NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027037

Metagenome / Metatranscriptome Family F027037

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027037
Family Type Metagenome / Metatranscriptome
Number of Sequences 196
Average Sequence Length 44 residues
Representative Sequence GEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG
Number of Associated Samples 157
Number of Associated Scaffolds 196

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.06 %
% of genes near scaffold ends (potentially truncated) 91.84 %
% of genes from short scaffolds (< 2000 bps) 93.37 %
Associated GOLD sequencing projects 145
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.490 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.980 % of family members)
Environment Ontology (ENVO) Unclassified
(21.939 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.306 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 22.22%    Coil/Unstructured: 77.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 196 Family Scaffolds
PF00117GATase 17.35
PF04675DNA_ligase_A_N 7.14
PF04672Methyltransf_19 2.04
PF07498Rho_N 2.04
PF16640Big_3_5 1.02
PF08376NIT 0.51
PF09084NMT1 0.51
PF00106adh_short 0.51
PF09851SHOCT 0.51
PF02656DUF202 0.51
PF00196GerE 0.51
PF00296Bac_luciferase 0.51
PF01663Phosphodiest 0.51
PF01569PAP2 0.51
PF03176MMPL 0.51
PF00085Thioredoxin 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 196 Family Scaffolds
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 7.14
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.51
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.51
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.51
COG2149Uncharacterized membrane protein YidH, DUF202 familyFunction unknown [S] 0.51
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.51
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.49 %
UnclassifiedrootN/A25.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003219|JGI26341J46601_10089455All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300004092|Ga0062389_100394441All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300004092|Ga0062389_101460029All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300005332|Ga0066388_101051169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1371Open in IMG/M
3300005434|Ga0070709_10618729All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300005434|Ga0070709_11255797All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005435|Ga0070714_100234581All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300005435|Ga0070714_100419573All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300005435|Ga0070714_101704670All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005436|Ga0070713_100216914All Organisms → cellular organisms → Bacteria1734Open in IMG/M
3300005436|Ga0070713_101000815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales806Open in IMG/M
3300005436|Ga0070713_101834076All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005437|Ga0070710_10099844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1726Open in IMG/M
3300005439|Ga0070711_101418876All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005467|Ga0070706_100112431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2535Open in IMG/M
3300005468|Ga0070707_101789630All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005534|Ga0070735_10001481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia22732Open in IMG/M
3300005539|Ga0068853_100062085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3232Open in IMG/M
3300005546|Ga0070696_100572576All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005548|Ga0070665_100383299All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300005577|Ga0068857_101916854All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005578|Ga0068854_100563932All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium968Open in IMG/M
3300005587|Ga0066654_10175500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1101Open in IMG/M
3300005610|Ga0070763_10168912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1152Open in IMG/M
3300005614|Ga0068856_102435248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300005616|Ga0068852_100324755Not Available1495Open in IMG/M
3300005713|Ga0066905_100140116All Organisms → cellular organisms → Bacteria1724Open in IMG/M
3300005764|Ga0066903_100574774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1943Open in IMG/M
3300005921|Ga0070766_10122066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1567Open in IMG/M
3300005921|Ga0070766_10428907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca870Open in IMG/M
3300005921|Ga0070766_11068559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca556Open in IMG/M
3300006028|Ga0070717_10268929All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300006028|Ga0070717_11295202Not Available662Open in IMG/M
