873	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	861	Open in IMG/M
3300008448\|Ga0114876_1195108	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	689	Open in IMG/M
3300008450\|Ga0114880_1129849	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	934	Open in IMG/M
3300008450\|Ga0114880_1179712	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	731	Open in IMG/M
3300009051\|Ga0102864_1159368	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	617	Open in IMG/M
3300009068\|Ga0114973_10249996	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	956	Open in IMG/M
3300009068\|Ga0114973_10704868	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	513	Open in IMG/M
3300009151\|Ga0114962_10073079	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2192	Open in IMG/M
3300009151\|Ga0114962_10152027	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1390	Open in IMG/M
3300009151\|Ga0114962_10182152	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1240	Open in IMG/M
3300009151\|Ga0114962_10237252	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1046	Open in IMG/M
3300009151\|Ga0114962_10370747	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	781	Open in IMG/M
3300009151\|Ga0114962_10656677	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	539	Open in IMG/M
3300009152\|Ga0114980_10588577	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	629	Open in IMG/M
3300009154\|Ga0114963_10375482	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	776	Open in IMG/M
3300009158\|Ga0114977_10085537	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1924	Open in IMG/M
3300009158\|Ga0114977_10673279	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	552	Open in IMG/M
3300009159\|Ga0114978_10347035	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	899	Open in IMG/M
3300009159\|Ga0114978_10472545	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	740	Open in IMG/M
3300009160\|Ga0114981_10214587	All Organisms → Viruses → Predicted Viral	1053	Open in IMG/M
3300009161\|Ga0114966_10373420	Not Available	842	Open in IMG/M
3300009164\|Ga0114975_10039955	All Organisms → Viruses → Predicted Viral	2787	Open in IMG/M
3300009165\|Ga0105102_10361318	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	764	Open in IMG/M
3300009180\|Ga0114979_10091602	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii	1882	Open in IMG/M
3300009182\|Ga0114959_10075529	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1889	Open in IMG/M
3300009183\|Ga0114974_10028139	All Organisms → Viruses → Predicted Viral	3908	Open in IMG/M
3300009183\|Ga0114974_10168610	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1357	Open in IMG/M
3300009185\|Ga0114971_10401610	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	778	Open in IMG/M
3300009185\|Ga0114971_10758992	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	527	Open in IMG/M
3300010158\|Ga0114960_10238091	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	934	Open in IMG/M
3300010370\|Ga0129336_10616826	Not Available	578	Open in IMG/M
3300011010\|Ga0139557_1030982	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	946	Open in IMG/M
3300011183\|Ga0136713_1005827	All Organisms → Viruses → Predicted Viral	1537	Open in IMG/M
3300012666\|Ga0157498_1030993	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	827	Open in IMG/M
3300013005\|Ga0164292_10251273	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1231	Open in IMG/M
3300013005\|Ga0164292_11032811	Not Available	512	Open in IMG/M
3300013372\|Ga0177922_10160344	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	614	Open in IMG/M
3300013372\|Ga0177922_10251642	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1167	Open in IMG/M
3300013372\|Ga0177922_10341094	Not Available	1105	Open in IMG/M
3300013372\|Ga0177922_10460713	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	612	Open in IMG/M
3300017716\|Ga0181350_1079583	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	830	Open in IMG/M
3300017722\|Ga0181347_1018583	All Organisms → cellular organisms → Bacteria → Proteobacteria	2205	Open in IMG/M
3300017723\|Ga0181362_1033347	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1094	Open in IMG/M
3300017736\|Ga0181365_1130050	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	602	Open in IMG/M
3300017736\|Ga0181365_1131452	Not Available	598	Open in IMG/M
3300017736\|Ga0181365_1143223	Not Available	568	Open in IMG/M
3300017754\|Ga0181344_1020235	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2071	Open in IMG/M
3300017754\|Ga0181344_1020502	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2056	Open in IMG/M
3300017754\|Ga0181344_1161327	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	638	Open in IMG/M
3300017761\|Ga0181356_1138064	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	764	Open in IMG/M
3300017774\|Ga0181358_1144275	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	818	Open in IMG/M
