Basic Information | |
---|---|
Family ID | F027037 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 196 |
Average Sequence Length | 44 residues |
Representative Sequence | GEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG |
Number of Associated Samples | 157 |
Number of Associated Scaffolds | 196 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.06 % |
% of genes near scaffold ends (potentially truncated) | 91.84 % |
% of genes from short scaffolds (< 2000 bps) | 93.37 % |
Associated GOLD sequencing projects | 145 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.490 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.980 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.939 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.306 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.22% Coil/Unstructured: 77.78% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 196 Family Scaffolds |
---|---|---|
PF00117 | GATase | 17.35 |
PF04675 | DNA_ligase_A_N | 7.14 |
PF04672 | Methyltransf_19 | 2.04 |
PF07498 | Rho_N | 2.04 |
PF16640 | Big_3_5 | 1.02 |
PF08376 | NIT | 0.51 |
PF09084 | NMT1 | 0.51 |
PF00106 | adh_short | 0.51 |
PF09851 | SHOCT | 0.51 |
PF02656 | DUF202 | 0.51 |
PF00196 | GerE | 0.51 |
PF00296 | Bac_luciferase | 0.51 |
PF01663 | Phosphodiest | 0.51 |
PF01569 | PAP2 | 0.51 |
PF03176 | MMPL | 0.51 |
PF00085 | Thioredoxin | 0.51 |
COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
---|---|---|---|
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 7.14 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.51 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.51 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.51 |
COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.51 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.51 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.49 % |
Unclassified | root | N/A | 25.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003219|JGI26341J46601_10089455 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300004092|Ga0062389_100394441 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300004092|Ga0062389_101460029 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300005332|Ga0066388_101051169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1371 | Open in IMG/M |
3300005434|Ga0070709_10618729 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300005434|Ga0070709_11255797 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005435|Ga0070714_100234581 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
3300005435|Ga0070714_100419573 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300005435|Ga0070714_101704670 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005436|Ga0070713_100216914 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
3300005436|Ga0070713_101000815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 806 | Open in IMG/M |
3300005436|Ga0070713_101834076 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005437|Ga0070710_10099844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1726 | Open in IMG/M |
3300005439|Ga0070711_101418876 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300005467|Ga0070706_100112431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2535 | Open in IMG/M |
3300005468|Ga0070707_101789630 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300005534|Ga0070735_10001481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 22732 | Open in IMG/M |
3300005539|Ga0068853_100062085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3232 | Open in IMG/M |
3300005546|Ga0070696_100572576 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300005548|Ga0070665_100383299 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300005577|Ga0068857_101916854 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300005578|Ga0068854_100563932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
3300005587|Ga0066654_10175500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1101 | Open in IMG/M |
3300005610|Ga0070763_10168912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1152 | Open in IMG/M |
3300005614|Ga0068856_102435248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300005616|Ga0068852_100324755 | Not Available | 1495 | Open in IMG/M |
3300005713|Ga0066905_100140116 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
3300005764|Ga0066903_100574774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1943 | Open in IMG/M |
3300005921|Ga0070766_10122066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1567 | Open in IMG/M |
3300005921|Ga0070766_10428907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 870 | Open in IMG/M |
3300005921|Ga0070766_11068559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 556 | Open in IMG/M |
3300006028|Ga0070717_10268929 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300006028|Ga0070717_11295202 | Not Available | 662 | Open in IMG/M |
3300006162|Ga0075030_100952153 | Not Available | 676 | Open in IMG/M |