3300006162|Ga0075030_100952153Not Available676Open in IMG/M
3300006163|Ga0070715_10274781All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300006173|Ga0070716_100187579All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300006175|Ga0070712_101064125All Organisms → cellular organisms → Bacteria → Proteobacteria701Open in IMG/M
3300006175|Ga0070712_101459105All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300006175|Ga0070712_101612970All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300006176|Ga0070765_102030356Not Available538Open in IMG/M
3300006354|Ga0075021_10551975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca733Open in IMG/M
3300006954|Ga0079219_10157354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1223Open in IMG/M
3300009101|Ga0105247_10359957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1026Open in IMG/M
3300009623|Ga0116133_1045719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca1084Open in IMG/M
3300009624|Ga0116105_1130336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca653Open in IMG/M
3300010043|Ga0126380_11624717Not Available578Open in IMG/M
3300010046|Ga0126384_12043037Not Available549Open in IMG/M
3300010048|Ga0126373_11113454Not Available856Open in IMG/M
3300010048|Ga0126373_12699461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae554Open in IMG/M
3300010049|Ga0123356_12958179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300010343|Ga0074044_10063200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2516Open in IMG/M
3300010361|Ga0126378_11289251Not Available826Open in IMG/M
3300010361|Ga0126378_11804956Not Available695Open in IMG/M
3300010366|Ga0126379_10377465Not Available1458Open in IMG/M
3300010366|Ga0126379_11784084Not Available719Open in IMG/M
3300010371|Ga0134125_10598787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1218Open in IMG/M
3300010376|Ga0126381_103710244All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300010379|Ga0136449_101534271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1017Open in IMG/M
3300010379|Ga0136449_101976716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium862Open in IMG/M
3300010379|Ga0136449_103705097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca577Open in IMG/M
3300010379|Ga0136449_104243224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales531Open in IMG/M
3300010398|Ga0126383_10377297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus1448Open in IMG/M
3300010398|Ga0126383_10594151Not Available1177Open in IMG/M
3300010876|Ga0126361_10779263All Organisms → cellular organisms → Bacteria2625Open in IMG/M
3300010937|Ga0137776_1804948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2987Open in IMG/M
3300012285|Ga0137370_11006539Not Available513Open in IMG/M
3300012930|Ga0137407_10766423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium910Open in IMG/M
3300012971|Ga0126369_11835818Not Available695Open in IMG/M
3300012975|Ga0134110_10486345Not Available559Open in IMG/M
3300012977|Ga0134087_10302806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium749Open in IMG/M
3300012984|Ga0164309_10599663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca860Open in IMG/M
3300013104|Ga0157370_11444484All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300013105|Ga0157369_11942545All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300014654|Ga0181525_10611942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca608Open in IMG/M
3300014657|Ga0181522_10033739All Organisms → cellular organisms → Bacteria2837Open in IMG/M
3300015245|Ga0137409_10179191All Organisms → cellular organisms → Bacteria1921Open in IMG/M
3300015371|Ga0132258_11264349Not Available1865Open in IMG/M
3300015372|Ga0132256_102798335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300015374|Ga0132255_101175368All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1155Open in IMG/M
3300016270|Ga0182036_10735062Not Available800Open in IMG/M
3300016270|Ga0182036_11331709Not Available600Open in IMG/M
3300016294|Ga0182041_12183535Not Available517Open in IMG/M
3300016387|Ga0182040_10945550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca716Open in IMG/M
3300016445|Ga0182038_12048176Not Available519Open in IMG/M
3300017926|Ga0187807_1137748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca777Open in IMG/M
3300017928|Ga0187806_1013635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2296Open in IMG/M
3300017946|Ga0187879_10730925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca551Open in IMG/M
3300018035|Ga0187875_10095378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1694Open in IMG/M
3300018057|Ga0187858_10460523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca782Open in IMG/M
3300018058|Ga0187766_10533585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca794Open in IMG/M