3300017774\|Ga0181358_1252431	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	554	Open in IMG/M
3300017777\|Ga0181357_1084471	All Organisms → Viruses → Predicted Viral	1214	Open in IMG/M
3300017785\|Ga0181355_1043971	All Organisms → Viruses → Predicted Viral	1909	Open in IMG/M
3300019784\|Ga0181359_1000522	All Organisms → Viruses	8718	Open in IMG/M
3300019784\|Ga0181359_1019169	All Organisms → Viruses → Predicted Viral	2575	Open in IMG/M
3300019784\|Ga0181359_1075845	Not Available	1268	Open in IMG/M
3300019784\|Ga0181359_1086871	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1164	Open in IMG/M
3300019784\|Ga0181359_1123053	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	925	Open in IMG/M
3300019784\|Ga0181359_1167434	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	738	Open in IMG/M
3300019784\|Ga0181359_1207017	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	627	Open in IMG/M
3300019784\|Ga0181359_1217081	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	604	Open in IMG/M
3300020048\|Ga0207193_1073310	All Organisms → Viruses → Predicted Viral	3326	Open in IMG/M
3300020141\|Ga0211732_1437961	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	540	Open in IMG/M
3300020160\|Ga0211733_11088956	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	977	Open in IMG/M
3300020161\|Ga0211726_10982241	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2803	Open in IMG/M
3300021354\|Ga0194047_10148071	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	960	Open in IMG/M
3300021962\|Ga0222713_10039035	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3732	Open in IMG/M
3300021962\|Ga0222713_10640255	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	614	Open in IMG/M
3300021963\|Ga0222712_10003957	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	15811	Open in IMG/M
3300021963\|Ga0222712_10116128	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1849	Open in IMG/M
3300022179\|Ga0181353_1100190	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	713	Open in IMG/M
3300022190\|Ga0181354_1132586	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	792	Open in IMG/M
3300022407\|Ga0181351_1088641	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1218	Open in IMG/M
3300022407\|Ga0181351_1108547	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1060	Open in IMG/M
3300022407\|Ga0181351_1269445	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	518	Open in IMG/M
3300023179\|Ga0214923_10594815	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	524	Open in IMG/M
3300023184\|Ga0214919_10055818	Not Available	3716	Open in IMG/M
3300024346\|Ga0244775_11390689	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	540	Open in IMG/M
3300024350\|Ga0255167_1009297	All Organisms → Viruses → Predicted Viral	2034	Open in IMG/M
3300024354\|Ga0255171_1062861	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	684	Open in IMG/M
3300025445\|Ga0208424_1000892	All Organisms → Viruses → Predicted Viral	3438	Open in IMG/M
3300025635\|Ga0208147_1023210	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1658	Open in IMG/M
3300027133\|Ga0255070_1061652	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	575	Open in IMG/M
3300027213\|Ga0208555_1023789	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	967	Open in IMG/M
3300027586\|Ga0208966_1173649	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	561	Open in IMG/M
3300027608\|Ga0208974_1000205	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	25931	Open in IMG/M
3300027608\|Ga0208974_1000811	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	12510	Open in IMG/M
3300027697\|Ga0209033_1021015	All Organisms → Viruses → Predicted Viral	2654	Open in IMG/M
3300027710\|Ga0209599_10014128	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2357	Open in IMG/M
3300027732\|Ga0209442_1007778	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5310	Open in IMG/M
3300027734\|Ga0209087_1182451	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	819	Open in IMG/M
3300027736\|Ga0209190_1000300	Not Available	35999	Open in IMG/M
3300027736\|Ga0209190_1071199	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1680	Open in IMG/M
3300027741\|Ga0209085_1163572	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	930	Open in IMG/M
3300027746\|Ga0209597_1005420	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	7745	Open in IMG/M
3300027749\|Ga0209084_1012652	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4953	Open in IMG/M
3300027749\|Ga0209084_1040915	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2299	Open in IMG/M
3300027749\|Ga0209084_1072768	Not Available	1578	Open in IMG/M
3300027754\|Ga0209596_1141913	All Organisms → Viruses → Predicted Viral	1079	Open in IMG/M
3300027759\|Ga0209296_1007473	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6804	Open in IMG/M