3300006163|Ga0070715_10274781 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300006173|Ga0070716_100187579 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300006175|Ga0070712_101064125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
3300006175|Ga0070712_101459105 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300006175|Ga0070712_101612970 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300006176|Ga0070765_102030356 | Not Available | 538 | Open in IMG/M |
3300006354|Ga0075021_10551975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 733 | Open in IMG/M |
3300006954|Ga0079219_10157354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1223 | Open in IMG/M |
3300009101|Ga0105247_10359957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
3300009623|Ga0116133_1045719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 1084 | Open in IMG/M |
3300009624|Ga0116105_1130336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 653 | Open in IMG/M |
3300010043|Ga0126380_11624717 | Not Available | 578 | Open in IMG/M |
3300010046|Ga0126384_12043037 | Not Available | 549 | Open in IMG/M |
3300010048|Ga0126373_11113454 | Not Available | 856 | Open in IMG/M |
3300010048|Ga0126373_12699461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 554 | Open in IMG/M |
3300010049|Ga0123356_12958179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
3300010343|Ga0074044_10063200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2516 | Open in IMG/M |
3300010361|Ga0126378_11289251 | Not Available | 826 | Open in IMG/M |
3300010361|Ga0126378_11804956 | Not Available | 695 | Open in IMG/M |
3300010366|Ga0126379_10377465 | Not Available | 1458 | Open in IMG/M |
3300010366|Ga0126379_11784084 | Not Available | 719 | Open in IMG/M |
3300010371|Ga0134125_10598787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1218 | Open in IMG/M |
3300010376|Ga0126381_103710244 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300010379|Ga0136449_101534271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1017 | Open in IMG/M |
3300010379|Ga0136449_101976716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 862 | Open in IMG/M |
3300010379|Ga0136449_103705097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 577 | Open in IMG/M |
3300010379|Ga0136449_104243224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 531 | Open in IMG/M |
3300010398|Ga0126383_10377297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 1448 | Open in IMG/M |
3300010398|Ga0126383_10594151 | Not Available | 1177 | Open in IMG/M |
3300010876|Ga0126361_10779263 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
3300010937|Ga0137776_1804948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2987 | Open in IMG/M |
3300012285|Ga0137370_11006539 | Not Available | 513 | Open in IMG/M |
3300012930|Ga0137407_10766423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 910 | Open in IMG/M |
3300012971|Ga0126369_11835818 | Not Available | 695 | Open in IMG/M |
3300012975|Ga0134110_10486345 | Not Available | 559 | Open in IMG/M |
3300012977|Ga0134087_10302806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
3300012984|Ga0164309_10599663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 860 | Open in IMG/M |
3300013104|Ga0157370_11444484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300013105|Ga0157369_11942545 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300014654|Ga0181525_10611942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 608 | Open in IMG/M |
3300014657|Ga0181522_10033739 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
3300015245|Ga0137409_10179191 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
3300015371|Ga0132258_11264349 | Not Available | 1865 | Open in IMG/M |
3300015372|Ga0132256_102798335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300015374|Ga0132255_101175368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1155 | Open in IMG/M |
3300016270|Ga0182036_10735062 | Not Available | 800 | Open in IMG/M |
3300016270|Ga0182036_11331709 | Not Available | 600 | Open in IMG/M |
3300016294|Ga0182041_12183535 | Not Available | 517 | Open in IMG/M |
3300016387|Ga0182040_10945550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 716 | Open in IMG/M |
3300016445|Ga0182038_12048176 | Not Available | 519 | Open in IMG/M |
3300017926|Ga0187807_1137748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 777 | Open in IMG/M |
3300017928|Ga0187806_1013635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2296 | Open in IMG/M |
3300017946|Ga0187879_10730925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 551 | Open in IMG/M |
3300018035|Ga0187875_10095378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1694 | Open in IMG/M |
3300018057|Ga0187858_10460523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 782 | Open in IMG/M |
3300018058|Ga0187766_10533585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 794 | Open in IMG/M |
3300018058|Ga0187766_11224162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 544 | Open in IMG/M |
3300020082|Ga0206353_10237942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 855 | Open in IMG/M |