3300018058|Ga0187766_11224162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca544Open in IMG/M
3300020082|Ga0206353_10237942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura855Open in IMG/M
3300020580|Ga0210403_11106573Not Available615Open in IMG/M
3300020581|Ga0210399_11102664All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300021170|Ga0210400_10387679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1152Open in IMG/M
3300021178|Ga0210408_10123260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2044Open in IMG/M
3300021180|Ga0210396_11485807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca557Open in IMG/M
3300021401|Ga0210393_10142205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca1926Open in IMG/M
3300021402|Ga0210385_10295609All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300021403|Ga0210397_11257460Not Available575Open in IMG/M
3300021432|Ga0210384_11117422All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300021433|Ga0210391_10651704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca826Open in IMG/M
3300021478|Ga0210402_10668500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria961Open in IMG/M
3300021559|Ga0210409_10723948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca866Open in IMG/M
3300021560|Ga0126371_10234604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1944Open in IMG/M
3300022720|Ga0242672_1092699All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300025898|Ga0207692_10093983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1632Open in IMG/M
3300025898|Ga0207692_10218090All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300025906|Ga0207699_10115675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1726Open in IMG/M
3300025906|Ga0207699_10542623All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300025909|Ga0207705_11433949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300025910|Ga0207684_10254815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1514Open in IMG/M
3300025910|Ga0207684_10634877Not Available911Open in IMG/M
3300025915|Ga0207693_10227399Not Available1465Open in IMG/M
3300025915|Ga0207693_11467544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300025916|Ga0207663_10336636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1139Open in IMG/M
3300025916|Ga0207663_11292192Not Available588Open in IMG/M
3300025916|Ga0207663_11312021All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300025927|Ga0207687_10403859All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1124Open in IMG/M
3300025928|Ga0207700_12027328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces xanthii502Open in IMG/M
3300025932|Ga0207690_10536270All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium950Open in IMG/M
3300025941|Ga0207711_12007009Not Available521Open in IMG/M
3300025960|Ga0207651_11724504Not Available564Open in IMG/M
3300026023|Ga0207677_10351138Not Available1236Open in IMG/M
3300026078|Ga0207702_10585579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1094Open in IMG/M
3300026116|Ga0207674_11563824Not Available628Open in IMG/M
3300026121|Ga0207683_10017148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6166Open in IMG/M
3300026995|Ga0208761_1004756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1012Open in IMG/M
3300027787|Ga0209074_10029408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1558Open in IMG/M
3300027853|Ga0209274_10468824Not Available652Open in IMG/M
3300027867|Ga0209167_10622895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca591Open in IMG/M
3300027884|Ga0209275_10061823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1832Open in IMG/M
3300027884|Ga0209275_10413916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca762Open in IMG/M
3300027889|Ga0209380_10417769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca786Open in IMG/M
3300028379|Ga0268266_10301882Not Available1494Open in IMG/M
3300028806|Ga0302221_10226177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca818Open in IMG/M
3300028828|Ga0307312_10858847All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300028871|Ga0302230_10135800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca969Open in IMG/M
3300028877|Ga0302235_10024124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3245Open in IMG/M
3300029701|Ga0222748_1125985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca521Open in IMG/M
3300029910|Ga0311369_10800379All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300029951|Ga0311371_12105354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca593Open in IMG/M
3300030007|Ga0311338_11476669Not Available628Open in IMG/M
3300030490|Ga0302184_10188702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae872Open in IMG/M
3300030494|Ga0310037_10259469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia751Open in IMG/M