3300027759\|Ga0209296_1021475	All Organisms → Viruses → Predicted Viral	3675	Open in IMG/M
3300027759\|Ga0209296_1045171	All Organisms → Viruses → Predicted Viral	2333	Open in IMG/M
3300027763\|Ga0209088_10331211	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	608	Open in IMG/M
3300027764\|Ga0209134_10286517	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	561	Open in IMG/M
3300027782\|Ga0209500_10000528	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32997	Open in IMG/M
3300027782\|Ga0209500_10306944	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	670	Open in IMG/M
3300027896\|Ga0209777_10566557	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	827	Open in IMG/M
3300027971\|Ga0209401_1091502	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1273	Open in IMG/M
3300028025\|Ga0247723_1002497	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	9738	Open in IMG/M
3300028025\|Ga0247723_1004985	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6085	Open in IMG/M
3300028025\|Ga0247723_1008836	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4104	Open in IMG/M
3300028025\|Ga0247723_1022064	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2126	Open in IMG/M
3300028025\|Ga0247723_1090209	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	790	Open in IMG/M
3300028027\|Ga0247722_10001289	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	14038	Open in IMG/M
3300028393\|Ga0304728_1218769	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	652	Open in IMG/M
3300028394\|Ga0304730_1004719	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	8881	Open in IMG/M
3300031707\|Ga0315291_10016219	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	8945	Open in IMG/M
3300031707\|Ga0315291_10413363	Not Available	1279	Open in IMG/M
3300031746\|Ga0315293_10932083	Not Available	624	Open in IMG/M
3300031772\|Ga0315288_10157302	All Organisms → Viruses → Predicted Viral	2520	Open in IMG/M
3300031784\|Ga0315899_10664630	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	974	Open in IMG/M
3300031787\|Ga0315900_10433071	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1024	Open in IMG/M
3300031834\|Ga0315290_11328252	Not Available	591	Open in IMG/M
3300031857\|Ga0315909_10239549	Not Available	1402	Open in IMG/M
3300031857\|Ga0315909_10273101	All Organisms → Viruses → Predicted Viral	1282	Open in IMG/M
3300031885\|Ga0315285_10501846	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	832	Open in IMG/M
3300031885\|Ga0315285_10587115	Not Available	742	Open in IMG/M
3300031951\|Ga0315904_10388180	All Organisms → Viruses → Predicted Viral	1270	Open in IMG/M
3300031952\|Ga0315294_10443361	Not Available	1202	Open in IMG/M
3300031963\|Ga0315901_10075983	Not Available	3177	Open in IMG/M
3300031963\|Ga0315901_11157467	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	527	Open in IMG/M
3300031999\|Ga0315274_10251294	Not Available	2148	Open in IMG/M
3300031999\|Ga0315274_10475182	Not Available	1423	Open in IMG/M
3300031999\|Ga0315274_11609617	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	609	Open in IMG/M
3300031999\|Ga0315274_11865917	Not Available	547	Open in IMG/M
3300032046\|Ga0315289_10984439	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	711	Open in IMG/M
3300032053\|Ga0315284_11124637	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	871	Open in IMG/M
3300032053\|Ga0315284_11266550	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	803	Open in IMG/M
3300032053\|Ga0315284_12477782	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	506	Open in IMG/M
3300032093\|Ga0315902_10786718	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	755	Open in IMG/M
3300032118\|Ga0315277_11766981	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	515	Open in IMG/M
3300032516\|Ga0315273_10307188	All Organisms → Viruses → Predicted Viral	2152	Open in IMG/M
3300033233\|Ga0334722_11333320	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	501	Open in IMG/M
3300033981\|Ga0334982_0407237	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	617	Open in IMG/M
3300033993\|Ga0334994_0360843	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	715	Open in IMG/M
3300033994\|Ga0334996_0466798	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	574	Open in IMG/M
3300033996\|Ga0334979_0158049	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1365	Open in IMG/M
3300034012\|Ga0334986_0031202	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3519	Open in IMG/M
3300034012\|Ga0334986_0141801	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1395	Open in IMG/M
3300034012\|Ga0334986_0342509	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	778	Open in IMG/M
3300034061\|Ga0334987_0113037	All Organisms → Viruses → Predicted Viral	2061	Open in IMG/M
3300034062\|Ga0334995_0467595	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	768	Open in IMG/M
3300034073\|Ga0310130_0031997	All Organisms → Viruses → Predicted Viral	1617	Open in IMG/M