3300020580|Ga0210403_11106573 | Not Available | 615 | Open in IMG/M |
3300020581|Ga0210399_11102664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300021170|Ga0210400_10387679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1152 | Open in IMG/M |
3300021178|Ga0210408_10123260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2044 | Open in IMG/M |
3300021180|Ga0210396_11485807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 557 | Open in IMG/M |
3300021401|Ga0210393_10142205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 1926 | Open in IMG/M |
3300021402|Ga0210385_10295609 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300021403|Ga0210397_11257460 | Not Available | 575 | Open in IMG/M |
3300021432|Ga0210384_11117422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300021433|Ga0210391_10651704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 826 | Open in IMG/M |
3300021478|Ga0210402_10668500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
3300021559|Ga0210409_10723948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 866 | Open in IMG/M |
3300021560|Ga0126371_10234604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1944 | Open in IMG/M |
3300022720|Ga0242672_1092699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300025898|Ga0207692_10093983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1632 | Open in IMG/M |
3300025898|Ga0207692_10218090 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300025906|Ga0207699_10115675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1726 | Open in IMG/M |
3300025906|Ga0207699_10542623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
3300025909|Ga0207705_11433949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300025910|Ga0207684_10254815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1514 | Open in IMG/M |
3300025910|Ga0207684_10634877 | Not Available | 911 | Open in IMG/M |
3300025915|Ga0207693_10227399 | Not Available | 1465 | Open in IMG/M |
3300025915|Ga0207693_11467544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300025916|Ga0207663_10336636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
3300025916|Ga0207663_11292192 | Not Available | 588 | Open in IMG/M |
3300025916|Ga0207663_11312021 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300025927|Ga0207687_10403859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1124 | Open in IMG/M |
3300025928|Ga0207700_12027328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces xanthii | 502 | Open in IMG/M |
3300025932|Ga0207690_10536270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
3300025941|Ga0207711_12007009 | Not Available | 521 | Open in IMG/M |
3300025960|Ga0207651_11724504 | Not Available | 564 | Open in IMG/M |
3300026023|Ga0207677_10351138 | Not Available | 1236 | Open in IMG/M |
3300026078|Ga0207702_10585579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1094 | Open in IMG/M |
3300026116|Ga0207674_11563824 | Not Available | 628 | Open in IMG/M |
3300026121|Ga0207683_10017148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6166 | Open in IMG/M |
3300026995|Ga0208761_1004756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1012 | Open in IMG/M |
3300027787|Ga0209074_10029408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1558 | Open in IMG/M |
3300027853|Ga0209274_10468824 | Not Available | 652 | Open in IMG/M |
3300027867|Ga0209167_10622895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 591 | Open in IMG/M |
3300027884|Ga0209275_10061823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1832 | Open in IMG/M |
3300027884|Ga0209275_10413916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 762 | Open in IMG/M |
3300027889|Ga0209380_10417769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 786 | Open in IMG/M |
3300028379|Ga0268266_10301882 | Not Available | 1494 | Open in IMG/M |
3300028806|Ga0302221_10226177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 818 | Open in IMG/M |
3300028828|Ga0307312_10858847 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300028871|Ga0302230_10135800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 969 | Open in IMG/M |
3300028877|Ga0302235_10024124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3245 | Open in IMG/M |
3300029701|Ga0222748_1125985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 521 | Open in IMG/M |
3300029910|Ga0311369_10800379 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300029951|Ga0311371_12105354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 593 | Open in IMG/M |
3300030007|Ga0311338_11476669 | Not Available | 628 | Open in IMG/M |
3300030490|Ga0302184_10188702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 872 | Open in IMG/M |
3300030494|Ga0310037_10259469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
3300030494|Ga0310037_10474843 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300030520|Ga0311372_11102160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1031 | Open in IMG/M |
3300030618|Ga0311354_11662111 | Not Available | 559 | Open in IMG/M |
3300030906|Ga0302314_10905882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 865 | Open in IMG/M |
3300031236|Ga0302324_100199993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3190 | Open in IMG/M |
3300031525|Ga0302326_11174865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1058 | Open in IMG/M |
3300031525|Ga0302326_11522355 | Not Available | 894 | Open in IMG/M |
3300031561|Ga0318528_10510943 | Not Available | 645 | Open in IMG/M |
3300031564|Ga0318573_10234718 | Not Available | 976 | Open in IMG/M |
3300031564|Ga0318573_10717063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 537 | Open in IMG/M |
3300031679|Ga0318561_10320981 | Not Available | 848 | Open in IMG/M |
3300031680|Ga0318574_10419675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 782 | Open in IMG/M |
3300031713|Ga0318496_10687080 | Not Available | 564 | Open in IMG/M |
3300031751|Ga0318494_10300352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 926 | Open in IMG/M |
3300031764|Ga0318535_10274309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
3300031764|Ga0318535_10507390 | Not Available | 536 | Open in IMG/M |
3300031765|Ga0318554_10440267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
3300031765|Ga0318554_10564409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 642 | Open in IMG/M |
3300031770|Ga0318521_11026002 | Not Available | 506 | Open in IMG/M |
3300031781|Ga0318547_10745595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300031781|Ga0318547_11073876 | Not Available | 504 | Open in IMG/M |
3300031782|Ga0318552_10565787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 580 | Open in IMG/M |
3300031782|Ga0318552_10603785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 560 | Open in IMG/M |
3300031782|Ga0318552_10648805 | Not Available | 538 | Open in IMG/M |
3300031793|Ga0318548_10445369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300031796|Ga0318576_10412731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 638 | Open in IMG/M |
3300031819|Ga0318568_10651548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 655 | Open in IMG/M |
3300031831|Ga0318564_10294177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300031833|Ga0310917_11140242 | Not Available | 520 | Open in IMG/M |
3300031912|Ga0306921_10886256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 1014 | Open in IMG/M |
3300031942|Ga0310916_11403721 | Not Available | 572 | Open in IMG/M |
3300031946|Ga0310910_10345702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1175 | Open in IMG/M |
3300032001|Ga0306922_11270789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 746 | Open in IMG/M |
3300032001|Ga0306922_12283849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 519 | Open in IMG/M |
3300032008|Ga0318562_10455772 | Not Available | 742 | Open in IMG/M |
3300032035|Ga0310911_10201254 | Not Available | 1133 | Open in IMG/M |
3300032041|Ga0318549_10280462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura graeca | 751 | Open in IMG/M |
3300032054|Ga0318570_10126449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
3300032055|Ga0318575_10142870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
3300032066|Ga0318514_10289669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
3300032068|Ga0318553_10010197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4099 | Open in IMG/M |
3300032076|Ga0306924_10648148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
3300032076|Ga0306924_11253717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
3300032261|Ga0306920_100814251 | Not Available | 1370 | Open in IMG/M |
3300032828|Ga0335080_10818992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
3300032828|Ga0335080_11907402 | Not Available | 577 | Open in IMG/M |
3300032897|Ga0335071_10493657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1177 | Open in IMG/M |
3300033134|Ga0335073_10446245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1497 | Open in IMG/M |
3300033134|Ga0335073_11654933 | Not Available | 607 | Open in IMG/M |
3300033290|Ga0318519_10239760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
3300034268|Ga0372943_0887431 | Not Available | 593 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.63% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.57% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.06% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.55% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.53% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.53% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.53% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.53% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.53% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.02% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.02% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.02% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.02% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.02% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.02% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.02% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.02% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.02% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.02% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.02% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.02% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.51% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.51% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.51% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI26341J46601_100894551 | 3300003219 | Bog Forest Soil | AGEVVRAGRTLVVCRGEAFADDGQRPFAVMQATMTAVVGRSGISG* |
Ga0062389_1003944411 | 3300004092 | Bog Forest Soil | EVVRAGRTLVVCRGEAFADDGQRPFAVMQATMTAVVGRSGISG* |
Ga0062389_1014600291 | 3300004092 | Bog Forest Soil | TMTGEVIRAGRTLVVCRGEAFADDDKRPFAVMQATMTAVYSKSGITG* |
Ga0066388_1010511692 | 3300005332 | Tropical Forest Soil | MTGTVTRAGRTLVVCRGDAFADTATTPFAVMQATLTAVYDQPGIQQ* |
Ga0070709_106187292 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG* |
Ga0070709_112557971 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG* |
Ga0070714_1002345811 | 3300005435 | Agricultural Soil | ERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG* |
Ga0070714_1004195731 | 3300005435 | Agricultural Soil | GEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG* |
Ga0070714_1017046701 | 3300005435 | Agricultural Soil | GEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRLGISG* |
Ga0070713_1002169143 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVRAGRTLVVCRGEAFADGGKRPFAVMQATMTAVYGKAGISG* |
Ga0070713_1010008153 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG* |
Ga0070713_1018340761 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TGEVVRAGRTLVTCRGEAFADGGDRPFAAMQATMTAVYGKAGISG* |
Ga0070710_100998441 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG* |
Ga0070711_1014188761 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GQRFTITGEVVRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKTGISG* |
Ga0070706_1001124313 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VVRAGRTLVVCRGAAFADGDERPFAVMQATMTAVYHRPGISG* |
Ga0070707_1017896302 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG* |
Ga0070735_100014811 | 3300005534 | Surface Soil | RAGRTLVVCRGEAFADDADRPFAAMQATLTALYDRPGING* |
Ga0068853_1000620854 | 3300005539 | Corn Rhizosphere | RAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG* |
Ga0070696_1005725761 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG* |
Ga0070665_1003832991 | 3300005548 | Switchgrass Rhizosphere | TITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG* |
Ga0068857_1019168541 | 3300005577 | Corn Rhizosphere | MAPPAGQRFTVTGEVVRAGRTLVTCRGEAFADSRDRPFAAMQATMTAVYGKAGISG* |
Ga0068854_1005639321 | 3300005578 | Corn Rhizosphere | LVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG* |
Ga0066654_101755002 | 3300005587 | Soil | RTLVVCRGEAFADGDRRPFAIMQATMTALYNRPGISG* |
Ga0070763_101689123 | 3300005610 | Soil | LVVCRGEAFADGASRPFAAMQATMTALYDRADLGG* |
Ga0068856_1024352482 | 3300005614 | Corn Rhizosphere | EVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTTLYNRPGISG* |
Ga0068852_1003247551 | 3300005616 | Corn Rhizosphere | EVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG* |
Ga0066905_1001401162 | 3300005713 | Tropical Forest Soil | MTGTVVRAGRTLVVCRGDAFADTDATPFAVMPATLTAVYDRPGIRH* |
Ga0066903_1005747741 | 3300005764 | Tropical Forest Soil | EVVRAGRTLVVCRGEAFADADRRPFAVMQATMTAVFGRPGISG* |
Ga0070766_101220665 | 3300005921 | Soil | RFTMTGQVVRAGRTLVVCRGEAFADGAERPFAAMQATMTAVYDRPGLSG* |
Ga0070766_104289072 | 3300005921 | Soil | LVVCRGEAFADGSQRPFAVMQATMTALYNRPGISG* |
Ga0070766_110685591 | 3300005921 | Soil | VRAGRTLVVCRGEAFADGADRPFAAMQATMTALYDRPGMNG* |
Ga0070717_102689291 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGISG* |
Ga0070717_112952021 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG* |
Ga0075030_1009521533 | 3300006162 | Watersheds | VVRAGRTLVVCRGEAFADGGQRPFAVMQATMTAVVGRPGISG* |
Ga0070715_102747813 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ITGEVVRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG* |
Ga0070716_1001875793 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TGEVVRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG* |
Ga0070712_1010641251 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PAAGRRFVITGEVIRAGRTLVVCHGEAVAEGAAAPFAVMQATLSAVYGRPGITH* |
Ga0070712_1014591051 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTTLYNRPGISG* |
Ga0070712_1016129702 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RFTITGEVVRAGRTLVVCRGEAFADGNKRPFAVMQATMTTLYNRPGISG* |
Ga0070765_1020303561 | 3300006176 | Soil | RTLVVCRGEAFADDAAVPFAVMQATMTTLVNRPGISG* |
Ga0075021_105519752 | 3300006354 | Watersheds | LVVCRGEAFADTSQRPFAVMQATMTAIYNRPGISG* |
Ga0079219_101573542 | 3300006954 | Agricultural Soil | GYAAGERFRMTGTVTRAGRTLVVCRGDAFADAAITPFAVMQATLTAVYDRPGIQH* |
Ga0105247_103599571 | 3300009101 | Switchgrass Rhizosphere | TGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG* |
Ga0116133_10457191 | 3300009623 | Peatland | EVVRAGRTLVVCRGEAFADESQRPFAVMQATMTAVHNRGISG* |
Ga0116105_11303361 | 3300009624 | Peatland | QVVRAGRTLVVCRAEAFADGDQRPFAVMQATMTAVYDRPGISG* |
Ga0126380_116247171 | 3300010043 | Tropical Forest Soil | VAAGERFVMTGTVVRAGRTLVVCRGEAVASGAGVPATAGKAAPFAVMQATLTALYDRPGIRH* |
Ga0126384_120430371 | 3300010046 | Tropical Forest Soil | GERFVMTGTVVRAGRTLVVCRGEAVASGAGVPATAGEAAPFAVMQATLTALYDRPGIRH* |
Ga0126373_111134542 | 3300010048 | Tropical Forest Soil | VITGTVVRAGRTLVVCRGEAFTAGTAVPFAVMQATLTALYDRPGVRH* |
Ga0126373_126994612 | 3300010048 | Tropical Forest Soil | APAAGRQFEMTGEVVRAGRTLVVCRGEAVADGATTPFAVMQATLSAVYNRPGIAH* |
Ga0123356_129581793 | 3300010049 | Termite Gut | GRTLVVCRGEAAADGSQKPLAVMQSTLSAVYDRPGITH* |
Ga0074044_100632003 | 3300010343 | Bog Forest Soil | MVCRGEAFADDDSRPFAIMQATMTALYNRAGLSG* |
Ga0126378_112892512 | 3300010361 | Tropical Forest Soil | VVRAGRTLVVCRGDAFAGDAATPFAVMQATLTALYERPGVQH* |
Ga0126378_118049561 | 3300010361 | Tropical Forest Soil | TVVRAGRTLVVCRGEAVASGAGVPATAGEAAPFAVMQATLTALYDRPGIRH* |
Ga0126379_103774655 | 3300010366 | Tropical Forest Soil | AAGERFVMTGTVVRAGRTLVVCRGEAVASGAGVGAEAGEAAPFAVMQATLTALYDRPGIRH* |
Ga0126379_117840843 | 3300010366 | Tropical Forest Soil | AAVLTATYSINVRAGRTLVVCRGEAVASGAGVPATAGEAAPFAVMQATLTALYDRPGIRH |
Ga0134125_105987872 | 3300010371 | Terrestrial Soil | TLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG* |
Ga0126381_1037102442 | 3300010376 | Tropical Forest Soil | MAPAEAPGIPPDGLAESAGARFRMTGTVTRAGRTLMVCRGDAFADTATAPFAVMQATLTAVYDRPGIQH* |
Ga0136449_1015342712 | 3300010379 | Peatlands Soil | FAITGEVVRAGRTLVVCRGEAFADGGQRPFAVMQATMTAVIGRADISG* |
Ga0136449_1019767162 | 3300010379 | Peatlands Soil | AITGEVVRAGRTLVVCRGEAFADDSQRPFAVMQATMTAVYGKPGIQG* |
Ga0136449_1037050971 | 3300010379 | Peatlands Soil | IGQVVRAGRNLVVCRGEAFADGAGRPFAAMQATMSAIYNRPGVSG* |
Ga0136449_1042432241 | 3300010379 | Peatlands Soil | TGEVVRAGRTLVVCRGEAFADDSQRPFAVMQATMTAVIGRPGING* |
Ga0126383_103772971 | 3300010398 | Tropical Forest Soil | MTGTVVRAGRTLVVCRGDAFAGDAATPFAVMQATLTALYNRPGVQH* |
Ga0126383_105941511 | 3300010398 | Tropical Forest Soil | AGRTLVVCRGDAFADTATTPFAVMQATLTTVYDRPGIQH* |
Ga0126361_107792634 | 3300010876 | Boreal Forest Soil | VVRAGRTLVVCRGEAFADGDQRPFAVMQATMSVLNNRPDISG* |
Ga0137776_18049483 | 3300010937 | Sediment | GERFRMTGTVVRAGRTLVVCRGDAFADSAATPFAVMQATLTALFDRSGVHH* |
Ga0137370_110065392 | 3300012285 | Vadose Zone Soil | VVCRGEAFADGDKRPFAIMQATMTALSGRPGLSG* |
Ga0137407_107664232 | 3300012930 | Vadose Zone Soil | VVRAGRTLVVCRGEAFADGGGRPFAVMQATLTAVYGRTGISG* |
Ga0126369_118358183 | 3300012971 | Tropical Forest Soil | ERFVMTGTVVRAGRTLVVCRGEAVASGAGVPATAGEAAPFAVMQATLTALYDRPGIRH* |
Ga0134110_104863451 | 3300012975 | Grasslands Soil | TGTVVRAGRTLVVCRGDAFAGDAASPFAVMQATLTALYDRPGVQH* |
Ga0134087_103028062 | 3300012977 | Grasslands Soil | AGRTLIVCRGEAFADGGKRPFAVMQATMTAVYGKADISG* |
Ga0164309_105996632 | 3300012984 | Soil | EVVRAGRTLVVCRGEAFADGDTRPFAVMQATLTAVYNRPSISG* |
Ga0157370_114444841 | 3300013104 | Corn Rhizosphere | TLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG* |
Ga0157369_119425451 | 3300013105 | Corn Rhizosphere | RFVMTGEVIRAGRTLVVCRGEATADGAVKPFAVMQSTLSAVYNRPGITH* |
Ga0181525_106119421 | 3300014654 | Bog | AGQRFAMIGQVVRAGRTLVACRGEAFADGSERPFAIMQATMTAVYNRPGISG* |
Ga0181522_100337394 | 3300014657 | Bog | APAAGQRFAITGSVVRAGRTLVVCRGEAFADDAAVPFAVMQATMTAVVNRPGISG* |
Ga0137409_101791914 | 3300015245 | Vadose Zone Soil | AGRTLVVCHGEAFADDGTRPFAVMQATMTTLYNCPGISG* |
Ga0132258_112643491 | 3300015371 | Arabidopsis Rhizosphere | AGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRTGISG* |
Ga0132256_1027983352 | 3300015372 | Arabidopsis Rhizosphere | LVVCRGEAFADGDKRPFAVMQATMTALFGRTGISG* |
Ga0132255_1011753682 | 3300015374 | Arabidopsis Rhizosphere | AGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPEISG* |
Ga0182036_107350622 | 3300016270 | Soil | VVRAGRTLVVCRGEAVCDGAAVPCAVMQATLTALYDRPGIQR |
Ga0182036_113317092 | 3300016270 | Soil | GTVVRAGRTLVVCRGEATASGAGAPAVAGEAAPFAVMQATLTALYDRPGIRH |
Ga0182041_121835352 | 3300016294 | Soil | MTGTVVRAGRTLVVCRGEATTAGAAVPFAVMQATLTAVYDRPGIRH |
Ga0182040_109455502 | 3300016387 | Soil | GQVVRAGRTLVVCRGEAFGDGAAAPFAVMQATMTALYDRPGLRG |
Ga0182038_120481761 | 3300016445 | Soil | VVRAGRTLVVCRGEAFADGAERPFAAMQATMTAQYDRPGVSG |
Ga0187807_11377481 | 3300017926 | Freshwater Sediment | LVVCRGEAFADGASRPFAAMQATMTALYDRPDLSG |
Ga0187806_10136355 | 3300017928 | Freshwater Sediment | AGRTLVVCRGEAFADGADRPFAVMQATMTALYDRPGISG |
Ga0187879_107309252 | 3300017946 | Peatland | VVRAGRTTVVCRGDAFADGDKRPFAIMQATMSVLHNRPDISG |
Ga0187875_100953782 | 3300018035 | Peatland | VLTGEVVRAGRTLVVCHGEAFGDGSQRPFAVMQATMTAVYGKGGISG |
Ga0187858_104605232 | 3300018057 | Peatland | GRTLVVCRGEAFADESQRPFAVMQATMTAVYNRPGISG |
Ga0187766_105335852 | 3300018058 | Tropical Peatland | VRAGRTLVVCRGEAFADGAERPFAAMQATMTALYGRPGVSG |
Ga0187766_112241622 | 3300018058 | Tropical Peatland | VVRAGRTLVVCRGEAFADGAERPFAAMQATMTALYDRPGVSG |
Ga0206353_102379421 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | LVVCRGEAFADGGTRPFAVMQATMTALYNRPGVSG |
Ga0210403_111065732 | 3300020580 | Soil | EVVRAGRTLIVCRGEAFADGGKRPFAVMQATMTAVYNRPGVSG |
Ga0210399_111026642 | 3300020581 | Soil | AGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGISG |
Ga0210400_103876793 | 3300021170 | Soil | AGQRFTMTGQVVRAGRTLVVCRGEAFADGAGRPFAAMQATMTSLYDRPGLSG |
Ga0210408_101232601 | 3300021178 | Soil | FTITGEVVRAGRTLVVCRGEAFADGGKRPFAVMQATMTAVYGKAGISG |
Ga0210396_114858071 | 3300021180 | Soil | GRTLVVCRGEAFADGDKRPFAVMQATMTAVFDRPGIQG |
Ga0210393_101422054 | 3300021401 | Soil | TLLGCGGEAFAYDASRPFAAMQATMTALYDRPDISG |
Ga0210385_102956091 | 3300021402 | Soil | AGQRFTMTGQVVRAGRTLVVCRGEAFADGAGRPFAAMQATMTALYDRPGLSG |
Ga0210397_112574602 | 3300021403 | Soil | GSRGGFRMTGAVVRAGRTLVVCRGDAFAAGAATPFAVMQATLTALYDRPGIRH |
Ga0210384_111174222 | 3300021432 | Soil | RFTITGEVVRAGRTLVVCHGEAFADGGQRPFAVMQATMTAVYGKAGISG |
Ga0210391_106517042 | 3300021433 | Soil | DRFAITGLVVRAGRTLVVCRGEAFAEGAAAPFAVMQATMMALYDRPGLSG |
Ga0210402_106685002 | 3300021478 | Soil | MVTRAGRTFVVCRGDAFADTATTPFAVMQATLTAVYDRPGSEH |
Ga0210409_107239482 | 3300021559 | Soil | GQVVRAGRTLVVCRGEAFADGASRPFAAMQATMTAVYDRPGLSG |
Ga0126371_102346044 | 3300021560 | Tropical Forest Soil | AGRRFTMTGQVIRAGRTLVVCRGEALADGDERPFAVMQATMTALYNRPDLSG |
Ga0242672_10926992 | 3300022720 | Soil | FTITGEVVRTGRTLVVCRGEAFADGDKRPFAVMQATMTAVYNRPGISG |
Ga0207692_100939831 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG |
Ga0207692_102180901 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AGERFTITGEVVRAGRTLVVCRGEAFADGAKRPFAVMQATMTAVYAKAGISG |
Ga0207699_101156753 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG |
Ga0207699_105426232 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG |
Ga0207705_114339492 | 3300025909 | Corn Rhizosphere | RAGRTLVVCRGEAFADGDKRPFAVMQATMTALFGRPGISG |
Ga0207684_102548152 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VVRAGRTLVVCRGAAFADGDERPFAVMQATMTAVYHRPGISG |
Ga0207684_106348771 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVRAGRTLVVCRGEAFAGGDTRPFAVMQATMTAVFGRPGLSG |
Ga0207693_102273991 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG |
Ga0207693_114675441 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTTLYNRPGISG |
Ga0207663_103366361 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TITGEVVRAGRTLVVCRGEAFADGAKRPFAVMQATMTAVYAKAGISG |
Ga0207663_112921921 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FTITGEVVRAGRTLVVCRGEAFADGGQRPFAAMQATMTAVYGKAGISG |
Ga0207663_113120213 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GQRFTITGEVVRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKTGISG |
Ga0207687_104038592 | 3300025927 | Miscanthus Rhizosphere | TLVVCRGEAFADGDKRPFAVMQATMTTLYNRPGISG |
Ga0207700_120273281 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FTITGEVVRAGRTLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG |
Ga0207690_105362701 | 3300025932 | Corn Rhizosphere | TVEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGVSG |
Ga0207711_120070091 | 3300025941 | Switchgrass Rhizosphere | AGRTLVVCRGEAYADGDKRPFAVMQATMTALYNRPGISG |
Ga0207651_117245042 | 3300025960 | Switchgrass Rhizosphere | ERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTALYNRPGISG |
Ga0207677_103511382 | 3300026023 | Miscanthus Rhizosphere | GRTLVVCRGEAFADGDKRPFAVMQATMTALYNRSGVSG |
Ga0207702_105855793 | 3300026078 | Corn Rhizosphere | TLVICRGEAFADGGDRPFAAMQATMTAVYGKAGISG |
Ga0207674_115638242 | 3300026116 | Corn Rhizosphere | LPHAPTPRAPPAGQRFTVTGEVVRAGRTLVTCRGEAFADSRDRPFAAMQATMTAVYGKAGISG |
Ga0207683_100171481 | 3300026121 | Miscanthus Rhizosphere | EVVRAGRTLVVCRGEAFADGGQRPFAAMQATMTAVYGKAGISG |
Ga0208761_10047562 | 3300026995 | Soil | ERFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVSGRPGLSG |
Ga0209074_100294083 | 3300027787 | Agricultural Soil | EVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTSLFGRPGISG |
Ga0209274_104688241 | 3300027853 | Soil | GQLFSITGSVVRAGRTLQVCRGEAFADDATVPFAVMQATMTALVNRPGITG |
Ga0209167_106228951 | 3300027867 | Surface Soil | LVVCRGEAFADGADRPFAAMQATMTALYDRPGISG |
Ga0209275_100618233 | 3300027884 | Soil | GRTLVVCRGEAFADDAAVPFAVMQATMTTLVNRPGISG |
Ga0209275_104139162 | 3300027884 | Soil | AGRTLIVCRGQAFADGSERPFAAMQATMTAVRERPGLGG |
Ga0209380_104177692 | 3300027889 | Soil | RFTMTGQVVRAGRTLVVCRGEAFADGAERPFAAMQATMTAVYDRPGLSG |
Ga0268266_103018822 | 3300028379 | Switchgrass Rhizosphere | TGEVVRAGRTLVVCRGEAFADGDKRPFAVMQAIMTALYNRPGISG |
Ga0302221_102261772 | 3300028806 | Palsa | AMIGEVVRAGRTLVVCRGEAFADGGQRPFAVMQATMSAVYRPGFSG |
Ga0307312_108588471 | 3300028828 | Soil | TGEVVRAGRTLVVCRGEAFADDGKRPFAVMQATMTTLYNRPGISG |
Ga0302230_101358003 | 3300028871 | Palsa | GEVVRAGRTLVVCRGEAFAEGSQRPFAVMQATMTAVYDRPGISG |
Ga0302235_100241241 | 3300028877 | Palsa | GRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG |
Ga0222748_11259852 | 3300029701 | Soil | VVRAGRTLVVCRGEAFADGAGRPFAAMQATMTSLYDRPGLSG |
Ga0311369_108003791 | 3300029910 | Palsa | SGQRFAMTGEVVRAGRTLVVCRGEAFADGSQRPFAAMQATMTAVYNRPGISE |
Ga0311371_121053541 | 3300029951 | Palsa | EVVRAGRTLVVCRGEAFADGSQRPFAVMQATMSAVHNRPGISG |
Ga0311338_114766692 | 3300030007 | Palsa | TLVVCRSEAFADGDKRPFAIMQATMTALYDRPDIKG |
Ga0302184_101887021 | 3300030490 | Palsa | MIGEVVRAGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG |
Ga0310037_102594692 | 3300030494 | Peatlands Soil | GRTLVVCRGEAFADGGQRPFAVMQATMTAIIGKAGIQG |
Ga0310037_104748432 | 3300030494 | Peatlands Soil | AAGQRFTMTGQVVRAGRTLVVCRGEAFADGTDRPFAAIQATMTALYDRPGIVSG |
Ga0311372_111021602 | 3300030520 | Palsa | GRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPDIKG |
Ga0311354_116621113 | 3300030618 | Palsa | LVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG |
Ga0302314_109058823 | 3300030906 | Palsa | IGEVVRAGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG |
Ga0302324_1001999931 | 3300031236 | Palsa | GEVVRAGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG |
Ga0302326_111748652 | 3300031525 | Palsa | AMIGEVVRAGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPDIKG |
Ga0302326_115223551 | 3300031525 | Palsa | AMIGEVVRAGRTLVVCRSEAFADGDKRPFAIMQATMTALYDRPGIKG |
Ga0318528_105109431 | 3300031561 | Soil | VVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRAGISG |
Ga0318573_102347182 | 3300031564 | Soil | GERFRMTGTVTRAGRTLVVCRGDAFADTATTPFAVMQATLTAVYDRPGIQD |
Ga0318573_107170632 | 3300031564 | Soil | VNAGCRAGRTLVVCRGDAFADSATTPFAVMQATLTAVYDRPGIRH |
Ga0318561_103209812 | 3300031679 | Soil | TGTVTRAGQTLVVCRGDAFADSATTPFAVMQATLTAVYDRPGIRH |
Ga0318574_104196752 | 3300031680 | Soil | IRAGRTLVVCRGDAFTDDAATPFAVMQATLTALYDRPGVQH |
Ga0318496_106870802 | 3300031713 | Soil | TGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG |
Ga0318494_103003522 | 3300031751 | Soil | TGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVVGRPGFSG |
Ga0318535_102743092 | 3300031764 | Soil | VVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVYGRPGIMG |
Ga0318535_105073901 | 3300031764 | Soil | EVVRAGRTLVICRGEAFADGDQRPFAVMQATMTAVYNRPGIRG |
Ga0318554_104402672 | 3300031765 | Soil | RFTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVYGRPGITG |
Ga0318554_105644091 | 3300031765 | Soil | RFRMTGTVTRAGRALVVCRGDAFADTATTPFAVMQATLTAVYDRPGIQD |
Ga0318521_110260021 | 3300031770 | Soil | GRTLVVCRGEAFADGDKRPFAVMQATMTAVFGVPA |
Ga0318547_107455952 | 3300031781 | Soil | LTGEQFRMTGTVTRAGRTIVVCRGDAFADTATTPFAIMQATLTAVYDRPGIKH |
Ga0318547_110738761 | 3300031781 | Soil | LVVCRGEAVCDGAAVPCAVMQATLTALYDRPGIQR |
Ga0318552_105657872 | 3300031782 | Soil | TMTGQVIRAGRTLVVCRGEALADGDERPFAVMQATMTALYNRPDLSG |
Ga0318552_106037852 | 3300031782 | Soil | GQVVRAGRTLVVCCGEAFTDGATAPFAVMQATMTALYDRPGLRG |
Ga0318552_106488051 | 3300031782 | Soil | GERFVMTGTVVRAGRTLVVCRGEAVTTGAAAPFAVMQATLTAVYDRPGIRH |
Ga0318548_104453692 | 3300031793 | Soil | RTLVVCRGEAFADGDKRPFAVMQATMTAVYGRPGIMG |
Ga0318576_104127311 | 3300031796 | Soil | RFRMTGTVTRAGQTLVVCRGDAFADSATTPFAVMQATLTAVYDRPGIQD |
Ga0318568_106515482 | 3300031819 | Soil | GRTLVVCRGEAFGDGAAAPFAVMQATMTALYDRPGLRG |
Ga0318564_102941772 | 3300031831 | Soil | VRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG |
Ga0310917_111402422 | 3300031833 | Soil | VVRAGRTLVVCRGDAFTDGAATPFAVMQATLTALYDRPGVRH |
Ga0306921_108862561 | 3300031912 | Soil | VVRAGRTLVVCRGEAFADGADRPFAVMQATMTALYDRPGVSG |
Ga0310916_114037211 | 3300031942 | Soil | TITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGHPGITG |
Ga0310910_103457022 | 3300031946 | Soil | FTITGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG |
Ga0306922_112707891 | 3300032001 | Soil | VRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGISG |
Ga0306922_122838491 | 3300032001 | Soil | AGERFRMTGTVTRAGRTLVVCRGDAFADTATTPFAVMQATLTAVYDRPGIQH |
Ga0318562_104557721 | 3300032008 | Soil | FRMTGTVTRAGRTIVVCRGDAFADTATAPFAIMQATLTAVYDRPGIKH |
Ga0310911_102012541 | 3300032035 | Soil | ERFRMTGTVTRAGRALVVCRGDAFADTATTPFAVMQATLTAVYDRPGIQD |
Ga0318549_102804621 | 3300032041 | Soil | MTGQVVRAGRTLVVCRGEAFGDGAAAPFAVMQATMTALYDRPGPRG |
Ga0318570_101264491 | 3300032054 | Soil | GRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG |
Ga0318575_101428702 | 3300032055 | Soil | TLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG |
Ga0318514_102896692 | 3300032066 | Soil | GRTLVVCRGEAFADGDKRPFAVMQATMTAVYGRPGIMG |
Ga0318553_100101971 | 3300032068 | Soil | VVVRAGRTLVICRGEAFADGDQRPFAVMQATMTAVYNRPGIRG |
Ga0306924_106481481 | 3300032076 | Soil | TGEVVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVYGRPGITG |
Ga0306924_112537172 | 3300032076 | Soil | VVRAGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG |
Ga0306920_1008142511 | 3300032261 | Soil | TGTVTRAGRTLVVCRGDAFADSATTPFAVMQATLTAVYDRPGIRH |
Ga0335080_108189921 | 3300032828 | Soil | GRTLVVCRGEAFADGDQRPFAVMQATMTAVFGRPGITG |
Ga0335080_119074021 | 3300032828 | Soil | VVRAGRTLVVCRGEAFADDDERPFAVMQATMTAVTGRPGLSG |
Ga0335071_104936572 | 3300032897 | Soil | AGRTLVVCRGEAFADGDKRPFAVMQATMTAVFGRPGITG |
Ga0335073_104462451 | 3300033134 | Soil | RFVMTGEVVRAGRTLVVCRGEATVEGSAKPVAVMQSTLSAVYDRPGIAH |
Ga0335073_116549331 | 3300033134 | Soil | TITGEVVRAGRTLVVCRGEAFADGVQRPFAVMQATMTAVFGRPGITG |
Ga0318519_102397601 | 3300033290 | Soil | TLVVCRGEAFADGDQRPFALMQATMTAVYGRPGISG |
Ga0372943_0887431_2_109 | 3300034268 | Soil | LVVCRGEAFPDGGDRPFAVMQATMTAVYGRTGISG |
⦗Top⦘ |