Basic Information | |
---|---|
Family ID | F024884 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 204 |
Average Sequence Length | 41 residues |
Representative Sequence | NTGIDPKKTLKKAIVIGPKDSVAILILKKADAHIKAKITNKV |
Number of Associated Samples | 159 |
Number of Associated Scaffolds | 204 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.04 % |
% of genes from short scaffolds (< 2000 bps) | 93.14 % |
Associated GOLD sequencing projects | 147 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (61.765 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (29.412 % of family members) |
Environment Ontology (ENVO) | Unclassified (69.608 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.784 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 204 Family Scaffolds |
---|---|---|
PF04073 | tRNA_edit | 78.92 |
PF03951 | Gln-synt_N | 14.71 |
PF00266 | Aminotran_5 | 1.47 |
PF01521 | Fe-S_biosyn | 0.98 |
PF00892 | EamA | 0.98 |
PF02687 | FtsX | 0.49 |
PF16124 | RecQ_Zn_bind | 0.49 |
PF01883 | FeS_assembly_P | 0.49 |
PF01256 | Carb_kinase | 0.49 |
COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
---|---|---|---|
COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 14.71 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.98 |
COG0063 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domain | Nucleotide transport and metabolism [F] | 0.49 |
COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 61.76 % |
All Organisms | root | All Organisms | 38.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000149|LPaug09P1610mDRAFT_c1018735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 869 | Open in IMG/M |
3300000219|LPfeb10P161000mDRAFT_c1011082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1889 | Open in IMG/M |
3300000929|NpDRAFT_10099960 | Not Available | 666 | Open in IMG/M |
3300000973|BBAY93_10195403 | Not Available | 506 | Open in IMG/M |
3300001346|JGI20151J14362_10161972 | Not Available | 655 | Open in IMG/M |
3300001354|JGI20155J14468_10130312 | Not Available | 833 | Open in IMG/M |
3300001966|GOS2245_1014191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1109 | Open in IMG/M |
3300001966|GOS2245_1091321 | Not Available | 829 | Open in IMG/M |
3300001967|GOS2242_1045756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1363 | Open in IMG/M |
3300001971|GOS2215_10074226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2034 | Open in IMG/M |
3300002040|GOScombined01_101741606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2135 | Open in IMG/M |
3300002186|JGI24539J26755_10089433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 898 | Open in IMG/M |
3300003477|nap3_10105370 | Not Available | 670 | Open in IMG/M |
3300003501|JGI26243J51142_1008392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2985 | Open in IMG/M |
3300003620|JGI26273J51734_10126700 | Not Available | 686 | Open in IMG/M |
3300005239|Ga0073579_1084405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
3300005404|Ga0066856_10336005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 649 | Open in IMG/M |
3300005430|Ga0066849_10230273 | Not Available | 716 | Open in IMG/M |
3300005514|Ga0066866_10245010 | Not Available | 620 | Open in IMG/M |
3300005522|Ga0066861_10170500 | Not Available | 749 | Open in IMG/M |
3300005606|Ga0066835_10166787 | Not Available | 734 | Open in IMG/M |
3300005837|Ga0078893_10363473 | Not Available | 638 | Open in IMG/M |
3300006166|Ga0066836_10556254 | Not Available | 694 | Open in IMG/M |
3300006191|Ga0075447_10271159 | Not Available | 547 | Open in IMG/M |
3300006345|Ga0099693_1446263 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300006480|Ga0100226_1023540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
3300006481|Ga0100229_1090442 | Not Available | 656 | Open in IMG/M |
3300006947|Ga0075444_10414649 | Not Available | 504 | Open in IMG/M |
3300007229|Ga0075468_10148009 | Not Available | 712 | Open in IMG/M |
3300007231|Ga0075469_10190840 | Not Available | 549 | Open in IMG/M |
3300007551|Ga0102881_1199558 | Not Available | 553 | Open in IMG/M |
3300007637|Ga0102906_1151067 | Not Available | 633 | Open in IMG/M |
3300007681|Ga0102824_1184898 | Not Available | 549 | Open in IMG/M |
3300007692|Ga0102823_1143299 | Not Available | 634 | Open in IMG/M |
3300007992|Ga0105748_10267159 | Not Available | 721 | Open in IMG/M |
3300008097|Ga0111541_10152366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 955 | Open in IMG/M |
3300008625|Ga0115653_1226452 | Not Available | 753 | Open in IMG/M |
3300008952|Ga0115651_1001746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 38842 | Open in IMG/M |
3300008952|Ga0115651_1002857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 27676 | Open in IMG/M |
3300008964|Ga0102889_1139936 | Not Available | 710 | Open in IMG/M |
3300009058|Ga0102854_1175762 | Not Available | 613 | Open in IMG/M |
3300009110|Ga0117925_1125272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 922 | Open in IMG/M |
3300009126|Ga0118723_1179674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1189 | Open in IMG/M |
3300009132|Ga0118730_1117865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1716 | Open in IMG/M |
3300009172|Ga0114995_10092587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1698 | Open in IMG/M |