3300034073\|Ga0310130_0057537	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1158	Open in IMG/M
3300034101\|Ga0335027_0199219	Not Available	1424	Open in IMG/M
3300034101\|Ga0335027_0636622	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	643	Open in IMG/M
3300034102\|Ga0335029_0309712	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	992	Open in IMG/M
3300034102\|Ga0335029_0682719	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	560	Open in IMG/M
3300034104\|Ga0335031_0247117	All Organisms → Viruses → Predicted Viral	1184	Open in IMG/M
3300034106\|Ga0335036_0020660	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5291	Open in IMG/M
3300034106\|Ga0335036_0494997	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	763	Open in IMG/M
3300034116\|Ga0335068_0479222	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	580	Open in IMG/M
3300034118\|Ga0335053_0636917	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	609	Open in IMG/M
3300034283\|Ga0335007_0155519	All Organisms → Viruses → Predicted Viral	1632	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	95.59%
Terrestrial	Environmental → Terrestrial	4.41%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	85.29%
Marine	Environmental → Aquatic → Marine	10.29%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	4.41%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	53.92%
Lentic	Environmental → Aquatic → Freshwater → Lentic	24.51%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	4.41%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	4.41%
Coastal	Environmental → Aquatic → Marine → Coastal	4.90%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.94%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	2.45%
River	Environmental → Aquatic → Freshwater → River	1.47%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.49%
Ice	Environmental → Aquatic → Freshwater → Ice	0.49%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	44.12%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	23.53%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	9.80%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	4.41%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	4.41%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	4.90%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.94%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	2.45%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.47%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.98%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.49%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.49%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	20.59%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	16.18%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	11.27%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	9.31%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	6.86%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	3.92%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	3.92%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.43%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	3.43%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	2.94%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.45%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	2.45%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.96%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.47%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.47%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.98%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.98%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	0.98%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.98%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.49%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.49%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.49%
Freshwater, Surface Ice	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice	0.49%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.49%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.49%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.49%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.49%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.49%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003852	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006875	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA	Environmental	Open in IMG/M
3300007544	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3	Environmental	Open in IMG/M
3300007622	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02	Environmental	Open in IMG/M
3300007972	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um	Environmental	Open in IMG/M