3300030494|Ga0310037_10474843All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300030520|Ga0311372_11102160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1031Open in IMG/M
3300030618|Ga0311354_11662111Not Available559Open in IMG/M
3300030906|Ga0302314_10905882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae865Open in IMG/M
3300031236|Ga0302324_100199993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3190Open in IMG/M
3300031525|Ga0302326_11174865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1058Open in IMG/M
3300031525|Ga0302326_11522355Not Available894Open in IMG/M
3300031561|Ga0318528_10510943Not Available645Open in IMG/M
3300031564|Ga0318573_10234718Not Available976Open in IMG/M
3300031564|Ga0318573_10717063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium537Open in IMG/M
3300031679|Ga0318561_10320981Not Available848Open in IMG/M
3300031680|Ga0318574_10419675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus782Open in IMG/M
3300031713|Ga0318496_10687080Not Available564Open in IMG/M
3300031751|Ga0318494_10300352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia926Open in IMG/M
3300031764|Ga0318535_10274309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium755Open in IMG/M
3300031764|Ga0318535_10507390Not Available536Open in IMG/M
3300031765|Ga0318554_10440267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300031765|Ga0318554_10564409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium642Open in IMG/M
3300031770|Ga0318521_11026002Not Available506Open in IMG/M
3300031781|Ga0318547_10745595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300031781|Ga0318547_11073876Not Available504Open in IMG/M
3300031782|Ga0318552_10565787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca580Open in IMG/M
3300031782|Ga0318552_10603785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca560Open in IMG/M
3300031782|Ga0318552_10648805Not Available538Open in IMG/M
3300031793|Ga0318548_10445369All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300031796|Ga0318576_10412731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium638Open in IMG/M
3300031819|Ga0318568_10651548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca655Open in IMG/M
3300031831|Ga0318564_10294177All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300031833|Ga0310917_11140242Not Available520Open in IMG/M
3300031912|Ga0306921_10886256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca1014Open in IMG/M
3300031942|Ga0310916_11403721Not Available572Open in IMG/M
3300031946|Ga0310910_10345702All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1175Open in IMG/M
3300032001|Ga0306922_11270789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca746Open in IMG/M
3300032001|Ga0306922_12283849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium519Open in IMG/M
3300032008|Ga0318562_10455772Not Available742Open in IMG/M
3300032035|Ga0310911_10201254Not Available1133Open in IMG/M
3300032041|Ga0318549_10280462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca751Open in IMG/M
3300032054|Ga0318570_10126449All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1133Open in IMG/M
3300032055|Ga0318575_10142870All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1186Open in IMG/M
3300032066|Ga0318514_10289669All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium865Open in IMG/M
3300032068|Ga0318553_10010197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4099Open in IMG/M
3300032076|Ga0306924_10648148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1191Open in IMG/M
3300032076|Ga0306924_11253717All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300032261|Ga0306920_100814251Not Available1370Open in IMG/M
3300032828|Ga0335080_10818992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium961Open in IMG/M
3300032828|Ga0335080_11907402Not Available577Open in IMG/M
3300032897|Ga0335071_10493657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1177Open in IMG/M
3300033134|Ga0335073_10446245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1497Open in IMG/M
3300033134|Ga0335073_11654933Not Available607Open in IMG/M
3300033290|Ga0318519_10239760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1046Open in IMG/M
3300034268|Ga0372943_0887431Not Available593Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere14.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.63%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.57%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.06%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.55%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.53%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.53%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.53%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.53%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.02%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.02%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.02%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.02%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.02%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.02%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.02%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.02%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.02%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.02%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.02%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.51%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.51%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.51%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.51%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26341J46601_1008945513300003219Bog Forest SoilAGEVVRAGRTLVVCRGEAFADDGQRPFAVMQATMTAVVGRSGISG*
Ga0062389_10039444113300004092Bog Forest SoilEVVRAGRTLVVCRGEAFADDGQRPFAVMQATMTAVVGRSGISG*
Ga0062389_10146002913300004092Bog Forest SoilTMTGEVIRAGRTLVVCRGEAFADDDKRPFAVMQATMTAVYSKSGITG*
Ga0066388_10105116923300005332Tropical Forest SoilMTGTVTRAGRTLVVCRGDAFADTATTPFAVMQATLTAVYDQPGIQQ*
Ga0070709_1061872923300005434Corn, Switchgrass And Miscanthus RhizosphereTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG*
Ga0070709_1125579713300005434Corn, Switchgrass And Miscanthus RhizosphereERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG*
Ga0070714_10023458113300005435Agricultural SoilERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG*
Ga0070714_10041957313300005435Agricultural SoilGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG*
Ga0070714_10170467013300005435Agricultural SoilGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRLGISG*
Ga0070713_10021691433300005436Corn, Switchgrass And Miscanthus RhizosphereEVVRAGRTLVVCRGEAFADGGKRPFAVMQATMTAVYGKAGISG*
Ga0070713_10100081533300005436Corn, Switchgrass And Miscanthus RhizosphereRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG*
Ga0070713_10183407613300005436Corn, Switchgrass And Miscanthus RhizosphereTGEVVRAGRTLVTCRGEAFADGGDRPFAAMQATMTAVYGKAGISG*
Ga0070710_1009984413300005437Corn, Switchgrass And Miscanthus RhizosphereAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG*
Ga0070711_10141887613300005439Corn, Switchgrass And Miscanthus RhizosphereGQRFTITGEVVRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKTGISG*
Ga0070706_10011243133300005467Corn, Switchgrass And Miscanthus RhizosphereVVRAGRTLVVCRGAAFADGDERPFAVMQATMTAVYHRPGISG*
Ga0070707_10178963023300005468Corn, Switchgrass And Miscanthus RhizosphereGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG*
Ga0070735_1000148113300005534Surface SoilRAGRTLVVCRGEAFADDADRPFAAMQATLTALYDRPGING*
Ga0068853_10006208543300005539Corn RhizosphereRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG*
Ga0070696_10057257613300005546Corn, Switchgrass And Miscanthus RhizosphereRFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG*
Ga0070665_10038329913300005548Switchgrass RhizosphereTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG*
Ga0068857_10191685413300005577Corn RhizosphereMAPPAGQRFTVTGEVVRAGRTLVTCRGEAFADSRDRPFAAMQATMTAVYGKAGISG*
Ga0068854_10056393213300005578Corn RhizosphereLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG*
Ga0066654_1017550023300005587SoilRTLVVCRGEAFADGDRRPFAIMQATMTALYNRPGISG*
Ga0070763_1016891233300005610SoilLVVCRGEAFADGASRPFAAMQATMTALYDRADLGG*
Ga0068856_10243524823300005614Corn RhizosphereEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTTLYNRPGISG*
Ga0068852_10032475513300005616Corn RhizosphereEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG*
Ga0066905_10014011623300005713Tropical Forest SoilMTGTVVRAGRTLVVCRGDAFADTDATPFAVMPATLTAVYDRPGIRH*
Ga0066903_10057477413300005764Tropical Forest SoilEVVRAGRTLVVCRGEAFADADRRPFAVMQATMTAVFGRPGISG*
Ga0070766_1012206653300005921SoilRFTMTGQVVRAGRTLVVCRGEAFADGAERPFAAMQATMTAVYDRPGLSG*
Ga0070766_1042890723300005921SoilLVVCRGEAFADGSQRPFAVMQATMTALYNRPGISG*
Ga0070766_1106855913300005921SoilVRAGRTLVVCRGEAFADGADRPFAAMQATMTALYDRPGMNG*
Ga0070717_1026892913300006028Corn, Switchgrass And Miscanthus RhizosphereRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGISG*
Ga0070717_1129520213300006028Corn, Switchgrass And Miscanthus RhizosphereTLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG*
Ga0075030_10095215333300006162WatershedsVVRAGRTLVVCRGEAFADGGQRPFAVMQATMTAVVGRPGISG*
Ga0070715_1027478133300006163Corn, Switchgrass And Miscanthus RhizosphereITGEVVRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG*
Ga0070716_10018757933300006173Corn, Switchgrass And Miscanthus RhizosphereTGEVVRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG*
Ga0070712_10106412513300006175Corn, Switchgrass And Miscanthus RhizospherePAAGRRFVITGEVIRAGRTLVVCHGEAVAEGAAAPFAVMQATLSAVYGRPGITH*
Ga0070712_10145910513300006175Corn, Switchgrass And Miscanthus RhizosphereERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTTLYNRPGISG*
Ga0070712_10161297023300006175Corn, Switchgrass And Miscanthus RhizosphereRFTITGEVVRAGRTLVVCRGEAFADGNKRPFAVMQATMTTLYNRPGISG*
Ga0070765_10203035613300006176SoilRTLVVCRGEAFADDAAVPFAVMQATMTTLVNRPGISG*
Ga0075021_1055197523300006354WatershedsLVVCRGEAFADTSQRPFAVMQATMTAIYNRPGISG*
Ga0079219_1015735423300006954Agricultural SoilGYAAGERFRMTGTVTRAGRTLVVCRGDAFADAAITPFAVMQATLTAVYDRPGIQH*
Ga0105247_1035995713300009101Switchgrass RhizosphereTGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG*
Ga0116133_104571913300009623PeatlandEVVRAGRTLVVCRGEAFADESQRPFAVMQATMTAVHNRGISG*
Ga0116105_113033613300009624PeatlandQVVRAGRTLVVCRAEAFADGDQRPFAVMQATMTAVYDRPGISG*
Ga0126380_1162471713300010043Tropical Forest SoilVAAGERFVMTGTVVRAGRTLVVCRGEAVASGAGVPATAGKAAPFAVMQATLTALYDRPGIRH*
Ga0126384_1204303713300010046Tropical Forest SoilGERFVMTGTVVRAGRTLVVCRGEAVASGAGVPATAGEAAPFAVMQATLTALYDRPGIRH*
Ga0126373_1111345423300010048Tropical Forest SoilVITGTVVRAGRTLVVCRGEAFTAGTAVPFAVMQATLTALYDRPGVRH*
Ga0126373_1269946123300010048Tropical Forest SoilAPAAGRQFEMTGEVVRAGRTLVVCRGEAVADGATTPFAVMQATLSAVYNRPGIAH*
Ga0123356_1295817933300010049Termite GutGRTLVVCRGEAAADGSQKPLAVMQSTLSAVYDRPGITH*
Ga0074044_1006320033300010343Bog Forest SoilMVCRGEAFADDDSRPFAIMQATMTALYNRAGLSG*
Ga0126378_1128925123300010361Tropical Forest SoilVVRAGRTLVVCRGDAFAGDAATPFAVMQATLTALYERPGVQH*
Ga0126378_1180495613300010361Tropical Forest SoilTVVRAGRTLVVCRGEAVASGAGVPATAGEAAPFAVMQATLTALYDRPGIRH*
Ga0126379_1037746553300010366Tropical Forest SoilAAGERFVMTGTVVRAGRTLVVCRGEAVASGAGVGAEAGEAAPFAVMQATLTALYDRPGIRH*
Ga0126379_1178408433300010366Tropical Forest SoilAAVLTATYSINVRAGRTLVVCRGEAVASGAGVPATAGEAAPFAVMQATLTALYDRPGIRH
Ga0134125_1059878723300010371Terrestrial SoilTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG*
Ga0126381_10371024423300010376Tropical Forest SoilMAPAEAPGIPPDGLAESAGARFRMTGTVTRAGRTLMVCRGDAFADTATAPFAVMQATLTAVYDRPGIQH*
Ga0136449_10153427123300010379Peatlands SoilFAITGEVVRAGRTLVVCRGEAFADGGQRPFAVMQATMTAVIGRADISG*
Ga0136449_10197671623300010379Peatlands SoilAITGEVVRAGRTLVVCRGEAFADDSQRPFAVMQATMTAVYGKPGIQG*
Ga0136449_10370509713300010379Peatlands SoilIGQVVRAGRNLVVCRGEAFADGAGRPFAAMQATMSAIYNRPGVSG*
Ga0136449_10424322413300010379Peatlands SoilTGEVVRAGRTLVVCRGEAFADDSQRPFAVMQATMTAVIGRPGING*
Ga0126383_1037729713300010398Tropical Forest SoilMTGTVVRAGRTLVVCRGDAFAGDAATPFAVMQATLTALYNRPGVQH*
Ga0126383_1059415113300010398Tropical Forest SoilAGRTLVVCRGDAFADTATTPFAVMQATLTTVYDRPGIQH*
Ga0126361_1077926343300010876Boreal Forest SoilVVRAGRTLVVCRGEAFADGDQRPFAVMQATMSVLNNRPDISG*
Ga0137776_180494833300010937SedimentGERFRMTGTVVRAGRTLVVCRGDAFADSAATPFAVMQATLTALFDRSGVHH*
Ga0137370_1100653923300012285Vadose Zone SoilVVCRGEAFADGDKRPFAIMQATMTALSGRPGLSG*
Ga0137407_1076642323300012930Vadose Zone SoilVVRAGRTLVVCRGEAFADGGGRPFAVMQATLTAVYGRTGISG*
Ga0126369_1183581833300012971Tropical Forest SoilERFVMTGTVVRAGRTLVVCRGEAVASGAGVPATAGEAAPFAVMQATLTALYDRPGIRH*
Ga0134110_1048634513300012975Grasslands SoilTGTVVRAGRTLVVCRGDAFAGDAASPFAVMQATLTALYDRPGVQH*
Ga0134087_1030280623300012977Grasslands SoilAGRTLIVCRGEAFADGGKRPFAVMQATMTAVYGKADISG*
Ga0164309_1059966323300012984SoilEVVRAGRTLVVCRGEAFADGDTRPFAVMQATLTAVYNRPSISG*
Ga0157370_1144448413300013104Corn RhizosphereTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG*
Ga0157369_1194254513300013105Corn RhizosphereRFVMTGEVIRAGRTLVVCRGEATADGAVKPFAVMQSTLSAVYNRPGITH*
Ga0181525_1061194213300014654BogAGQRFAMIGQVVRAGRTLVACRGEAFADGSERPFAIMQATMTAVYNRPGISG*
Ga0181522_1003373943300014657BogAPAAGQRFAITGSVVRAGRTLVVCRGEAFADDAAVPFAVMQATMTAVVNRPGISG*
Ga0137409_1017919143300015245Vadose Zone SoilAGRTLVVCHGEAFADDGTRPFAVMQATMTTLYNCPGISG*
Ga0132258_1126434913300015371Arabidopsis RhizosphereAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRTGISG*
Ga0132256_10279833523300015372Arabidopsis RhizosphereLVVCRGEAFADGDKRPFAVMQATMTALFGRTGISG*
Ga0132255_10117536823300015374Arabidopsis RhizosphereAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPEISG*
Ga0182036_1073506223300016270SoilVVRAGRTLVVCRGEAVCDGAAVPCAVMQATLTALYDRPGIQR
Ga0182036_1133170923300016270SoilGTVVRAGRTLVVCRGEATASGAGAPAVAGEAAPFAVMQATLTALYDRPGIRH
Ga0182041_1218353523300016294SoilMTGTVVRAGRTLVVCRGEATTAGAAVPFAVMQATLTAVYDRPGIRH
Ga0182040_1094555023300016387SoilGQVVRAGRTLVVCRGEAFGDGAAAPFAVMQATMTALYDRPGLRG
Ga0182038_1204817613300016445SoilVVRAGRTLVVCRGEAFADGAERPFAAMQATMTAQYDRPGVSG
Ga0187807_113774813300017926Freshwater SedimentLVVCRGEAFADGASRPFAAMQATMTALYDRPDLSG
Ga0187806_101363553300017928Freshwater SedimentAGRTLVVCRGEAFADGADRPFAVMQATMTALYDRPGISG
Ga0187879_1073092523300017946PeatlandVVRAGRTTVVCRGDAFADGDKRPFAIMQATMSVLHNRPDISG
Ga0187875_1009537823300018035PeatlandVLTGEVVRAGRTLVVCHGEAFGDGSQRPFAVMQATMTAVYGKGGISG
Ga0187858_1046052323300018057PeatlandGRTLVVCRGEAFADESQRPFAVMQATMTAVYNRPGISG
Ga0187766_1053358523300018058Tropical PeatlandVRAGRTLVVCRGEAFADGAERPFAAMQATMTALYGRPGVSG
Ga0187766_1122416223300018058Tropical PeatlandVVRAGRTLVVCRGEAFADGAERPFAAMQATMTALYDRPGVSG
Ga0206353_1023794213300020082Corn, Switchgrass And Miscanthus RhizosphereLVVCRGEAFADGGTRPFAVMQATMTALYNRPGVSG
Ga0210403_1110657323300020580SoilEVVRAGRTLIVCRGEAFADGGKRPFAVMQATMTAVYNRPGVSG
Ga0210399_1110266423300020581SoilAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGISG
Ga0210400_1038767933300021170SoilAGQRFTMTGQVVRAGRTLVVCRGEAFADGAGRPFAAMQATMTSLYDRPGLSG
Ga0210408_1012326013300021178SoilFTITGEVVRAGRTLVVCRGEAFADGGKRPFAVMQATMTAVYGKAGISG
Ga0210396_1148580713300021180SoilGRTLVVCRGEAFADGDKRPFAVMQATMTAVFDRPGIQG
Ga0210393_1014220543300021401SoilTLLGCGGEAFAYDASRPFAAMQATMTALYDRPDISG
Ga0210385_1029560913300021402SoilAGQRFTMTGQVVRAGRTLVVCRGEAFADGAGRPFAAMQATMTALYDRPGLSG
Ga0210397_1125746023300021403SoilGSRGGFRMTGAVVRAGRTLVVCRGDAFAAGAATPFAVMQATLTALYDRPGIRH
Ga0210384_1111742223300021432SoilRFTITGEVVRAGRTLVVCHGEAFADGGQRPFAVMQATMTAVYGKAGISG
Ga0210391_1065170423300021433SoilDRFAITGLVVRAGRTLVVCRGEAFAEGAAAPFAVMQATMMALYDRPGLSG
Ga0210402_1066850023300021478SoilMVTRAGRTFVVCRGDAFADTATTPFAVMQATLTAVYDRPGSEH
Ga0210409_1072394823300021559SoilGQVVRAGRTLVVCRGEAFADGASRPFAAMQATMTAVYDRPGLSG
Ga0126371_1023460443300021560Tropical Forest SoilAGRRFTMTGQVIRAGRTLVVCRGEALADGDERPFAVMQATMTALYNRPDLSG
Ga0242672_109269923300022720SoilFTITGEVVRTGRTLVVCRGEAFADGDKRPFAVMQATMTAVYNRPGISG
Ga0207692_1009398313300025898Corn, Switchgrass And Miscanthus RhizosphereAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG
Ga0207692_1021809013300025898Corn, Switchgrass And Miscanthus RhizosphereAGERFTITGEVVRAGRTLVVCRGEAFADGAKRPFAVMQATMTAVYAKAGISG
Ga0207699_1011567533300025906Corn, Switchgrass And Miscanthus RhizosphereERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG
Ga0207699_1054262323300025906Corn, Switchgrass And Miscanthus RhizosphereGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG
Ga0207705_1143394923300025909Corn RhizosphereRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG
Ga0207684_1025481523300025910Corn, Switchgrass And Miscanthus RhizosphereVVRAGRTLVVCRGAAFADGDERPFAVMQATMTAVYHRPGISG
Ga0207684_1063487713300025910Corn, Switchgrass And Miscanthus RhizosphereEVVRAGRTLVVCRGEAFAGGDTRPFAVMQATMTAVFGRPGLSG
Ga0207693_1022739913300025915Corn, Switchgrass And Miscanthus RhizosphereEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG
Ga0207693_1146754413300025915Corn, Switchgrass And Miscanthus RhizosphereEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTTLYNRPGISG
Ga0207663_1033663613300025916Corn, Switchgrass And Miscanthus RhizosphereTITGEVVRAGRTLVVCRGEAFADGAKRPFAVMQATMTAVYAKAGISG
Ga0207663_1129219213300025916Corn, Switchgrass And Miscanthus RhizosphereFTITGEVVRAGRTLVVCRGEAFADGGQRPFAAMQATMTAVYGKAGISG
Ga0207663_1131202133300025916Corn, Switchgrass And Miscanthus RhizosphereGQRFTITGEVVRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKTGISG
Ga0207687_1040385923300025927Miscanthus RhizosphereTLVVCRGEAFADGDKRPFAVMQATMTTLYNRPGISG
Ga0207700_1202732813300025928Corn, Switchgrass And Miscanthus RhizosphereFTITGEVVRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG
Ga0207690_1053627013300025932Corn RhizosphereTVEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGVSG
Ga0207711_1200700913300025941Switchgrass RhizosphereAGRTLVVCRGEAYADGDKRPFAVMQATMTALYNRPGISG
Ga0207651_1172450423300025960Switchgrass RhizosphereERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG
Ga0207677_1035113823300026023Miscanthus RhizosphereGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRSGVSG
Ga0207702_1058557933300026078Corn RhizosphereTLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG
Ga0207674_1156382423300026116Corn RhizosphereLPHAPTPRAPPAGQRFTVTGEVVRAGRTLVTCRGEAFADSRDRPFAAMQATMTAVYGKAGISG
Ga0207683_1001714813300026121Miscanthus RhizosphereEVVRAGRTLVVCRGEAFADGGQRPFAAMQATMTAVYGKAGISG
Ga0208761_100475623300026995SoilERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVSGRPGLSG
Ga0209074_1002940833300027787Agricultural SoilEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTSLFGRPGISG
Ga0209274_1046882413300027853SoilGQLFSITGSVVRAGRTLQVCRGEAFADDATVPFAVMQATMTALVNRPGITG
Ga0209167_1062289513300027867Surface SoilLVVCRGEAFADGADRPFAAMQATMTALYDRPGISG
Ga0209275_1006182333300027884SoilGRTLVVCRGEAFADDAAVPFAVMQATMTTLVNRPGISG
Ga0209275_1041391623300027884SoilAGRTLIVCRGQAFADGSERPFAAMQATMTAVRERPGLGG
Ga0209380_1041776923300027889SoilRFTMTGQVVRAGRTLVVCRGEAFADGAERPFAAMQATMTAVYDRPGLSG
Ga0268266_1030188223300028379Switchgrass RhizosphereTGEVVRAGRTLVVCRGEAFADGDKRPFAVMQAIMTALYNRPGISG
Ga0302221_1022617723300028806PalsaAMIGEVVRAGRTLVVCRGEAFADGGQRPFAVMQATMSAVYRPGFSG
Ga0307312_1085884713300028828SoilTGEVVRAGRTLVVCRGEAFADDGKRPFAVMQATMTTLYNRPGISG
Ga0302230_1013580033300028871PalsaGEVVRAGRTLVVCRGEAFAEGSQRPFAVMQATMTAVYDRPGISG
Ga0302235_1002412413300028877PalsaGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG
Ga0222748_112598523300029701SoilVVRAGRTLVVCRGEAFADGAGRPFAAMQATMTSLYDRPGLSG
Ga0311369_1080037913300029910PalsaSGQRFAMTGEVVRAGRTLVVCRGEAFADGSQRPFAAMQATMTAVYNRPGISE
Ga0311371_1210535413300029951PalsaEVVRAGRTLVVCRGEAFADGSQRPFAVMQATMSAVHNRPGISG
Ga0311338_1147666923300030007PalsaTLVVCRSEAFADGDKRPFAIMQATMTALYDRPDIKG
Ga0302184_1018870213300030490PalsaMIGEVVRAGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG
Ga0310037_1025946923300030494Peatlands SoilGRTLVVCRGEAFADGGQRPFAVMQATMTAIIGKAGIQG
Ga0310037_1047484323300030494Peatlands SoilAAGQRFTMTGQVVRAGRTLVVCRGEAFADGTDRPFAAIQATMTALYDRPGIVSG
Ga0311372_1110216023300030520PalsaGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPDIKG
Ga0311354_1166211133300030618PalsaLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG
Ga0302314_1090588233300030906PalsaIGEVVRAGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG
Ga0302324_10019999313300031236PalsaGEVVRAGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG
Ga0302326_1117486523300031525PalsaAMIGEVVRAGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPDIKG
Ga0302326_1152235513300031525PalsaAMIGEVVRAGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG
Ga0318528_1051094313300031561SoilVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRAGISG
Ga0318573_1023471823300031564SoilGERFRMTGTVTRAGRTLVVCRGDAFADTATTPFAVMQATLTAVYDRPGIQD
Ga0318573_1071706323300031564SoilVNAGCRAGRTLVVCRGDAFADSATTPFAVMQATLTAVYDRPGIRH
Ga0318561_1032098123300031679SoilTGTVTRAGQTLVVCRGDAFADSATTPFAVMQATLTAVYDRPGIRH
Ga0318574_1041967523300031680SoilIRAGRTLVVCRGDAFTDDAATPFAVMQATLTALYDRPGVQH
Ga0318496_1068708023300031713SoilTGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG
Ga0318494_1030035223300031751SoilTGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVVGRPGFSG
Ga0318535_1027430923300031764SoilVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVYGRPGIMG
Ga0318535_1050739013300031764SoilEVVRAGRTLVICRGEAFADGDQRPFAVMQATMTAVYNRPGIRG
Ga0318554_1044026723300031765SoilRFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVYGRPGITG
Ga0318554_1056440913300031765SoilRFRMTGTVTRAGRALVVCRGDAFADTATTPFAVMQATLTAVYDRPGIQD
Ga0318521_1102600213300031770SoilGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGVPA
Ga0318547_1074559523300031781SoilLTGEQFRMTGTVTRAGRTIVVCRGDAFADTATTPFAIMQATLTAVYDRPGIKH
Ga0318547_1107387613300031781SoilLVVCRGEAVCDGAAVPCAVMQATLTALYDRPGIQR
Ga0318552_1056578723300031782SoilTMTGQVIRAGRTLVVCRGEALADGDERPFAVMQATMTALYNRPDLSG
Ga0318552_1060378523300031782SoilGQVVRAGRTLVVCCGEAFTDGATAPFAVMQATMTALYDRPGLRG
Ga0318552_1064880513300031782SoilGERFVMTGTVVRAGRTLVVCRGEAVTTGAAAPFAVMQATLTAVYDRPGIRH
Ga0318548_1044536923300031793SoilRTLVVCRGEAFADGDKRPFAVMQATMTAVYGRPGIMG
Ga0318576_1041273113300031796SoilRFRMTGTVTRAGQTLVVCRGDAFADSATTPFAVMQATLTAVYDRPGIQD
Ga0318568_1065154823300031819SoilGRTLVVCRGEAFGDGAAAPFAVMQATMTALYDRPGLRG
Ga0318564_1029417723300031831SoilVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG
Ga0310917_1114024223300031833SoilVVRAGRTLVVCRGDAFTDGAATPFAVMQATLTALYDRPGVRH
Ga0306921_1088625613300031912SoilVVRAGRTLVVCRGEAFADGADRPFAVMQATMTALYDRPGVSG
Ga0310916_1140372113300031942SoilTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGHPGITG
Ga0310910_1034570223300031946SoilFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG
Ga0306922_1127078913300032001SoilVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGISG
Ga0306922_1228384913300032001SoilAGERFRMTGTVTRAGRTLVVCRGDAFADTATTPFAVMQATLTAVYDRPGIQH
Ga0318562_1045577213300032008SoilFRMTGTVTRAGRTIVVCRGDAFADTATAPFAIMQATLTAVYDRPGIKH
Ga0310911_1020125413300032035SoilERFRMTGTVTRAGRALVVCRGDAFADTATTPFAVMQATLTAVYDRPGIQD
Ga0318549_1028046213300032041SoilMTGQVVRAGRTLVVCRGEAFGDGAAAPFAVMQATMTALYDRPGPRG
Ga0318570_1012644913300032054SoilGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG
Ga0318575_1014287023300032055SoilTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG
Ga0318514_1028966923300032066SoilGRTLVVCRGEAFADGDKRPFAVMQATMTAVYGRPGIMG
Ga0318553_1001019713300032068SoilVVVRAGRTLVICRGEAFADGDQRPFAVMQATMTAVYNRPGIRG
Ga0306924_1064814813300032076SoilTGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVYGRPGITG
Ga0306924_1125371723300032076SoilVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG
Ga0306920_10081425113300032261SoilTGTVTRAGRTLVVCRGDAFADSATTPFAVMQATLTAVYDRPGIRH
Ga0335080_1081899213300032828SoilGRTLVVCRGEAFADGDQRPFAVMQATMTAVFGRPGITG
Ga0335080_1190740213300032828SoilVVRAGRTLVVCRGEAFADDDERPFAVMQATMTAVTGRPGLSG
Ga0335071_1049365723300032897SoilAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG
Ga0335073_1044624513300033134SoilRFVMTGEVVRAGRTLVVCRGEATVEGSAKPVAVMQSTLSAVYDRPGIAH
Ga0335073_1165493313300033134SoilTITGEVVRAGRTLVVCRGEAFADGVQRPFAVMQATMTAVFGRPGITG
Ga0318519_1023976013300033290SoilTLVVCRGEAFADGDQRPFALMQATMTAVYGRPGISG
Ga0372943_0887431_2_1093300034268SoilLVVCRGEAFPDGGDRPFAVMQATMTAVYGRTGISG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.