3300009172|Ga0114995_10485782 | Not Available | 676 | Open in IMG/M |
3300009172|Ga0114995_10618047 | Not Available | 592 | Open in IMG/M |
3300009376|Ga0118722_1138942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1576 | Open in IMG/M |
3300009376|Ga0118722_1353673 | Not Available | 761 | Open in IMG/M |
3300009420|Ga0114994_10301717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1067 | Open in IMG/M |
3300009420|Ga0114994_10594417 | Not Available | 726 | Open in IMG/M |
3300009420|Ga0114994_10610391 | Not Available | 715 | Open in IMG/M |
3300009420|Ga0114994_10685494 | Not Available | 669 | Open in IMG/M |
3300009422|Ga0114998_10174299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1028 | Open in IMG/M |
3300009422|Ga0114998_10317496 | Not Available | 729 | Open in IMG/M |
3300009422|Ga0114998_10469709 | Not Available | 589 | Open in IMG/M |
3300009425|Ga0114997_10517326 | Not Available | 635 | Open in IMG/M |
3300009425|Ga0114997_10686264 | Not Available | 536 | Open in IMG/M |
3300009425|Ga0114997_10721931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
3300009425|Ga0114997_10734714 | Not Available | 515 | Open in IMG/M |
3300009434|Ga0115562_1293443 | Not Available | 558 | Open in IMG/M |
3300009443|Ga0115557_1315508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 586 | Open in IMG/M |
3300009496|Ga0115570_10265557 | Not Available | 753 | Open in IMG/M |
3300009512|Ga0115003_10475968 | Not Available | 731 | Open in IMG/M |
3300009544|Ga0115006_11180405 | Not Available | 684 | Open in IMG/M |
3300009593|Ga0115011_11260279 | Not Available | 641 | Open in IMG/M |
3300009593|Ga0115011_11262682 | Not Available | 640 | Open in IMG/M |
3300009593|Ga0115011_11357530 | Not Available | 621 | Open in IMG/M |
3300009703|Ga0114933_10378913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 929 | Open in IMG/M |
3300009703|Ga0114933_10380932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 926 | Open in IMG/M |
3300009705|Ga0115000_10448220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 817 | Open in IMG/M |
3300009705|Ga0115000_10533519 | Not Available | 736 | Open in IMG/M |
3300009705|Ga0115000_10671614 | Not Available | 641 | Open in IMG/M |
3300009785|Ga0115001_10539259 | Not Available | 717 | Open in IMG/M |
3300009785|Ga0115001_10578326 | Not Available | 688 | Open in IMG/M |
3300009785|Ga0115001_10881081 | Not Available | 538 | Open in IMG/M |
3300010883|Ga0133547_10110294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6082 | Open in IMG/M |
3300010883|Ga0133547_11107622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1522 | Open in IMG/M |
3300010883|Ga0133547_11205381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1445 | Open in IMG/M |
3300010883|Ga0133547_11773320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1143 | Open in IMG/M |
3300010883|Ga0133547_12025221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1053 | Open in IMG/M |
3300010883|Ga0133547_12101411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1030 | Open in IMG/M |
3300012415|Ga0138263_1288964 | Not Available | 622 | Open in IMG/M |
3300012524|Ga0129331_1282409 | Not Available | 607 | Open in IMG/M |
3300012919|Ga0160422_10921380 | Not Available | 564 | Open in IMG/M |
3300012919|Ga0160422_10930098 | Not Available | 561 | Open in IMG/M |
3300012928|Ga0163110_10993105 | Not Available | 668 | Open in IMG/M |
3300012936|Ga0163109_10676726 | Not Available | 755 | Open in IMG/M |
3300012936|Ga0163109_10688912 | Not Available | 747 | Open in IMG/M |
3300012950|Ga0163108_10518665 | Not Available | 770 | Open in IMG/M |
3300012954|Ga0163111_10294668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1439 | Open in IMG/M |
3300012954|Ga0163111_10721223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 942 | Open in IMG/M |
3300012954|Ga0163111_11318926 | Not Available | 708 | Open in IMG/M |
3300012954|Ga0163111_11388589 | Not Available | 692 | Open in IMG/M |
3300012954|Ga0163111_11992620 | Not Available | 584 | Open in IMG/M |
3300017697|Ga0180120_10327218 | Not Available | 610 | Open in IMG/M |
3300017781|Ga0181423_1067462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1417 | Open in IMG/M |
3300017781|Ga0181423_1224342 | Not Available | 706 | Open in IMG/M |
3300017949|Ga0181584_10515522 | Not Available | 733 | Open in IMG/M |
3300018036|Ga0181600_10421908 | Not Available | 644 | Open in IMG/M |
3300018048|Ga0181606_10546237 | Not Available | 601 | Open in IMG/M |
3300018049|Ga0181572_10221579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1221 | Open in IMG/M |
3300020055|Ga0181575_10485827 | Not Available | 665 | Open in IMG/M |
3300020178|Ga0181599_1277035 | Not Available | 631 | Open in IMG/M |
3300020238|Ga0211492_1059452 | Not Available | 699 | Open in IMG/M |
3300020268|Ga0211495_1033993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1044 | Open in IMG/M |
3300020304|Ga0211684_1017531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1016 | Open in IMG/M |
3300020309|Ga0211681_1060921 | Not Available | 625 | Open in IMG/M |
3300020316|Ga0211487_1062632 | Not Available | 737 | Open in IMG/M |
3300020368|Ga0211674_10180632 | Not Available | 539 | Open in IMG/M |
3300020371|Ga0211500_1090085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 918 | Open in IMG/M |
3300020371|Ga0211500_1208210 | Not Available | 562 | Open in IMG/M |
3300020372|Ga0211683_10054743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1310 | Open in IMG/M |
3300020378|Ga0211527_10057074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1203 | Open in IMG/M |
3300020378|Ga0211527_10102192 | Not Available | 839 | Open in IMG/M |
3300020382|Ga0211686_10095690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1213 | Open in IMG/M |
3300020391|Ga0211675_10311618 | Not Available | 664 | Open in IMG/M |
3300020392|Ga0211666_10306797 | Not Available | 594 | Open in IMG/M |
3300020396|Ga0211687_10077060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1442 | Open in IMG/M |
3300020396|Ga0211687_10172650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 885 | Open in IMG/M |
3300020396|Ga0211687_10178633 | Not Available | 867 | Open in IMG/M |
3300020401|Ga0211617_10194433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 845 | Open in IMG/M |
3300020411|Ga0211587_10015419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3939 | Open in IMG/M |
3300020416|Ga0211644_10245132 | Not Available | 736 | Open in IMG/M |
3300020417|Ga0211528_10160485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 879 | Open in IMG/M |
3300020421|Ga0211653_10456094 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 547 | Open in IMG/M |
3300020439|Ga0211558_10415726 | Not Available | 621 | Open in IMG/M |
3300020441|Ga0211695_10266898 | Not Available | 621 | Open in IMG/M |
3300020445|Ga0211564_10372732 | Not Available | 702 | Open in IMG/M |
3300020450|Ga0211641_10101780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1472 | Open in IMG/M |
3300020454|Ga0211548_10236754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 888 | Open in IMG/M |
3300020454|Ga0211548_10571805 | Not Available | 553 | Open in IMG/M |
3300020457|Ga0211643_10437400 | Not Available | 643 | Open in IMG/M |
3300020463|Ga0211676_10658418 | Not Available | 526 | Open in IMG/M |
3300020465|Ga0211640_10734085 | Not Available | 524 | Open in IMG/M |
3300020466|Ga0211714_10405107 | Not Available | 647 | Open in IMG/M |
3300020467|Ga0211713_10447200 | Not Available | 627 | Open in IMG/M |
3300020473|Ga0211625_10268681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 883 | Open in IMG/M |
3300021185|Ga0206682_10368286 | Not Available | 613 | Open in IMG/M |
3300021375|Ga0213869_10062347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1902 | Open in IMG/M |
3300021957|Ga0222717_10511867 | Not Available | 644 | Open in IMG/M |
(restricted) 3300022920|Ga0233426_10253188 | Not Available | 699 | Open in IMG/M |
3300022927|Ga0255769_10262248 | Not Available | 722 | Open in IMG/M |
3300023110|Ga0255743_10448761 | Not Available | 624 | Open in IMG/M |
3300023240|Ga0222676_1017431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1288 | Open in IMG/M |
(restricted) 3300024255|Ga0233438_10260527 | Not Available | 681 | Open in IMG/M |
(restricted) 3300024260|Ga0233441_1185028 | Not Available | 634 | Open in IMG/M |
3300024335|Ga0228672_1191534 | Not Available | 503 | Open in IMG/M |
3300024417|Ga0228650_1108991 | Not Available | 748 | Open in IMG/M |
3300025663|Ga0209775_1162097 | Not Available | 624 | Open in IMG/M |
3300025666|Ga0209601_1178413 | Not Available | 577 | Open in IMG/M |
3300025727|Ga0209047_1012878 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 4163 | Open in IMG/M |
3300025770|Ga0209362_1135773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 880 | Open in IMG/M |
3300025869|Ga0209308_10083511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1586 | Open in IMG/M |
3300025870|Ga0209666_1331190 | Not Available | 590 | Open in IMG/M |
3300025880|Ga0209534_10318752 | Not Available | 707 | Open in IMG/M |
3300025886|Ga0209632_10360957 | Not Available | 703 | Open in IMG/M |
3300025890|Ga0209631_10006411 | Not Available | 12115 | Open in IMG/M |
3300025894|Ga0209335_10147965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1143 | Open in IMG/M |
3300026138|Ga0209951_1005526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2756 | Open in IMG/M |
3300026260|Ga0208408_1135595 | Not Available | 699 | Open in IMG/M |
3300026269|Ga0208766_1089011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 877 | Open in IMG/M |
3300026292|Ga0208277_1217183 | Not Available | 600 | Open in IMG/M |
3300027522|Ga0209384_1066289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 929 | Open in IMG/M |
3300027687|Ga0209710_1022766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3238 | Open in IMG/M |
3300027751|Ga0208304_10084008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1208 | Open in IMG/M |
3300027752|Ga0209192_10205400 | Not Available | 748 | Open in IMG/M |
3300027780|Ga0209502_10291782 | Not Available | 706 | Open in IMG/M |
3300027788|Ga0209711_10193514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 942 | Open in IMG/M |
3300027791|Ga0209830_10027901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3194 | Open in IMG/M |
3300027791|Ga0209830_10311577 | Not Available | 695 | Open in IMG/M |
3300027801|Ga0209091_10028411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3459 | Open in IMG/M |
3300027801|Ga0209091_10045161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2581 | Open in IMG/M |
3300027801|Ga0209091_10113883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1438 | Open in IMG/M |
3300027801|Ga0209091_10514484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 517 | Open in IMG/M |
3300027813|Ga0209090_10083431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1750 | Open in IMG/M |
3300027813|Ga0209090_10359019 | Not Available | 709 | Open in IMG/M |
3300027830|Ga0209359_10300162 | Not Available | 735 | Open in IMG/M |
3300027833|Ga0209092_10433248 | Not Available | 683 | Open in IMG/M |
3300027859|Ga0209503_10683391 | Not Available | 513 | Open in IMG/M |
3300027906|Ga0209404_10389339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 906 | Open in IMG/M |
3300028132|Ga0228649_1038004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1322 | Open in IMG/M |
3300028194|Ga0257106_1291314 | Not Available | 537 | Open in IMG/M |
3300031630|Ga0308004_10287372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
3300031644|Ga0308001_10153886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 938 | Open in IMG/M |
3300031659|Ga0307986_10412128 | Not Available | 537 | Open in IMG/M |
3300031659|Ga0307986_10454901 | Not Available | 500 | Open in IMG/M |
3300031695|Ga0308016_10277229 | Not Available | 623 | Open in IMG/M |
3300031696|Ga0307995_1236030 | Not Available | 633 | Open in IMG/M |
3300031696|Ga0307995_1269973 | Not Available | 576 | Open in IMG/M |
3300031702|Ga0307998_1081084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1229 | Open in IMG/M |
3300031702|Ga0307998_1184714 | Not Available | 713 | Open in IMG/M |
3300031721|Ga0308013_10250684 | Not Available | 636 | Open in IMG/M |
3300031766|Ga0315322_10570352 | Not Available | 729 | Open in IMG/M |
3300031773|Ga0315332_10577144 | Not Available | 702 | Open in IMG/M |
3300031774|Ga0315331_11107029 | Not Available | 532 | Open in IMG/M |
3300031785|Ga0310343_11240192 | Not Available | 563 | Open in IMG/M |
3300031851|Ga0315320_10242766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1308 | Open in IMG/M |
3300032006|Ga0310344_10803392 | Not Available | 797 | Open in IMG/M |
3300032047|Ga0315330_10400354 | Not Available | 846 | Open in IMG/M |
3300032073|Ga0315315_11877692 | Not Available | 507 | Open in IMG/M |
3300032130|Ga0315333_10293072 | Not Available | 771 | Open in IMG/M |
3300032277|Ga0316202_10077697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1540 | Open in IMG/M |
3300032820|Ga0310342_101154022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 914 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 29.41% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 18.63% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.90% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.92% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.92% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.92% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.92% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.92% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.43% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.94% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.45% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.96% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.96% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.47% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.47% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.47% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.47% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.98% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.98% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.98% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.49% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.49% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.49% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.49% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.49% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.49% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.49% |
Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.49% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.49% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.49% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.49% |
Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
3300000219 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 1000m | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
3300001966 | Marine microbial communities from Roca Redonda, Equador - GS030 | Environmental | Open in IMG/M |
3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
3300001971 | Marine microbial communities from the Sargasso Sea - GS000c | Environmental | Open in IMG/M |
3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
3300002186 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome | Environmental | Open in IMG/M |
3300003477 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 | Environmental | Open in IMG/M |
3300003501 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA | Environmental | Open in IMG/M |
3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
3300006480 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075m | Environmental | Open in IMG/M |
3300006481 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025m | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
3300008625 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um | Environmental | Open in IMG/M |
3300008952 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um | Environmental | Open in IMG/M |
3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
3300009110 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 198m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300009126 | Combined Assembly of Gp0139357, Gp0139356 | Environmental | Open in IMG/M |
3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
3300009376 | Combined Assembly of Gp0137079, Gp0137080 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300012415 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020238 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068) | Environmental | Open in IMG/M |
3300020268 | Marine microbial communities from Tara Oceans - TARA_B000000477 (ERX556113-ERR599107) | Environmental | Open in IMG/M |
3300020304 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556110-ERR599176) | Environmental | Open in IMG/M |
3300020309 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX556064-ERR599104) | Environmental | Open in IMG/M |
3300020316 | Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX555946-ERR599134) | Environmental | Open in IMG/M |
3300020368 | Marine microbial communities from Tara Oceans - TARA_B100001027 (ERX556049-ERR599093) | Environmental | Open in IMG/M |
3300020371 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555978-ERR598991) | Environmental | Open in IMG/M |
3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
3300023240 | Saline water microbial communities from Ace Lake, Antarctica - #870 | Environmental | Open in IMG/M |
3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
3300024260 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MG | Environmental | Open in IMG/M |
3300024335 | Seawater microbial communities from Monterey Bay, California, United States - 90D | Environmental | Open in IMG/M |
3300024417 | Seawater microbial communities from Monterey Bay, California, United States - 62D | Environmental | Open in IMG/M |
3300025663 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_135m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
3300025727 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026260 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes) | Environmental | Open in IMG/M |
3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028132 | Seawater microbial communities from Monterey Bay, California, United States - 61D | Environmental | Open in IMG/M |
3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
LPaug09P1610mDRAFT_10187351 | 3300000149 | Marine | APKKTLKKAMVTGPKEYVAILMLKKADAQIKASVANKM* |
LPfeb10P161000mDRAFT_10110821 | 3300000219 | Marine | IAPKKTLKNAIVTGPNEYVAILILKKADAQIKANNVNKI* |
NpDRAFT_100999602 | 3300000929 | Freshwater And Marine | NTGIDPKKTLKKAIVIGPKDSVAILILKKADAHIKAKITNKV* |
BBAY93_101954032 | 3300000973 | Macroalgal Surface | PKKTLKKAMVTGPKEYVAILILKNAEAQINANKVNNR* |
JGI20151J14362_101619722 | 3300001346 | Pelagic Marine | DPKKTLRKAIVTGPKDSVAILILKKAEAQIKASXINSI* |
JGI20155J14468_101303122 | 3300001354 | Pelagic Marine | KQSNKTGIAPKKTLRKAIVTGPKEYVAIFMLKKAEAQINASNANNK* |
GOS2245_10141911 | 3300001966 | Marine | NKTGIDPNNTLKNAIVIGPKEYVAILILKNAEAQINANTVNNI* |
GOS2245_10913212 | 3300001966 | Marine | MLQLLYFYKNIKLKTGIAPKKDLKKPIVICPTEYVAISILKKADAHINDNSVNNK |
GOS2242_10457563 | 3300001967 | Marine | IAPKKDLRKPIVIGPNEYVAILILKKADAHINDNKVNSK* |
GOS2215_100742263 | 3300001971 | Marine | KHKIKTGIAPKKDLKKPIVIGPNEYVAIFILKKADAHINDNNVNNK* |
GOScombined01_1017416061 | 3300002040 | Marine | NTGIAPKNTLRKAIVTGPKEYVAILILKKADAQINAKIVSKK* |
JGI24539J26755_100894333 | 3300002186 | Marine | DPKKTLKKAIVIGPKDSVAILMLKKADAHIKDKITNKI* |
nap3_101053702 | 3300003477 | Estuarine | RTGIAPKNTRRKAIVTGPNEYVAIFILKNADAHIKDNMVNKA* |
JGI26243J51142_10083926 | 3300003501 | Marine | HKSKTGIAPKKTLKNAIVTGPNEYVAIFILKKADAQIKANNVNKI* |
JGI26273J51734_101267002 | 3300003620 | Marine | NNNTGIEPKKTLRKAMVMGPKESVAILMLKNAEAHIKANITNKV* |
Ga0073579_10844053 | 3300005239 | Marine | MEPKKTLKKAIVMGPKDSVAILILKKAEAHIKARNTNKI* |
Ga0066856_103360053 | 3300005404 | Marine | NNKTGIAPKKTRKKAIVTGPKELVAILILKNADAQISAKNVKSI* |
Ga0066849_102302731 | 3300005430 | Marine | GIAPKKTLKKAMVTGPKEYVAILILKKADAQIKANVVNKT* |
Ga0066866_102450102 | 3300005514 | Marine | PKKTLKKAMVTGPKEYVAILILKKADAQIKANVVNKI* |
Ga0066861_101705002 | 3300005522 | Marine | IKTGMAPKKDLKKPIVIGPNEYVAILILKKADAHINDNKVNNK* |
Ga0066835_101667872 | 3300005606 | Marine | GIAPKKDLKKPIVIGPNEYVAIFILKKADAHINDNNVNNK* |
Ga0078893_103634732 | 3300005837 | Marine Surface Water | FIKQSNKTGIAPKKTLRKAIVTGPNEYVAILMLKKADAQIRAKKVSNK* |
Ga0066836_105562541 | 3300006166 | Marine | GIAPKKTLKKAMVTGPKEYVAILILKKADAQIKANVVNKI* |
Ga0075447_102711591 | 3300006191 | Marine | GIDPKKTLKKAIVIGPKDSVAIFILKKAEAHIKDKITNKA* |
Ga0099693_14462632 | 3300006345 | Marine | MAPKNTLRKAIVTGPKEYVAILILKKADAQINAKIVSKK* |
Ga0100226_10235401 | 3300006480 | Marine | KKDLKKPIVIGPNEYVAIFILKKADAHINDNNVNNK* |
Ga0100229_10904421 | 3300006481 | Marine | PKKDLKKPIVIGPKEYVAILILKKAEAHIKDNIVNNK* |
Ga0075444_104146492 | 3300006947 | Marine | STGIDPKKTLKKAIVIGPKDSVAIFILKKAEAHIKDKITNKV* |
Ga0075468_101480092 | 3300007229 | Aqueous | TGIDPKKTLKKAMVIGPKDSVAILILKKADAHIKDKSTNKI* |
Ga0075469_101908402 | 3300007231 | Aqueous | PKKTLKNAIVIGPKDSVAILILKKADAHIKAKTTNNV* |
Ga0102881_11995581 | 3300007551 | Estuarine | KHNNNTGIDPKKTLRKAIVTGPKDSVAILILKKADAHIKAKITNKV* |
Ga0102906_11510672 | 3300007637 | Estuarine | APKKTLKNAIVTGPNEYVAIFILKKADAQIKANNVNKI* |
Ga0102824_11848981 | 3300007681 | Estuarine | TGIDPKKTLKKAIVIGPKDSVAIFILKKAEAHIKAKITNKV* |
Ga0102823_11432991 | 3300007692 | Estuarine | KTLKKAIVTGPKEYVAILILKKAEAQIKANTVNKT* |
Ga0105748_102671591 | 3300007992 | Estuary Water | NSTGIDPKKTLKKAIVIGPKDSVAILMLKKADAHIKDKSTNKI* |
Ga0111541_101523661 | 3300008097 | Marine | KHKSKTGIAPKKDLKKPIVRGPKEYVAILILKKAEAHIRDNKVNNK* |
Ga0115653_12264521 | 3300008625 | Marine | ILRNAIVSGPYEYVAILILKKAEAQIRARTTRKI* |
Ga0115651_10017461 | 3300008952 | Marine | PTTGIAPNSILRNAIVSGPYEYVAILILKKAEAQIRARTTRKI* |
Ga0115651_10028571 | 3300008952 | Marine | PTTGIAPNSILRNAIVSGPYEYVAILILKKAEAQIRARTIRKI* |
Ga0102889_11399361 | 3300008964 | Estuarine | TGIDPKKTLKKAIVIGPKDSVAILMLKKADAHIKDKSTNKI* |
Ga0102854_11757621 | 3300009058 | Estuarine | KHNNKTGIEPKKTLKNAIVTGPKDSVAILMLKKAEAHINANIPSSV* |
Ga0117925_11252721 | 3300009110 | Marine | TGIAPKKILKNAMVRGPYEKVAIFILKKAEAQMRANTVSNK* |
Ga0118723_11796741 | 3300009126 | Marine | PTTGIAPNSILRNAIVSGPYEYVAILILKKAEAQIRARTTRRI* |
Ga0118730_11178653 | 3300009132 | Marine | APNNILRNAIVSGPYEYVAILILKKAEAQIRANTTRKI* |
Ga0114995_100925871 | 3300009172 | Marine | KHNNKTGIEPKKTLKKAIVIGPKDSVAILILKKADAHIKANIISSV* |
Ga0114995_104857821 | 3300009172 | Marine | KKTLKKAIVIGPKDSVAILMLKKADAHIKDKITNKI* |
Ga0114995_106180472 | 3300009172 | Marine | NSTGIDPKKTLKKAIVIGPKDSVAILMLKKADAHIKDKITNKI* |
Ga0118722_11389421 | 3300009376 | Marine | QSPTTGIAPNSILRNAIVSGPYEYVAILILKKAEAQIRAKTTRKI* |
Ga0118722_13536732 | 3300009376 | Marine | QSPTTGIAPNSILRNAIVSGPYEYVAILILKKAEAQIRARTIRKI* |
Ga0114994_103017173 | 3300009420 | Marine | NKTGIEPKKTLKKAIVIGPNDSVAILMLKNAEAHIKAKTVNKI* |
Ga0114994_105944172 | 3300009420 | Marine | NTGIDPKNTRKKAIVTGPKDSVAILILKKADAHIKAKIINRT* |
Ga0114994_106103911 | 3300009420 | Marine | NKTGMEPKKTLKKAIVMGPKDSVAILILKKADAHIKARNTNKI* |
Ga0114994_106854941 | 3300009420 | Marine | KTLKKAIVIGPKDSVAILILKNAEAHIKAKITNRM* |
Ga0114998_101742991 | 3300009422 | Marine | KTLKKAIVIGPKDSVAILMLKKADAHIKDKITNKI* |
Ga0114998_103174962 | 3300009422 | Marine | GIEPKKTLKKEIVIGPKDSVAILILKKADAHIKARNTNKI* |
Ga0114998_104697091 | 3300009422 | Marine | KTGMEPKKTLKKAIVMGPKDSVAILILKKADAHIKAKNTNKI* |
Ga0114997_105173261 | 3300009425 | Marine | KTLKKAIVIGPKDSVAIFILKKAEAHIIDKITNKM* |
Ga0114997_106862641 | 3300009425 | Marine | TLKKAIVIGPKDSVAILILKKAEAHIKAKITNKV* |
Ga0114997_107219311 | 3300009425 | Marine | KTLKKAIVTGPKEYVAILILKKAEAQIRANTVNKI* |
Ga0114997_107347141 | 3300009425 | Marine | NNSTGIDPKKTLKKAIVIGPKDSVAILMLKKADAHIKDKINNKI* |
Ga0115562_12934432 | 3300009434 | Pelagic Marine | STGIDPKKTLKKAIVIGPKDSVAILMLKKADAHIKDKSTNKI* |
Ga0115557_13155083 | 3300009443 | Pelagic Marine | PKKTLRKAIVTGPKDSVAILILKKAEAHIKASTTNNV* |
Ga0115570_102655571 | 3300009496 | Pelagic Marine | NSTGIEPNKTLKNAIVIGPKDSVAIFILKKADAHIKAKTTNKV* |
Ga0115003_104759681 | 3300009512 | Marine | KTLKKEIVIGPKDSVAILILKNAEAHIKAKKTNSV* |
Ga0115006_111804052 | 3300009544 | Marine | IIKLEWTQKKTLKKAIVIGPNDSVAILMLKKAEAHIKAKISNKV* |
Ga0115011_112602791 | 3300009593 | Marine | PTTGIAPNSILRNAIVSGPYEYVAILILKKAEAQIRASTTRKI* |
Ga0115011_112626822 | 3300009593 | Marine | ILIFLNKQSPTTGIAPNNILRNAIVTGPYEYVAILILKKAEAQIIASTTRKT* |
Ga0115011_113575301 | 3300009593 | Marine | SKTGIAPKKTLKKAMVTGPKEYVAILILKKADAQIKANVVNRI* |
Ga0114933_103789131 | 3300009703 | Deep Subsurface | PNNILRNAIVTGPYEYVAILILKKAEAQIRASTTRKI* |
Ga0114933_103809323 | 3300009703 | Deep Subsurface | TGIAPKKTLRNAIVIGPKEYVAILILKNAEAQINASKANNP* |
Ga0115000_104482202 | 3300009705 | Marine | MEPKKTLKKEIVIGPKDSVAILILKKAEDQIKAKIINSV* |
Ga0115000_105335191 | 3300009705 | Marine | PKKTLKKAIVMGPKDSVAILILKKADAHIKARNINKI* |
Ga0115000_106716142 | 3300009705 | Marine | TGIDPKNTRKKAIVIGPKDSVAILILKNAEDHIKAKITKRI* |
Ga0115001_105392591 | 3300009785 | Marine | PKKTLKKAIVMGPKDSVAILILKKADAHIKAKITNKV* |
Ga0115001_105783262 | 3300009785 | Marine | IEPKKTLKKEIVIGPKDSVAILILKKADAHIKARNTNKI* |
Ga0115001_108810811 | 3300009785 | Marine | KKTLKNAIVIGPKDSVAILILKKADAHIKAKITNNV* |
Ga0133547_101102941 | 3300010883 | Marine | HSNKTGMEPKKTLKKAIVMGPKDSVAILILKKADAHIKAKNTNKI* |
Ga0133547_111076221 | 3300010883 | Marine | TGMEPKKTLKKAIVMGPKDSVAILILKKADAHIKARNINKI* |
Ga0133547_112053813 | 3300010883 | Marine | EPKKTLKKAIVIGPKDSVAILILKNAEAHIKAKINKSV* |
Ga0133547_117733201 | 3300010883 | Marine | KHNNKTGIEPKKTLKKAIVIGPKDSVAILILKKADAHIKARNTNKI* |
Ga0133547_120252211 | 3300010883 | Marine | NNSTGIDPKKTLKKAIVIGPKDSVAIFILKKAEAHIKDRITNKI* |
Ga0133547_121014113 | 3300010883 | Marine | MEPKKTLKKAIVIGPKDSVAILILKKAEAHIKARNTNKI* |
Ga0138263_12889641 | 3300012415 | Polar Marine | GIDPKKTLKKAIVIGPKDSVAIFILKKAEAHIKDKITNKV* |
Ga0129331_12824091 | 3300012524 | Aqueous | KKTLRKAIVTGPKDSVAILILKKAEAQIKARITNSI* |
Ga0160422_109213802 | 3300012919 | Seawater | GMAPKKTLKNAMVTGPYEYVAILILKKAEAQINASRINKR* |
Ga0160422_109300982 | 3300012919 | Seawater | KTGIAPKNTLKNAMVIGPNEYVAILILKKADAHIKANKINKR* |
Ga0163110_109931051 | 3300012928 | Surface Seawater | KDLKKPIVIGPNEYVAILILKKADAHINDNKVNNK* |
Ga0163109_106767261 | 3300012936 | Surface Seawater | IAPKKDLKKPIVIGPNEYVAIFILKKADAHINDNNVNNK* |
Ga0163109_106889121 | 3300012936 | Surface Seawater | STGIDPSKTLKNAIVTGPKEYVDILMLKKAEAQINAKITSKV* |
Ga0163108_105186651 | 3300012950 | Seawater | QSSINGIAPKKTLSNAIVIGPYEYVAILILKKADAHIIERIVNKI* |
Ga0163111_102946683 | 3300012954 | Surface Seawater | APSKDLKKPIVIGPNENVAILILKKADAHINDKINNNK* |
Ga0163111_107212231 | 3300012954 | Surface Seawater | KDLKKPIVIGPNEYVAILILKKADAHIKDNNVNNK* |
Ga0163111_113189262 | 3300012954 | Surface Seawater | KDLKKPIVIGPNEYVAILILKKADAHINDNNVNNK* |
Ga0163111_113885892 | 3300012954 | Surface Seawater | PKKDLKKPIVIGPNEYVAILILKKADAHINDNKVNNK* |
Ga0163111_119926201 | 3300012954 | Surface Seawater | KTLKKAIVTGPKEYVAILILKKADAHIKAKIVRRK* |
Ga0180120_103272181 | 3300017697 | Freshwater To Marine Saline Gradient | NNSTGIDPKKTLKKAIVIGPKDSVAILMLKKADAHIKDKSTNKI |
Ga0181423_10674623 | 3300017781 | Seawater | KITGMAPRKILKKAIVKGPYESVAIFILKKAEAQINAKNVSNK |
Ga0181423_12243421 | 3300017781 | Seawater | KTGIAPKKTLKKAMVTGPKEYVAILILKKAEAQIKANTVNKI |
Ga0181584_105155221 | 3300017949 | Salt Marsh | KTLRNAIVIGPNEYVAILILKKADAQINANNVNKL |
Ga0181600_104219081 | 3300018036 | Salt Marsh | RTGIAPKKTLRKAIVTGPNEYVAILILKKADAQIKAKTVNKI |
Ga0181606_105462371 | 3300018048 | Salt Marsh | SNRTGIAPKKTLRKAIVTGPNEYVAILILKKADAQIKANTVNKI |
Ga0181572_102215793 | 3300018049 | Salt Marsh | SNKTGIAPKKTLKKAIVTGPNEYVAILILKNAEAQIKANNVNNK |
Ga0181575_104858272 | 3300020055 | Salt Marsh | HKIKTGIAPKKDLKKPIVIGPNEYVAIFILKKADAHINDNKVNNK |
Ga0181599_12770351 | 3300020178 | Salt Marsh | TGIAPKNDLKKPIVIGPNEYVAIFILKKADAHINDNKVNNK |
Ga0211492_10594522 | 3300020238 | Marine | GIAPKKDLKKPIVIGPNEYVAIFILKKADAHINDNNVNNK |
Ga0211495_10339931 | 3300020268 | Marine | GIDPSKTLKKAIVTGPNEYVEILILKKAEAQINANTIKTI |
Ga0211684_10175311 | 3300020304 | Marine | EPKKTLKKAIVIGPKDSVAILILKNAEAHIKAKITNRV |
Ga0211681_10609212 | 3300020309 | Marine | KTGIEPKKTLKKAIVIGPKDSVAILILKKADAHINAKKINRV |
Ga0211487_10626321 | 3300020316 | Marine | KHKIKTGIAPKKDLKKPIVIGPNEYVAIFILKKADAHINDNNVNNK |
Ga0211674_101806322 | 3300020368 | Marine | GIDPRKTLMKAIVIGPKDSVAILILKNADDQMRDRKTSNE |
Ga0211500_10900851 | 3300020371 | Marine | TGIAPKKTLKKAIVTGPNEYVAILILKNAEAQINASKVNNI |
Ga0211500_12082101 | 3300020371 | Marine | APKKTLKKAIVTGPNEYVAILILKNAEAQIKANNVNNK |
Ga0211683_100547433 | 3300020372 | Marine | EPKKTLKKAIVIGPKDSVAILILKKAEAHIKAKTNKRV |
Ga0211527_100570741 | 3300020378 | Marine | KTGIAPKKTLKKAIVIGPKEYVAILILKKAEAHINAKNVNKR |
Ga0211527_101021921 | 3300020378 | Marine | NKTGIAPKKTLKKAIVTGPNEYVAILILKNAEAQIKANNVNNK |
Ga0211686_100956903 | 3300020382 | Marine | GMEPKKTLKKAIVIGPKDSVAILILKKAEAHIKDKIISNV |
Ga0211675_103116181 | 3300020391 | Marine | IAPKKTLRKAIVTGPKEYVAILMLKKADAHIKAKMVSKK |
Ga0211666_103067971 | 3300020392 | Marine | KDLKKPIVIGPNEYVAILMLKKADAHIKDNNVNNK |
Ga0211687_100770601 | 3300020396 | Marine | PKKTLKKAIVTGPNDSVAILILKKAEAHIKAKITKRV |
Ga0211687_101726503 | 3300020396 | Marine | KTRKKAIVIGPKDSVAILILKKADAHIKARITKSV |
Ga0211687_101786331 | 3300020396 | Marine | NNTGIAPKKTLKKAIVTGPKEYVAILILKKAEAQIKDNTVNKT |
Ga0211617_101944331 | 3300020401 | Marine | KKTLRKAIVTGPNEYVAILMLKKAEAHIKAKTVKRT |
Ga0211587_100154191 | 3300020411 | Marine | ITGIAPRKIRKKAIVIGPKEYVAIFILKKADAQIKDNDNSNI |
Ga0211644_102451321 | 3300020416 | Marine | HKIKTGIAPKKDLKKPIVIGPNEYVAIFILKKADAHINDNNVNNK |
Ga0211528_101604853 | 3300020417 | Marine | KTGIAPKKTLKKAIVTGPNEYVAILILKNAEAQIKANNVNNK |
Ga0211653_104560941 | 3300020421 | Marine | TGIAPKNTLKKAIVIGPKEYVAILILKNADAHINANNVSKT |
Ga0211558_104157261 | 3300020439 | Marine | KIKTGIAPKKDLKKPIVIGPNEYVAIFILKKADAHINDNKVNNK |
Ga0211695_102668982 | 3300020441 | Marine | SNKTGIAPKKTLKKAIVTGPNEYVAIFILKKAEAHIKANMVSNI |
Ga0211564_103727322 | 3300020445 | Marine | SKTGNAPKKTLKKAIVTGPNEYVAILILKKADAHINDNNVNNK |
Ga0211641_101017803 | 3300020450 | Marine | IKTGKAPKRDLKKPIVIGPNEYVAILILKKAEAHINDNNDNNK |
Ga0211548_102367543 | 3300020454 | Marine | PKNDLKKPIVIGPNEYVAILILKKADAHIKDNNVNNK |
Ga0211548_105718052 | 3300020454 | Marine | KQRQITGIAPNNILRNAIVTGPYEYVAILILKKAEAQIRASTTRKI |
Ga0211643_104374002 | 3300020457 | Marine | SNKTGIAPKKHLKNAIVMGPKEYVAILILKKAEAQIKPNKVNKI |
Ga0211676_106584181 | 3300020463 | Marine | HKIKTGIAPKKDLKKPIVIGPNEYVAILILKKADAHINDNNVNNK |
Ga0211640_107340852 | 3300020465 | Marine | TGTAPSNILRNAIVTGPYEYVAILILKKAEAQIRANTTRKT |
Ga0211714_104051071 | 3300020466 | Marine | KHKIKTGIAPKKDLKKPIVIGPNEYVAIFILKKAEAHINDNKVNNK |
Ga0211713_104472001 | 3300020467 | Marine | KKTLRKAIVTGPKEYVAILILKKAEAQINAKITKRM |
Ga0211625_102686813 | 3300020473 | Marine | PKKDLKKPIVIGPNEYVAILILKKADAHINDNKVNSK |
Ga0206682_103682862 | 3300021185 | Seawater | IAPKKTLKNAIVTGPNEYVAILILKKADAQIKANNVNKI |
Ga0213869_100623473 | 3300021375 | Seawater | IFLKKHNNKTGIEPKKTLKNAIVTGPKDSVAILILKKAEAHINANIPSSV |
Ga0222717_105118671 | 3300021957 | Estuarine Water | APKKTLKKAIVTGPKEYVAILILKKADAQINDNVVNNI |
(restricted) Ga0233426_102531882 | 3300022920 | Seawater | KTLKKAIVIGPKDSVAILMLKKADAHIKDKITNKI |
Ga0255769_102622482 | 3300022927 | Salt Marsh | IKTGIAPKKDLKKPIVIGPNEYVAIFILKKADAHINDNNVNNK |
Ga0255743_104487611 | 3300023110 | Salt Marsh | GIAPKKTLKKAIVTGPNEYVAILILKNAEAQIKANNVNNK |
Ga0222676_10174313 | 3300023240 | Saline Water | STGIDPKKTLRKAIVIGPKDSVAILMLKKADAHIKDKIINKI |
(restricted) Ga0233438_102605271 | 3300024255 | Seawater | LKKHNNKTGIEPKKTLKNAIVTGPKDSVAILILKNAEAHINANATKRV |
(restricted) Ga0233441_11850282 | 3300024260 | Seawater | HKSKTGIAPKKTLKNAIVTGPNEYVAILILKKADAQIKANNVNKI |
Ga0228672_11915341 | 3300024335 | Seawater | LKKHNNKTGIEPKKTLKNAIVTGPKDSVAILILKKAEAHINANIPSRV |
Ga0228650_11089912 | 3300024417 | Seawater | HNNKTGIEPKKTLKNAIVTGPKDSVAILMLKKAEAHINANIPSSV |
Ga0209775_11620972 | 3300025663 | Marine | NNNTGIAPKKTLKNAIVIGPKDSVAILILKKADAHIKAKTTNNV |
Ga0209601_11784132 | 3300025666 | Pelagic Marine | NSTGIDPKKTLKKAIVIGPKDSVAILMLKKADAHIKDKSTNKI |
Ga0209047_10128781 | 3300025727 | Marine | KTLKKAIVIGPKDSVAILMLKKAEPQIIDSNIISRRYSLCHQ |
Ga0209362_11357731 | 3300025770 | Marine | TGIEPKKTLRKAMVMGPKESVAILMLKNAEAHIKANITNKV |
Ga0209308_100835113 | 3300025869 | Pelagic Marine | KKTLKKAMVTGPKEYVAILILKKAEAQIKANTVNKI |
Ga0209666_13311901 | 3300025870 | Marine | HKSKTGIAPKKTLKNAIVTGPNEYVAIFILKKADAQIKANNVNKI |
Ga0209534_103187522 | 3300025880 | Pelagic Marine | HNNNTGIDPKKTLKNAIVIGPKDSVAIFILKKADAHIKAKITNKV |
Ga0209632_103609571 | 3300025886 | Pelagic Marine | NSTGIDPNKTLKKAIVIGPKDSVAILMLKKADAHIKDKIINKI |
Ga0209631_1000641115 | 3300025890 | Pelagic Marine | APKKTLRKAIVTGPKEYVAIFMLKKAEAQINASNANNK |
Ga0209335_101479651 | 3300025894 | Pelagic Marine | KHSNSTGIDPKKTLRKAIVTGPKDSVAIFILKKADAHIKAKITNKV |
Ga0209951_10055265 | 3300026138 | Pond Water | KTLKNAIVIGPKDSVAILILKKADAHIKAKITNNV |
Ga0208408_11355952 | 3300026260 | Marine | KKTLKKAMVTGPNEYVAIFILKKADAHINDNNVNNK |
Ga0208766_10890113 | 3300026269 | Marine | PKKTLKKAMVTGPKEYVAILILKKADAQIKANVVNKT |
Ga0208277_12171832 | 3300026292 | Marine | KIKTGIAPKKDLKKPIVIGPNEYVAILILKKADAHINDNKVNNK |
Ga0209384_10662893 | 3300027522 | Marine | NSTGIDPKKTLKKAIVIGPKDSVAIFILKKAEAHIKDKITNKV |
Ga0209710_10227661 | 3300027687 | Marine | EPKKTLKKEIVIGPKDSVAILILKKADAHIKARNTNKI |
Ga0208304_100840083 | 3300027751 | Estuarine | QRSKTGIAPKKTLKKAMVTGPKEYVAILILKKAEAQIKANTVNKI |
Ga0209192_102054001 | 3300027752 | Marine | HNNKTGIEPKKTLKKEIVIGPKDSVAILILKKADAHIKARNTNKI |
Ga0209502_102917822 | 3300027780 | Marine | NNSTGIDPKKTLKKAIVIGPKDSVAILMLKKADAHIKDKITNKI |
Ga0209711_101935141 | 3300027788 | Marine | NKTGMEPKKTLKKEIVIGPKDSVAILMLKKAEAHIKAKINNKV |
Ga0209830_100279017 | 3300027791 | Marine | IEPKKTLKKEIVIGPKDSVAILILKKADAHIKARNTNKI |
Ga0209830_103115771 | 3300027791 | Marine | PKKTLKKAIVIGPKDSVAILMLKKADAHIKDKITNKI |
Ga0209091_100284117 | 3300027801 | Marine | TGIDPKKTLKKAIVIGPKDSVAIFILKKAEAHIKDKITNKV |
Ga0209091_100451611 | 3300027801 | Marine | RKTLKKAIVIGPKDSVAILILKKAEAHIKAKTNKRV |
Ga0209091_101138833 | 3300027801 | Marine | HNNKTGMEPKKTLKKEIVIGPKDSVAILMLKKAEAHIKAKITNKV |
Ga0209091_105144841 | 3300027801 | Marine | GVDPKNTRKKAIVIGPKDSVAIFILKNAEAHIKAKRTNSE |
Ga0209090_100834313 | 3300027813 | Marine | PKKTLKNAIVIGPKDSVAILILKKADAHIKAKTTNKV |
Ga0209090_103590192 | 3300027813 | Marine | NNKTGMKPKKTLKKAIVIGPKDSVAILILKNAEAHIKAKITSRI |
Ga0209359_103001622 | 3300027830 | Marine | IKTGIAPKKDLKKPIVIGPNEYVAIFILKKAEAHINDNKVNNK |
Ga0209092_104332482 | 3300027833 | Marine | NNNTGIDPKKTLKNAIVIGPKDSVAIFILKKADAHIKAKITNKV |
Ga0209503_106833911 | 3300027859 | Marine | GKAPKKTLKKAIDTGPNEYVAILILKKAEAHINDNIVNKK |
Ga0209404_103893391 | 3300027906 | Marine | PKNTLKKAIVTGPKEYVAILILKKADAQIKANVVNKI |
Ga0228649_10380041 | 3300028132 | Seawater | KTGIAPKKTLRKAIVTGPNEYVAILILKNAEAQIKANIVNKI |
Ga0257106_12913142 | 3300028194 | Marine | NTGIDPKKTLKNAIVIGPKDSVAILILKKAEAHIKDKITNKV |
Ga0308004_102873721 | 3300031630 | Marine | KTGIEPKKTLKKAIVIGPKDSVAILMLKNAEAHIKAKITNRL |
Ga0308001_101538861 | 3300031644 | Marine | HNNKTGIEPKKTLKKAMVIGPKDSVAILILKKADAHIKAKITNKV |
Ga0307986_104121282 | 3300031659 | Marine | MEPKKTLKKEIVIGPKDSVAILILKKAEAQIKARIINSV |
Ga0307986_104549012 | 3300031659 | Marine | DPKKTLKKAIVIGPKDSVAILMLKKADAHIKDKITNKM |
Ga0308016_102772292 | 3300031695 | Marine | NKTGMEPKKTLKKAIVIGPKDSVAILMLKKAEAHIKAKITNKV |
Ga0307995_12360301 | 3300031696 | Marine | KHNNKTGIEPNKTLKKAIVIGPKDSVAILMLKNAEAHIKAKITNSI |
Ga0307995_12699731 | 3300031696 | Marine | MEPKKTLKKAIVIGPKDSVAILILKNAEAHIKAKTTNRV |
Ga0307998_10810841 | 3300031702 | Marine | MEPKKTLKKAIVIGPNDSVAILILKKAEAHIKAKIINRV |
Ga0307998_11847142 | 3300031702 | Marine | TGIEPKKTLKKAIVMGPKDSVAILILKKADAHIKAKITNKV |
Ga0308013_102506842 | 3300031721 | Marine | TGMEPKKTLKKAIVIGPKDSVAILILKKAEAHIKAKTTKRV |
Ga0315322_105703522 | 3300031766 | Seawater | APKKILKNAIVTGPKEYVAIFILKKADDHIKAKTVKRI |
Ga0315332_105771442 | 3300031773 | Seawater | TGIAPKKDLKKPIVIGPNEYVAILILKKADAHINDNKVNNK |
Ga0315331_111070291 | 3300031774 | Seawater | RSKTGIAPKKTLKKAMVTGPKEYVAILILKKAEAQIKANTVNKI |
Ga0310343_112401922 | 3300031785 | Seawater | APKKDLKKPIVIGPKEYVAILILKKAEAHIKDNIVNKK |
Ga0315320_102427663 | 3300031851 | Seawater | TGIAPNKTLKKAMVTGPKEYVAILILKKADAQIKANVVNKI |
Ga0310344_108033922 | 3300032006 | Seawater | LKKQSPTTGIAPNNILRNAIVTGPYEYVAILILKKAEAQIRARTTRKI |
Ga0315330_104003542 | 3300032047 | Seawater | IFLKKHKIKTGIAPKKDLKKPIVIGPNEYVAILILKKADAHINDNKVNNK |
Ga0315315_118776921 | 3300032073 | Seawater | LYKQSATTGIAPKKILKNAIVTGPKEYVAIFILKKADDHIKAKTVKRI |
Ga0315333_102930721 | 3300032130 | Seawater | SILIFLKKQSPTTGIAPNSILRNAMVSGPYEYVAILMLKKAEAQIRANTTRKI |
Ga0316202_100776973 | 3300032277 | Microbial Mat | PKKTLKNAIVIGPKDSVAILILKKADAHIKAKTTNNV |
Ga0310342_1011540223 | 3300032820 | Seawater | TGIDPKNTLKKAIVIGPNDSVAIFILKKADAQIIDSNVNKI |
⦗Top⦘ |