3300007973	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300009051	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009154	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009182	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009185	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG	Environmental	Open in IMG/M
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental	Open in IMG/M
3300011183	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG	Environmental	Open in IMG/M
3300012666	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300021354	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024350	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d	Environmental	Open in IMG/M
3300024354	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d	Environmental	Open in IMG/M
3300025445	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025635	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027133	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h	Environmental	Open in IMG/M
3300027213	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes)	Environmental	Open in IMG/M
3300027586	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027697	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027741	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027746	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027764	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027896	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)	Environmental	Open in IMG/M
3300027971	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028027	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC	Environmental	Open in IMG/M
3300028393	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031707	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20	Environmental	Open in IMG/M
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental	Open in IMG/M
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032046	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032093	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117	Environmental	Open in IMG/M
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M
3300034118	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J29032_1095012394	3300002408	Freshwater	MARAEKILDVIVWLLILGSMGWLAYGCYILIDLFFLRG*
JGI25908J49247_100535925	3300003277	Freshwater Lake	ICICNCRKGVWQMARAEKILEVVVWLLIIGGMGWFFYGCYELIDLFFLRG*
Ga0031655_102572912	3300003852	Freshwater Lake Sediment	MGFLEKVIDWIVWALIIGGIGWLAFGCYTLIDLFFIRKCIW*
Ga0068876_107666141	3300005527	Freshwater Lake	AEKILEVVVWLLIVGGMGWFFYGCYQLIDLFFIRG*
Ga0068872_102060083	3300005528	Freshwater Lake	MGRAEKVLDVVVWLLIVGGMGWFAYGCYELIDLFFLRG*
Ga0049083_100580424	3300005580	Freshwater Lentic	MKLAEKIIDVIVWLLIIGSMGWLAYGCYILIDLFFIRG*
Ga0049081_100138677	3300005581	Freshwater Lentic	MSLLEKIVDVIVWLLIIGSMGWLAYGCYILIDLFFIRG*
Ga0049081_100487356	3300005581	Freshwater Lentic	MGRAEKILDVIVWLLVVGGMGWFAYGCYQLIDLFFLRG*
Ga0049081_101335462	3300005581	Freshwater Lentic	MDLAEKVIDWIVWGLIIGGMGWFFYGCYQLIDLFFLRR*
Ga0049081_102984583	3300005581	Freshwater Lentic	MGRAEKILDVVVWLLIVGGMGWFFYGCYELIDLFFLRG*
Ga0049081_103465262	3300005581	Freshwater Lentic	MARAEKILEVVVWLLIVGGMGWFAYGCYELIDLFFLRG*
Ga0049080_100415082	3300005582	Freshwater Lentic	MDFLEKVIDWIVWGLVVGGMGWFAYGCYQLIDLFFLRR*
Ga0049080_103095962	3300005582	Freshwater Lentic	MDLAEKILNVVVWLLIVGGMGWFAYGCYELINLFFLRG*
Ga0049085_100209972	3300005583	Freshwater Lentic	MQKLLDVTVWLLVVGSMGWLAYGCYALINLFFIRG*
Ga0049082_100774245	3300005584	Freshwater Lentic	MGRAEKILDVVVWLLIVSGIGWFFYGCYQLIDLFFIRG*
Ga0049084_102467152	3300005585	Freshwater Lentic	MQKLLDVTVWFLVLGTMGWFAYGCYALINLFFIRG*
Ga0079957_102299013	3300005805	Lake	MARAEKILEVVVWLLIVGGMGWFFYGCYQLIDLFFIRG*
Ga0079957_10365588	3300005805	Lake	MDLAEKILDIIVWLLVVGGMCWFAYGCYQLIDLFFIRG*
Ga0079957_11836483	3300005805	Lake	MDLAEKILDVIVWLLIIGGMGWFAYGCYQLIDLFFLRG*
Ga0070744_101206122	3300006484	Estuarine	MEQIEKILDVIVWLLVIGGMGWFAYGCYALIDLFFIRG*
Ga0075464_100413966	3300006805	Aqueous	MQRILDVIVWLLVIGGMGWFAYGCYALIDLFFIRG*
Ga0075464_101540315	3300006805	Aqueous	MDLAEKILDVIVWLLVVGGMCWFAYGCYQLIDLFFL
Ga0075464_102040712	3300006805	Aqueous	MGRAEKILDVVVWLLIVGGIGWLFYGCYQLIDLFFLRG*
Ga0075464_107564223	3300006805	Aqueous	MGRAEKILEVIVWLLIVGGMGWFAYGCYELIDLFFLRG*
Ga0075473_102182471	3300006875	Aqueous	MARAEKILEVVVWLLIVGGMGWFFYGCYQLIDLFF
Ga0102861_11054211	3300007544	Estuarine	MDLAEKVIDWIVWGLIIGGMGWFFYGCYQLIDLFFL
Ga0102863_10908522	3300007622	Estuarine	MGRAEKILDVVVWLLIVGGMGWFAYGCYELIDLFFLRG*
Ga0102863_11198702	3300007622	Estuarine	MDLAEKVIDWIVWGLIIGGMGWFFYGCYQLIDLFYLRG*
Ga0105745_12632904	3300007972	Estuary Water	MDRILKVIDVIVWLLIIGGIGWFFYGCYQLIDLFFI
Ga0105746_13659811	3300007973	Estuary Water	MGRAEKILDIIVWLLIVGGIGWFAYGCYELIDLFFIRG*
Ga0114340_10239487	3300008107	Freshwater, Plankton	MAILEKIIDWIVWGLIIGGMGWFFYGCYQLIDLFFIRG*
Ga0114340_10759026	3300008107	Freshwater, Plankton	MARAEKILEVVVWLLIVGGMGWFFYGCYQLIDLFFLRG*
Ga0114340_10768242	3300008107	Freshwater, Plankton	MAILEKIIDYIVWILIIGGMMWFAYGCYEVIDLFFIRG*
Ga0114340_11120574	3300008107	Freshwater, Plankton	MDLAEKVIDWIVWGLIISGMGWFFYGCYQLIDLFFIRG*
Ga0114340_11630941	3300008107	Freshwater, Plankton	MGRAEKILEVVVWLLIVGGMGWFFYGCYQLIDLFFIRG*
Ga0114340_12426962	3300008107	Freshwater, Plankton	MDLAEKILDVVVWLLIVGGIGWFAYGCYQLIDLFFLRG*
Ga0114363_11035735	3300008266	Freshwater, Plankton	MARAEKILEVVVWLLIIGGMGWFFYGCYELIDLFFLRG*
Ga0114364_11124733	3300008267	Freshwater, Plankton	MDILEKILDWIVWGLIISGMIWFFVGCYTLIDLFFLRG*
Ga0114876_10684103	3300008448	Freshwater Lake	MDLAEKILDVVVWLLIVGGMGWFAYGCYELIDLFFLRG*
Ga0114876_11478735	3300008448	Freshwater Lake	VWKMGRAEKILDVVVWLLIVSGIGWFFYGCYQLIDLFFIRG*
Ga0114876_11951084	3300008448	Freshwater Lake	MDLAEKILDVIVWLLIVGGMGWFAYGCYELIDLFFLRG*
Ga0114880_11298494	3300008450	Freshwater Lake	MELAEKIIDYIVWILIIGGMMWFAYGCYEVIDLFFIRG*
Ga0114880_11797123	3300008450	Freshwater Lake	MARAEKILEVVVWLLIVGGIGWFAYGCYELIDLFFLRG*
Ga0102864_11593681	3300009051	Estuarine	MAILEKIIDWIVWILIVGGISWFAYGCYQLIDLFFIRG
Ga0114973_102499965	3300009068	Freshwater Lake	MDLAEKILDIVIWMLIVGGMFWFAYGCYELVDLFFIRG*
Ga0114973_107048682	3300009068	Freshwater Lake	MDLAEKILDIVVWLLIVGGMGWFAYGCYELIDLFFLRG*
Ga0114962_100730793	3300009151	Freshwater Lake	MDILEKLVDWVVWALIISGMAWLAFGCYTLIDLFFIRG*
Ga0114962_101520272	3300009151	Freshwater Lake	MDFLEKLVDWIVWGLIVGGMAWLAFGCYTLIDLFFIRG*
Ga0114962_101821524	3300009151	Freshwater Lake	MDFLEKLVDWVVWGLIIGGMSWLAFGCYTLIDLFFIRG*
Ga0114962_102372521	3300009151	Freshwater Lake	MDFLKKVVDWVVWGLIIGGIGWLAFGCYTLIDLFFIRG*
Ga0114962_103707471	3300009151	Freshwater Lake	MDFLEKLVDWIVWALIIGGMGWLAFGCYTLIDLFFIRG*
Ga0114962_106566773	3300009151	Freshwater Lake	MDILEKLVDWVVWGLIIGGMGWLAFGCYTLIDLFFIRG*
Ga0114980_105885772	3300009152	Freshwater Lake	MDLAEKILDIVIWLLIVGGMFWFAYGCYELVDLFYLRG*
Ga0114963_103754821	3300009154	Freshwater Lake	MDILEKLVDWVVWGLIIGGMGWLAFGCYTLIDLFFI
Ga0114977_100855374	3300009158	Freshwater Lake	MQTIEKVIDWIVWALIIISMGSFFYGIYQLIDLFFIRR*
Ga0114977_106732792	3300009158	Freshwater Lake	MERIEKILDVIVWLLVIGGMGWFAYGCYALIDLFFIRG*
Ga0114978_103470352	3300009159	Freshwater Lake	MDRVLKVIDVVVWLLIIGGMFWFAYGCYELIDLFYLRG*
Ga0114978_104725452	3300009159	Freshwater Lake	MDLAEKILDIVIWLLIVGGMFWFAYGCYQLIDLFFIRG*
Ga0114981_102145872	3300009160	Freshwater Lake	MQKILDVIVWLLVIGSMGWFAYGCYALIDLFFIRG*
Ga0114966_103734201	3300009161	Freshwater Lake	MKLAEKIIDVIVWLLVVGSMGWLAYGCYILIDLFFIRG*
Ga0114975_100399554	3300009164	Freshwater Lake	MDLAEKILDIVIWMLIVGGMFWFAYGCYQLIDLFFIRG*
Ga0105102_103613182	3300009165	Freshwater Sediment	MGRAEKILDVIVWLLIVGGMGWFAYGCYELIDLFFLRG*
Ga0114979_100916022	3300009180	Freshwater Lake	MQKILDVIVWLLVVGSMGWFAYGCYALIDLFFIRG*
Ga0114959_100755292	3300009182	Freshwater Lake	MDILEKLVDWVVWGLIIGGIGWLAFGCYTLIDLFFIRG*
Ga0114974_1002813911	3300009183	Freshwater Lake	MDLGEKILDIVIWLLIVSGIGWFAYGCYELIDLFFLRG*
Ga0114974_101686101	3300009183	Freshwater Lake	MARAEKILEVVVWLLILGGMGWFFYGCYQLIDLFFIRG*
Ga0114971_104016101	3300009185	Freshwater Lake	AIIMERIEKILDVIVWLLVIGSMGWFAYGCYALINLFFIRG*
Ga0114971_107589923	3300009185	Freshwater Lake	MDLAEKILDIVVWLLIVGGMFWFAYGCYELVDLFFIRG
Ga0114960_102380911	3300010158	Freshwater Lake	LCLHLMENVMDFLEKLVDWVVWGLIIGGMVWLAFGCYTLIDLFFIRG*
Ga0129336_106168262	3300010370	Freshwater To Marine Saline Gradient	MEILEKVIDWIVWILIVGGMGWFAYGCYELIDLFFMRR*
Ga0139557_10309822	3300011010	Freshwater	MQRILDVIVWLLVVGSMGWFAYGCYALINLFFIRG*
Ga0136713_10058273	3300011183	Freshwater	MARAEKILDVIVWLLVVGGMGWFAYGCYQLIDLFFLRG*
Ga0157498_10309933	3300012666	Freshwater, Surface Ice	MARAEKILDVVVWLLIVGGMGWFFYGCYELIDLFFLRG*
Ga0164292_102512732	3300013005	Freshwater	MGRAEKILDVIVWLLIIGGMGWFFYGCYQLIDLFFIRG*
Ga0164292_110328111	3300013005	Freshwater	MARAEKILEVVVWLLIVGGMGWFFYGCYELIDLFFLRG*
Ga0177922_101603442	3300013372	Freshwater	MDRILKVIDWIVWGLVIGGMIWFFYGCYQLIDLFFLRG*
Ga0177922_102516421	3300013372	Freshwater	VWQMARAEKILEVIVWLLIVGGMGWFFYGCYQLIDLFFLRG*
Ga0177922_103410944	3300013372	Freshwater	ILKVIDWIVWGLIVGSIGWFFYGCYQLINLFFMEG*
Ga0177922_104607131	3300013372	Freshwater	MAILEKIIDWIVWLLIVGGMGWFFYGCYQLIDLFFLRR*
Ga0181350_10795832	3300017716	Freshwater Lake	MDRILKVIDWIVWGLVIGGIGWFVYGCYQLIDLFFLRG
Ga0181347_10185836	3300017722	Freshwater Lake	MKLAEKIVDVIVWLLVVGSMGWLAYGCYILIDLFFIRG
Ga0181362_10333475	3300017723	Freshwater Lake	MQKLLDVTVWLLVLGTMGWFAYGCYALINLFFIRG
Ga0181365_11300501	3300017736	Freshwater Lake	NCRKGVWQMARAEKILEVVVWLLIIGGMGWFFYGCYELIDLFFLRG
Ga0181365_11314523	3300017736	Freshwater Lake	MQRILDVIVWLLVVGSMGWFAYGCYALINLFFIRG
Ga0181365_11432233	3300017736	Freshwater Lake	ARAEKILEVVVWLLIIGGMGWFFYGCYELIDLFFLRG
Ga0181344_10202353	3300017754	Freshwater Lake	MDILEKVIDWIVWGLIISGMIWFFVGCYTLIDLFFLRG
Ga0181344_10205023	3300017754	Freshwater Lake	MDILEKVIDWIVWGLIISGMLWFFIGCYTLIDLFFLRG
Ga0181344_11613273	3300017754	Freshwater Lake	MDLLEKVIDWIVWGLIISGMIWFFVGCYTLIDLFFLR
Ga0181356_11380643	3300017761	Freshwater Lake	MQKILDITVWFLVLGTMGWFAYGCYALIDLFFIRG
Ga0181358_11442754	3300017774	Freshwater Lake	MQKLLDVTVWLLVLGTMGWLAYGCYALINLFFIRG
Ga0181358_12524313	3300017774	Freshwater Lake	MDLAEKVIDWIVWGLIIGGMGWFFYGCYQLIDLFFLR
Ga0181357_10844715	3300017777	Freshwater Lake	MGRAEKILDVIVWLLVVGGMGWFAYGCYELIDLFFLRG
Ga0181355_10439711	3300017785	Freshwater Lake	MGRAEKILDVVVWLLIVSGIGWFFYGCYQLIDLFFIR
Ga0181359_100052225	3300019784	Freshwater Lake	MAILEKVIDWIVWLLIVGGMGWFAYGCYQLIDLFFLRR
Ga0181359_10191692	3300019784	Freshwater Lake	MGRAEKILDVVVWLLIVSGIGWFFYGCYQLIDLFFIRG
Ga0181359_10758452	3300019784	Freshwater Lake	MKLAEKIIDVIVWLLIIGSMGWLAYGCYILIDLFFIRG
Ga0181359_10868711	3300019784	Freshwater Lake	AEKILEVVVWLLIVGGMGWFFYGCYELIDLFFLRG
Ga0181359_11230534	3300019784	Freshwater Lake	MGRAEKILDVVVWLLIVGGMGWFFYGCYELIDLFFLRG
Ga0181359_11674342	3300019784	Freshwater Lake	MGRAEKILDVVVWLLIVGGIGWFAYGCYELIDLFFIRG
Ga0181359_12070174	3300019784	Freshwater Lake	MDLAEKVIDWIVWGLIIGGMGWFFYGCYQLIDLFFLRR
Ga0181359_12170811	3300019784	Freshwater Lake	RKGVWQMARAEKILEVVVWLLIIGGMGWFFYGCYELINLFFLRG
Ga0207193_10733104	3300020048	Freshwater Lake Sediment	MARAEKILEVVVWLLIVGGMGWFFYGCYQLIDLFFIRG
Ga0211732_14379613	3300020141	Freshwater	MGRTEKILEVIVWLLIVGGMGWFAYGCYELIDLFFLRG
Ga0211733_110889564	3300020160	Freshwater	MGRAEKILEVVVWLLIVGGMGWFAYGCYELIDLFFLRG
Ga0211726_109822417	3300020161	Freshwater	MGRAEKILDVVVWLLIVGGMGWFAYGCYELIDLFFLRG
Ga0194047_101480713	3300021354	Anoxic Zone Freshwater	MDFLEKLVDWVVWGLIIGGMGWLAFGCYTLIDLFFIRR
Ga0222713_100390356	3300021962	Estuarine Water	MEQIEKILDVIVWLLAIGGMGWFAYGCYALIDLFFIRG
Ga0222713_106402552	3300021962	Estuarine Water	MDLAEKILNVVVWLLIVGGMGWFVYGCYELIDLFFLRR
Ga0222712_1000395713	3300021963	Estuarine Water	MEILEKVIDWIVWILIVGGMGWFAYGCYELIDLFFMRR
Ga0222712_101161284	3300021963	Estuarine Water	MGRAEKILDVIVWLLIVGGMGWFAYGCYELIDLFFLRG
Ga0181353_11001902	3300022179	Freshwater Lake	MDLAEKILDVVVWLLIVGGIGWFAYGCYQLIDLFFLRG
Ga0181354_11325863	3300022190	Freshwater Lake	CRKGVWQMARAEKILEVVVWLLIIGGMGWFFYGCYQLIDLFFIRG
Ga0181351_10886415	3300022407	Freshwater Lake	EICICNCRKGVWQMARAEKILEVVVWLLIIGGMGWFFYGCYELINLFFLRG
Ga0181351_11085471	3300022407	Freshwater Lake	MGRAEKILEVVVWLLIVGGMGWFFYGCYELIDLFFLRG
Ga0181351_12694453	3300022407	Freshwater Lake	ARAEKILEVIVWLLIVGGMGWFFYGCYQLIDLFFIRG
Ga0214923_105948152	3300023179	Freshwater	MQKILDVMVWLLVIGSMGWFAYGCYALIDLFFIRG
Ga0214919_1005581811	3300023184	Freshwater	MQTIEKVIDWIVWALIIISMGSFFYGIYQLIDLFFIRR
Ga0244775_113906892	3300024346	Estuarine	MEQIEKILDVIVWLLVIGGMGWFAYGCYALIDLFFIRG
Ga0255167_10092973	3300024350	Freshwater	MDFLEKMLDCVVWLLIVSGMLWFAYGCYELINLFFWR
Ga0255171_10628611	3300024354	Freshwater	MGKEMDFLEKMLDCVVWLLIVSGMLWFAYGCYELINLFFWR
Ga0208424_10008928	3300025445	Aqueous	MGRAEKILEVIVWLLIVGGMGWFAYGCYELIDLFFLRG
Ga0208147_10232106	3300025635	Aqueous	MGRAEKILDVIVWLLVVGGMGWFAYGCYQLIDLFFLRG
Ga0255070_10616522	3300027133	Freshwater	MDLAEKVIDWIVWGLIIGGMGWFFYGCYQLIDLFYLRG
Ga0208555_10237892	3300027213	Estuarine	MDLAEKVIDWIVWGLIIGGMGWFFYGCYQLIDLFFIRG
Ga0208966_11736492	3300027586	Freshwater Lentic	MARAEKILEVVVWLLIVGGMGWFFYGCYELIDLFFLRG
Ga0208974_100020521	3300027608	Freshwater Lentic	MDRILKVIDWIVWGLIVGSIGWFFYGCYQLINLFFMKG
Ga0208974_100081131	3300027608	Freshwater Lentic	MDFLEKVIDWIVWGLVVGGMGWFAYGCYQLIDLFFLRR
Ga0209033_10210156	3300027697	Freshwater Lake	MARAEKILEVIVWLLIVGGISWLFYGCYKLIDLFFLRG
Ga0209599_100141286	3300027710	Deep Subsurface	MGRAEKVLDVVVWLLIVGGMGWFAYGCYELIDLFFLRG
Ga0209442_10077781	3300027732	Freshwater Lake	MDRILKVIDCIVWGLVIGGMGWFFYGCYQLIDLFFIRG
Ga0209087_11824512	3300027734	Freshwater Lake	MDLAEKILDIVIWMLIVGGMFWFAYGCYQLIDLFFIRG
Ga0209190_100030017	3300027736	Freshwater Lake	MSFIKLVEKIVDVIVWLLVISSMIWLAYGCYILIDLFFIRGN
Ga0209190_10711992	3300027736	Freshwater Lake	MQKILDVIVWLLVVGSMGWFAYGCYALIDLFFIRG
Ga0209085_11635723	3300027741	Freshwater Lake	MDILEKLVDWIVWGLIVGGMAWLAFGCYTLIDLFFIRG
Ga0209597_100542012	3300027746	Freshwater Lake	MDILEKLVDWVVWALIISGMAWLAFGCYTLIDLFFIRG
Ga0209084_10126528	3300027749	Freshwater Lake	MDFLEKLVDWIVWGLIVGGMAWLAFGCYTLIDLFFIRG
Ga0209084_10409151	3300027749	Freshwater Lake	MDFLEKLVDWIVWGLIIGGMGWLAFGCYTLINLFFIRG
Ga0209084_10727684	3300027749	Freshwater Lake	MDFLEKVVDWVVWGLIIGGMAWLAFGCYTLIDLFFIRG
Ga0209596_11419131	3300027754	Freshwater Lake	MERIEKILDVIVWLLVIGSMGWFAYGCYALINLFFIRG
Ga0209296_10074734	3300027759	Freshwater Lake	MDFLEKVVDWIVWGLIISGIMWFVFGCYTLIDLFFIRG
Ga0209296_10214754	3300027759	Freshwater Lake	MDLGEKILDIVIWLLIVSGIGWFAYGCYELIDLFFLRG
Ga0209296_10451712	3300027759	Freshwater Lake	MARAEKILEVVVWLLIVGGMGWFFYGCYQLIDLFFLRG
Ga0209088_103312111	3300027763	Freshwater Lake	MARAEKILDVIVWLLILGGMGWFFYGCYQLIDLFFLRG
Ga0209134_102865172	3300027764	Freshwater Lake	MDILEKVIDWIVWGLIISGMIWFFVGCYTLIDLFFIRG
Ga0209500_1000052852	3300027782	Freshwater Lake	MDFLEKLVDWIVWGLIIGGMGWLAFGCYTLIDLFFIRG
Ga0209500_103069442	3300027782	Freshwater Lake	MDLAEKILDIVIWLLIVGGMFWFAYGCYQLIDLFFIRG
Ga0209777_105665572	3300027896	Freshwater Lake Sediment	MGFLEKVIDWIVWALIIGGIGWLAFGCYTLIDLFFIRKCIW
Ga0209401_10915023	3300027971	Freshwater Lake	MDLAEKILDIVIWMLIISGMFWFAYGCYELVDLFFIRG
Ga0247723_10024974	3300028025	Deep Subsurface Sediment	MGRAEKILEVVVWFLIVSGIGWFFYGCYQLIDLFFLRG
Ga0247723_10049858	3300028025	Deep Subsurface Sediment	MGRAEKILEVVVWLLIIGGMGWFFYGCYELIDLFFLRG
Ga0247723_10088367	3300028025	Deep Subsurface Sediment	MGRAEKILDVVVWLLVIGSILGFAYGTYELIDLFFIRG
Ga0247723_10220644	3300028025	Deep Subsurface Sediment	MDILEKIIDWIVWGLIISGMIWFFVGCYTLIDLFFLRG
Ga0247723_10902094	3300028025	Deep Subsurface Sediment	MGRAEKVLDVVVWLLIVGGMGWFFYGCYQLIDLFFLRG
Ga0247722_1000128922	3300028027	Deep Subsurface Sediment	ICICNCRKGVWQMARAEKILEVVVWLLIIGGMGWFFYGCYQLIDLFFIRG
Ga0304728_12187691	3300028393	Freshwater Lake	MENVMDFLEKLVDWVVWGLIIGGMSWLAFGCYTLIDLFFIRG
Ga0304730_100471923	3300028394	Freshwater Lake	MDFLEKLVDWIVWGLIIGGIGWLAFGCYTLIDLFFIRG
Ga0315291_100162194	3300031707	Sediment	LLLKKMSLLEKIVDVIVWLLVVGSMGWFAYGCYTLIDLFFIRGQ
Ga0315291_104133634	3300031707	Sediment	MQKILDIIVWLLVVGSMGWLAYGCYALIDLFFIRG
Ga0315293_109320833	3300031746	Sediment	AIIMERIEKILDVIVWLLVIGSMGWFAYGCYALIDLFFIKG
Ga0315288_1015730210	3300031772	Sediment	MERIEKILDVIVWLLVIGSMIWFAYGCYALIDLFFIRG
Ga0315899_106646304	3300031784	Freshwater	RAEKILEVVVWLLIVGGMGWFFYGCYQLIDLFFIRG
Ga0315900_104330716	3300031787	Freshwater	MDFLEKVIDWIVWGLVVGGMGWFAYGCYQLIDLFFL
Ga0315290_113282521	3300031834	Sediment	MERIEKILDVIVWLLVIGSMGWFAYGCYALIDLFFIRG
Ga0315909_102395495	3300031857	Freshwater	MELAEKIIDYIVWILIIGGMMWFAYGCYEVIDLFFIRG
Ga0315909_102731015	3300031857	Freshwater	MGRAEKILDVVVWLLIVGGMGWFAYGCYELIDLFF
Ga0315285_105018464	3300031885	Sediment	MDRILKVIDWIVWGLVIGGMGWFFYGCYQLIDLFFLRR
Ga0315285_105871153	3300031885	Sediment	MKLTEKIINVIILTLIVGSMGWLVYGCYSLIDLFFIR
Ga0315904_103881806	3300031951	Freshwater	MGRAEKVLDVVVWLLIVGGMGWFAYGCYELIDLFFLR
Ga0315294_104433615	3300031952	Sediment	MERIEKILDVIVWLLVIGSMGWFAYGCYALIDLFFIKG
Ga0315901_100759839	3300031963	Freshwater	MAILEKIIDYIVWILIIGGMMWFAYGCYEVIDLFFIRG
Ga0315901_111574672	3300031963	Freshwater	MDLAEKILDVVVWLLIVGGMGWFAYGCYELIDLFFLRG
Ga0315274_102512942	3300031999	Sediment	LLLKEMTLLEKILDIIVWLLVVGSMGWFAYGCYTLIDLFFIRGQ
Ga0315274_104751822	3300031999	Sediment	MKLAEKIVDIIVWLLVVGSMGWLAYGCYALIDLFFIRG
Ga0315274_116096171	3300031999	Sediment	MDRILKVIDWIVWGLVIGGMGWFFYGCYQLIDLFYLRR
Ga0315274_118659172	3300031999	Sediment	MQKILDVTVWLLVLGTMGWFAYGCYALIDLFFIRG
Ga0315289_109844393	3300032046	Sediment	MDRILKVIDWIVWGLIIGSIGWLVYGCYQLIDLFFLRG
Ga0315284_111246373	3300032053	Sediment	MKLAEKIVDIIVWLLVVGSMGWLAYGCYILIDLFFIRG
Ga0315284_112665504	3300032053	Sediment	MDRILKVIDWIVWGLVIGGMGWFFYGCYQLIDLFFIRG
Ga0315284_124777821	3300032053	Sediment	MDRILKVIDWIVWGLIIGGMGWFFYGCYQLIDLFFIRG
Ga0315902_107867183	3300032093	Freshwater	MARAEKILEVVVWLLIIGGMGWFFYGCYELIDLFFLRG
Ga0315277_117669813	3300032118	Sediment	MDRILKVIDWIVWGLIVGGMGWFFYGCYQLIDLFYLRG
Ga0315273_103071885	3300032516	Sediment	MERIEKILDVTVWLLVLGTMGWFAYGCYALINLFFIRG
Ga0334722_113333203	3300033233	Sediment	MERIEKILDVIVWLLVIGSMIWFAYGCYALIDLFFIR
Ga0334982_0407237_214_330	3300033981	Freshwater	MGRAEKILEVIVWLLIVGGMGWFAYGCYQLIDLFFLRG
Ga0334994_0360843_391_507	3300033993	Freshwater	MARAEKILEVVVWLLIIGGMGWFFYGCYQLIDLFFIRG
Ga0334996_0466798_401_517	3300033994	Freshwater	MAILEKIIDWIVWILIIGGISWFFYGCYQLIDLFYLRG
Ga0334979_0158049_895_1011	3300033996	Freshwater	MGRAEKILDVIVWLLIIGGMGWFFYGCYQLIDLFFIRG
Ga0334986_0031202_3144_3260	3300034012	Freshwater	MARAEKILDVIVWLLIVGGIGWFFYGCYQLIDLFFLRG
Ga0334986_0141801_1094_1210	3300034012	Freshwater	MARAEKILDVVVWLLILGSMGWLAYGCYILIDLFFLRG
Ga0334986_0342509_449_565	3300034012	Freshwater	MGRAEKILEVVVWMLIVGGMGWFVYGCYELIDLFFLRG
Ga0334987_0113037_380_496	3300034061	Freshwater	MARAEKILNVVVWLLIVGGMGWFAYGCYELINLFFLRG
Ga0334995_0467595_54_170	3300034062	Freshwater	MGRTEKILDVIVWLLIVGGMGWFAYGCYELIDLFFLRG
Ga0310130_0031997_974_1090	3300034073	Fracking Water	MARAEKILEVVVWLLIVGGIGWFAYGCYELIDLFFIRG
Ga0310130_0057537_957_1073	3300034073	Fracking Water	MDLAEKILDVVVWLLIVGGIGWFFYGCYQLIDLFFLRG
Ga0335027_0199219_718_834	3300034101	Freshwater	MAILEKIIDWIVWILIVGGMGWFAYGCYELIDLFFMRR
Ga0335027_0636622_531_641	3300034101	Freshwater	MARAEKILEVVVWLLIVGGMGWFFYGCYQLIDLFFLR
Ga0335029_0309712_149_265	3300034102	Freshwater	MEILEKVIDWIVWILIVGGIGWFAYGCYELIDLFFMRR
Ga0335029_0682719_368_484	3300034102	Freshwater	MDLAEKILDVVVWLLIVGGMGWFFYGCYELINLFFLRG
Ga0335031_0247117_247_363	3300034104	Freshwater	MGRAEKILDVVVWLLIVGGMGWFAYGCYELIDLFFIRG
Ga0335036_0020660_4296_4412	3300034106	Freshwater	MGRAEKILEVVVWLLIVGGMGWFFYGCYQLIDLFFIRG
Ga0335036_0494997_463_579	3300034106	Freshwater	MARAEKILEVIVWLLIVSGIGWFFYGCYQLIDLFFLRG
Ga0335068_0479222_95_211	3300034116	Freshwater	MGRAEKILDVIVWLLIVGGIGWFAYGCYELIDLFFIRG
Ga0335053_0636917_501_608	3300034118	Freshwater	AEKILEVVVWFLIIGGMGWFFYGCYQLIDLFFLRG
Ga0335007_0155519_969_1085	3300034283	Freshwater	MDLAEKILDVVVWLLIVGGIGWFAYGCYELINLFFIRG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F024784

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences