NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027321

Metagenome / Metatranscriptome Family F027321

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027321
Family Type Metagenome / Metatranscriptome
Number of Sequences 195
Average Sequence Length 48 residues
Representative Sequence EKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF
Number of Associated Samples 140
Number of Associated Scaffolds 195

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.08 %
% of genes near scaffold ends (potentially truncated) 95.38 %
% of genes from short scaffolds (< 2000 bps) 91.79 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.821 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(24.615 % of family members)
Environment Ontology (ENVO) Unclassified
(21.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.103 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.84%    β-sheet: 0.00%    Coil/Unstructured: 56.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 195 Family Scaffolds
PF00675Peptidase_M16 8.72
PF08546ApbA_C 6.15
PF03401TctC 2.56
PF00106adh_short 2.05
PF00211Guanylate_cyc 2.05
PF00816Histone_HNS 1.54
PF13688Reprolysin_5 1.54
PF15902Sortilin-Vps10 1.54
PF00289Biotin_carb_N 1.03
PF00072Response_reg 0.51
PF07729FCD 0.51
PF05193Peptidase_M16_C 0.51
PF00581Rhodanese 0.51
PF01734Patatin 0.51
PF08281Sigma70_r4_2 0.51
PF01746tRNA_m1G_MT 0.51
PF04542Sigma70_r2 0.51
PF03781FGE-sulfatase 0.51
PF00080Sod_Cu 0.51
PF00486Trans_reg_C 0.51
PF13431TPR_17 0.51
PF00872Transposase_mut 0.51
PF12773DZR 0.51
PF02784Orn_Arg_deC_N 0.51
PF00296Bac_luciferase 0.51
PF12849PBP_like_2 0.51
PF00498FHA 0.51
PF02321OEP 0.51
PF10282Lactonase 0.51
PF11305DUF3107 0.51
PF01266DAO 0.51
PF13442Cytochrome_CBB3 0.51
PF03080Neprosin 0.51
PF03807F420_oxidored 0.51
PF06827zf-FPG_IleRS 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 195 Family Scaffolds
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 6.15
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.56
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 2.05
COG2916DNA-binding protein H-NSTranscription [K] 1.54
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.03
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 0.51
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.51
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 0.51
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.51
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.51
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.51
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.51
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.51
COG2032Cu/Zn superoxide dismutaseInorganic ion transport and metabolism [P] 0.51
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.51
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.51
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.51
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.51
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.51
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.33 %
UnclassifiedrootN/A6.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0843886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium559Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105876144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium590Open in IMG/M
3300000881|JGI10215J12807_1088558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1095Open in IMG/M
3300001431|F14TB_101542013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium692Open in IMG/M
3300004156|Ga0062589_101017302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium776Open in IMG/M
3300004281|Ga0066397_10140270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium544Open in IMG/M
3300004463|Ga0063356_103287401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium697Open in IMG/M
3300004463|Ga0063356_105960523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium523Open in IMG/M
3300004479|Ga0062595_101847575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium576Open in IMG/M
3300004480|Ga0062592_102589852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales511Open in IMG/M
3300004643|Ga0062591_102136445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria581Open in IMG/M
3300005332|Ga0066388_100078448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3658Open in IMG/M
3300005332|Ga0066388_102566587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium927Open in IMG/M
3300005406|Ga0070703_10530392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium534Open in IMG/M
3300005440|Ga0070705_101210627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria623Open in IMG/M
3300005441|Ga0070700_101629952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium552Open in IMG/M
3300005543|Ga0070672_101610054All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300005545|Ga0070695_101301812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium600Open in IMG/M
3300005546|Ga0070696_101482947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria580Open in IMG/M
3300005578|Ga0068854_101639221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium587Open in IMG/M
3300005614|Ga0068856_102164100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium565Open in IMG/M
3300005618|Ga0068864_100368938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1358Open in IMG/M
3300005718|Ga0068866_10889847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria625Open in IMG/M
3300005764|Ga0066903_100755264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1728Open in IMG/M
3300005764|Ga0066903_102699659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales963Open in IMG/M
3300005764|Ga0066903_103159188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium891Open in IMG/M
3300005764|Ga0066903_106749530All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300005764|Ga0066903_107187519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium576Open in IMG/M
3300005764|Ga0066903_107392846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium567Open in IMG/M
3300006049|Ga0075417_10164049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium1039Open in IMG/M
3300006049|Ga0075417_10722262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300006178|Ga0075367_10781575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium608Open in IMG/M
3300006196|Ga0075422_10537304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium535Open in IMG/M
3300006844|Ga0075428_100074458All Organisms → cellular organisms → Bacteria → Proteobacteria3709Open in IMG/M
3300006844|Ga0075428_100193640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium2199Open in IMG/M
3300006844|Ga0075428_100760823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1030Open in IMG/M
3300006844|Ga0075428_101542067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium695Open in IMG/M
3300006844|Ga0075428_101624135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium675Open in IMG/M
3300006845|Ga0075421_101626075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium701Open in IMG/M
3300006846|Ga0075430_101255333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium610Open in IMG/M
3300006846|Ga0075430_101736965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium512Open in IMG/M
3300006847|Ga0075431_102027078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium530Open in IMG/M
3300006852|Ga0075433_11444507All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_62_13595Open in IMG/M
3300006853|Ga0075420_100949906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales740Open in IMG/M
3300006854|Ga0075425_100000242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae49891Open in IMG/M
3300006871|Ga0075434_100161658All Organisms → cellular organisms → Bacteria → Proteobacteria2259Open in IMG/M
3300006880|Ga0075429_100180602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1849Open in IMG/M
3300006881|Ga0068865_100611537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales922Open in IMG/M
3300006904|Ga0075424_100007593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium10536Open in IMG/M
3300006904|Ga0075424_101746500Not Available658Open in IMG/M
3300006969|Ga0075419_10106819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1803Open in IMG/M
3300006969|Ga0075419_10667848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium735Open in IMG/M
3300006969|Ga0075419_11022225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium602Open in IMG/M
3300006969|Ga0075419_11364293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium528Open in IMG/M
3300006969|Ga0075419_11449459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium514Open in IMG/M
3300007076|Ga0075435_100228565All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300009094|Ga0111539_10559995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1331Open in IMG/M
3300009094|Ga0111539_11547610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium769Open in IMG/M
3300009094|Ga0111539_11898115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium691Open in IMG/M
3300009094|Ga0111539_12166613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium645Open in IMG/M
3300009094|Ga0111539_12267030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium630Open in IMG/M
3300009094|Ga0111539_12274840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium629Open in IMG/M
3300009100|Ga0075418_10154991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2438Open in IMG/M
3300009100|Ga0075418_10186391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2209Open in IMG/M
3300009100|Ga0075418_10449072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1381Open in IMG/M
3300009100|Ga0075418_10695035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1096Open in IMG/M
3300009100|Ga0075418_12079568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium619Open in IMG/M
3300009146|Ga0105091_10066370All Organisms → cellular organisms → Bacteria → Proteobacteria1620Open in IMG/M
3300009147|Ga0114129_11667333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria779Open in IMG/M
3300009147|Ga0114129_12474839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales621Open in IMG/M
3300009148|Ga0105243_10182149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1828Open in IMG/M
3300009156|Ga0111538_10079723All Organisms → cellular organisms → Bacteria4167Open in IMG/M
3300009156|Ga0111538_12187584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium695Open in IMG/M
3300009156|Ga0111538_12422327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium659Open in IMG/M
3300009156|Ga0111538_13962170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium512Open in IMG/M
3300009162|Ga0075423_12638036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria549Open in IMG/M
3300009162|Ga0075423_12909117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium525Open in IMG/M
3300009792|Ga0126374_11434488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium564Open in IMG/M
3300010046|Ga0126384_10289853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1341Open in IMG/M
3300010046|Ga0126384_10373883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1195Open in IMG/M
3300010046|Ga0126384_10885206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium805Open in IMG/M
3300010046|Ga0126384_11046112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium746Open in IMG/M
3300010046|Ga0126384_11972073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium558Open in IMG/M
3300010048|Ga0126373_11459978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium749Open in IMG/M
3300010358|Ga0126370_11738813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium601Open in IMG/M
3300010358|Ga0126370_12078677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium557Open in IMG/M
3300010359|Ga0126376_10295561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1405Open in IMG/M
3300010359|Ga0126376_10363495Not Available1288Open in IMG/M
3300010359|Ga0126376_10801783Not Available919Open in IMG/M
3300010359|Ga0126376_11965690All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea626Open in IMG/M
3300010361|Ga0126378_10325488All Organisms → cellular organisms → Bacteria → Proteobacteria1644Open in IMG/M
3300010361|Ga0126378_10595988All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300010361|Ga0126378_12206518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium628Open in IMG/M
3300010362|Ga0126377_10193172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1945Open in IMG/M
3300010371|Ga0134125_11314259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium789Open in IMG/M
3300010376|Ga0126381_102014014All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300010398|Ga0126383_13538431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium510Open in IMG/M
3300011106|Ga0151489_1637817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300011119|Ga0105246_10845999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium816Open in IMG/M
3300011119|Ga0105246_12134673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300011435|Ga0137426_1188588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium613Open in IMG/M
3300012907|Ga0157283_10319778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria546Open in IMG/M
3300012957|Ga0164303_11389176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium524Open in IMG/M
3300012961|Ga0164302_10692121All Organisms → cellular organisms → Bacteria → Proteobacteria754Open in IMG/M
3300012971|Ga0126369_12392718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium614Open in IMG/M
3300012971|Ga0126369_12591478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium592Open in IMG/M
3300012971|Ga0126369_13581793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium509Open in IMG/M
3300012985|Ga0164308_11536523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium612Open in IMG/M
3300012987|Ga0164307_10906832Not Available710Open in IMG/M
3300014272|Ga0075327_1296908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium537Open in IMG/M
3300014320|Ga0075342_1157959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales622Open in IMG/M
3300014876|Ga0180064_1087415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium654Open in IMG/M
3300014968|Ga0157379_12169472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium551Open in IMG/M
3300014969|Ga0157376_12325809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium575Open in IMG/M
3300015195|Ga0167658_1050339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1024Open in IMG/M
3300015195|Ga0167658_1114063All Organisms → cellular organisms → Bacteria → Proteobacteria551Open in IMG/M
3300015201|Ga0173478_10430465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria641Open in IMG/M
3300015371|Ga0132258_11588177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1651Open in IMG/M
3300015373|Ga0132257_100467936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1542Open in IMG/M
3300015374|Ga0132255_104256639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium607Open in IMG/M
3300015374|Ga0132255_105006342All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300016270|Ga0182036_10032143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium3134Open in IMG/M
3300016319|Ga0182033_10859153All Organisms → cellular organisms → Bacteria → Proteobacteria802Open in IMG/M
3300016341|Ga0182035_10605390All Organisms → cellular organisms → Bacteria → Proteobacteria947Open in IMG/M
3300016357|Ga0182032_10914440Not Available746Open in IMG/M
3300016404|Ga0182037_10023478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3822Open in IMG/M
3300016422|Ga0182039_11418765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium631Open in IMG/M
3300018072|Ga0184635_10184918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria832Open in IMG/M
3300018422|Ga0190265_10935871All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300018469|Ga0190270_10188327Not Available1728Open in IMG/M
3300018469|Ga0190270_11531004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp.717Open in IMG/M
3300018469|Ga0190270_12555437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales573Open in IMG/M
3300019356|Ga0173481_10859970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300020581|Ga0210399_10406206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Anderseniella → unclassified Anderseniella → Anderseniella sp.1136Open in IMG/M
3300020581|Ga0210399_10724639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales816Open in IMG/M
3300021560|Ga0126371_10417158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1486Open in IMG/M
3300025898|Ga0207692_10352932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae907Open in IMG/M
3300025911|Ga0207654_10708777Not Available723Open in IMG/M
3300025938|Ga0207704_10225440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1390Open in IMG/M
3300025941|Ga0207711_11671643Not Available580Open in IMG/M
3300025961|Ga0207712_11153037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium691Open in IMG/M
3300025961|Ga0207712_11507307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria602Open in IMG/M
3300025981|Ga0207640_12136170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria508Open in IMG/M
3300026118|Ga0207675_101691856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium653Open in IMG/M
3300026827|Ga0207591_101811Not Available853Open in IMG/M
3300027866|Ga0209813_10478863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium513Open in IMG/M
3300027874|Ga0209465_10216921All Organisms → cellular organisms → Bacteria → Proteobacteria955Open in IMG/M
3300027880|Ga0209481_10390365All Organisms → cellular organisms → Bacteria → Proteobacteria713Open in IMG/M
3300027886|Ga0209486_10863844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium597Open in IMG/M
3300027907|Ga0207428_11034561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium576Open in IMG/M
3300027909|Ga0209382_10708449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1082Open in IMG/M
3300028381|Ga0268264_10440872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1260Open in IMG/M
3300028814|Ga0307302_10477879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria618Open in IMG/M
3300030000|Ga0311337_11270704All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300031546|Ga0318538_10488816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium667Open in IMG/M
3300031679|Ga0318561_10396764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales758Open in IMG/M
3300031716|Ga0310813_11738368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium585Open in IMG/M
3300031723|Ga0318493_10851190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium515Open in IMG/M
3300031740|Ga0307468_100601297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium898Open in IMG/M
3300031744|Ga0306918_10961561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium664Open in IMG/M
3300031768|Ga0318509_10099433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1567Open in IMG/M
3300031777|Ga0318543_10330426All Organisms → cellular organisms → Bacteria → Proteobacteria682Open in IMG/M
3300031782|Ga0318552_10284814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium840Open in IMG/M
3300031797|Ga0318550_10085581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1470Open in IMG/M
3300031798|Ga0318523_10245432All Organisms → cellular organisms → Bacteria → Proteobacteria895Open in IMG/M
3300031799|Ga0318565_10459678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium616Open in IMG/M
3300031846|Ga0318512_10233857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium905Open in IMG/M
3300031854|Ga0310904_10457116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium848Open in IMG/M
3300031858|Ga0310892_10538866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria783Open in IMG/M
3300031879|Ga0306919_11182602All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300031890|Ga0306925_10368434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1542Open in IMG/M
3300031897|Ga0318520_10249221Not Available1060Open in IMG/M
3300031949|Ga0214473_10779086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1034Open in IMG/M
3300032001|Ga0306922_10719827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1049Open in IMG/M
3300032012|Ga0310902_11388245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium500Open in IMG/M
3300032013|Ga0310906_10478574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium839Open in IMG/M
3300032035|Ga0310911_10082070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1740Open in IMG/M
3300032035|Ga0310911_10163405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1257Open in IMG/M
3300032035|Ga0310911_10661147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium606Open in IMG/M
3300032059|Ga0318533_10416352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium982Open in IMG/M
3300032075|Ga0310890_11175654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales624Open in IMG/M
3300032076|Ga0306924_10101075All Organisms → cellular organisms → Bacteria → Proteobacteria3262Open in IMG/M
3300033550|Ga0247829_10285232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1337Open in IMG/M
3300033551|Ga0247830_10101568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium2022Open in IMG/M
3300034090|Ga0326723_0304567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales715Open in IMG/M
3300034113|Ga0364937_075795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121660Open in IMG/M
3300034147|Ga0364925_0061070All Organisms → cellular organisms → Bacteria → Proteobacteria1294Open in IMG/M
3300034148|Ga0364927_0049083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1098Open in IMG/M
3300034178|Ga0364934_0210567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium737Open in IMG/M
3300034643|Ga0370545_092525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium647Open in IMG/M
3300034659|Ga0314780_188812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium531Open in IMG/M
3300034671|Ga0314796_158588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium534Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere24.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.15%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.56%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.05%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.54%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.54%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.03%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.03%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.03%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.03%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.03%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.51%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.51%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.51%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.51%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.51%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.51%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014876Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026827Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034671Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_084388613300000033SoilGPALAQTKMDCSRLYKDFWXKXXREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
INPhiseqgaiiFebDRAFT_10587614413300000364SoilWEKFDREKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMAF*
JGI10215J12807_108855823300000881SoilAYKGFWDKLEREKYSKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
F14TB_10154201323300001431SoilAGVSRMTLRAYDACQAGDDVDSNALFHRLQRTRF*
Ga0062589_10101730223300004156SoilYKDFWEKMDREKYAKISAEQLAGVSRLALRAYDACQAGDELDAKALFDKLSAMKF*
Ga0066397_1014027013300004281Tropical Forest SoilLYKDFWEKFDREKYAKIPAEQLAGVSRLALRAYDACQAGDEQDAKALFDRLSKMTF*
Ga0063356_10328740113300004463Arabidopsis Thaliana RhizosphereSAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF*
Ga0063356_10596052323300004463Arabidopsis Thaliana RhizosphereGPGAPARMDCGSLYKSFWEKRDREMYQRISPEQLAGVSRMALRAFDACEAGDEQDAKALFERLDRMRY*
Ga0062595_10184757523300004479SoilSAEQLAGVSRLALRAYDACQAGDELDAKALFDKLSAMKF*
Ga0062592_10258985223300004480SoilLEREKYAKITPQQLAGVSRMALRAYDACQAGDEQDARALFDRLERMKF*
Ga0062591_10213644523300004643SoilQLYARMDCSRLYKDFWEKRDPQAYARITPDQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF*
Ga0066388_10007844813300005332Tropical Forest SoilKYARISAEQLAGLSRMALRAYDACEAGDDQDARALFERLARMQF*
Ga0066388_10256658723300005332Tropical Forest SoilKFAKLSGEQLAGISRSALRAYDACQAGDELEAQEMFDRLHMKLF*
Ga0070703_1053039223300005406Corn, Switchgrass And Miscanthus RhizosphereREKYAKINPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0070705_10121062723300005440Corn, Switchgrass And Miscanthus RhizosphereYKGFWDKLEREKYSKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0070700_10162995213300005441Corn, Switchgrass And Miscanthus RhizosphereEKYAKISAEQLAGVSRLALRAYDACQAGDEQDARALFDRLSKMTF*
Ga0070672_10161005413300005543Miscanthus RhizosphereLYKDFWEKMDREKYAKISAEQLAGVSRLALRAYDACQAGDELDAKALFDKLSSMKF*
Ga0070695_10130181213300005545Corn, Switchgrass And Miscanthus RhizosphereDCGVLYKDFWVKFDREKLARISADHLAAVSRMALRAHDACQAGDAQDARALFEKLQRMHF
Ga0070696_10148294713300005546Corn, Switchgrass And Miscanthus RhizosphereLYKNFWEKRDPQAYAKISPEQLAGISRMALRAYDACEAGDEQDAKALFDRLGRMNF*
Ga0068854_10163922113300005578Corn RhizospherePEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0068856_10216410023300005614Corn RhizosphereSAEQLAGVSRMALRAYDACQAGDEPDAGTLFGRLRRMQF*
Ga0068864_10036893823300005618Switchgrass RhizosphereFAKISAEQLAGVSRMALRAYDACQAGDEPDAGTLFGRLRRMQF*
Ga0068866_1088984723300005718Miscanthus RhizosphereISAEQLAGVSRLALRAYDACQAGDELDAKALFDKLSAMKF*
Ga0066903_10075526443300005764Tropical Forest SoilGISAEHLAGVSRMALRAYDACQAGDALDANALFNRLGRIQF*
Ga0066903_10269965913300005764Tropical Forest SoilRISAEQLAGVSRLVLRAYDACQAGDEQDAKALFKRLDHIRF*
Ga0066903_10315918813300005764Tropical Forest SoilAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF*
Ga0066903_10674953023300005764Tropical Forest SoilDREKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSRMTF*
Ga0066903_10718751913300005764Tropical Forest SoilKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF*
Ga0066903_10739284613300005764Tropical Forest SoilQLAGVSRMALRAYDACQAGDQLDATSLFGRLERMNF*
Ga0075417_1016404933300006049Populus RhizosphereKMNCSQLYKDFWVKRDPQAYVRLSAEQLAGVSRMALRAYDACEAGDEQDAKALFDRLQRMNF*
Ga0075417_1072226223300006049Populus RhizosphereKISAEQLAGVSRLALRAYDACQAGDEQDAKALFDRLSKMTF*
Ga0070715_1101632713300006163Corn, Switchgrass And Miscanthus RhizosphereVHASAMDCGGLYKNFWGKLDGETYARIPAEQLAGVSRMALRAYDACQAGDQLDAASLFGRLERMNF*
Ga0075367_1078157523300006178Populus EndosphereEREKYAKINPEQLAGVSRMALRAYDACQAGDELDAKALFEKLDKMKF*
Ga0075422_1053730413300006196Populus RhizosphereLAGVSRMALRAYDACQAGDEQDARALFDKLSKMTF*
Ga0075428_10007445813300006844Populus RhizosphereEQLAGVSRMALRAYDACEAGDEQDAKALFDRLQRMNF*
Ga0075428_10019364013300006844Populus RhizosphereMTAARPIKGSWEKLEREKYAKITPQQLAGVSRMALRAYDSCQAGDEQDARALFDRLERMKF*
Ga0075428_10076082333300006844Populus RhizosphereSRLYKDFWEKRDPQAYARITPDQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF*
Ga0075428_10154206723300006844Populus RhizosphereDKLEREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFDRLDKMKF*
Ga0075428_10162413513300006844Populus RhizosphereDCGKAYKGFWDKLEREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF
Ga0075421_10162607523300006845Populus RhizosphereEKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFDRLDKMKF*
Ga0075430_10125533313300006846Populus RhizosphereEQLAGVSRMALRAYDACQAGDEQDARALFDRLSKMTF*
Ga0075430_10173696523300006846Populus RhizosphereAERLAGVSRFALRAYDACQAGDDMDARVQFDKLNKLSFWF*
Ga0075431_10202707813300006847Populus RhizosphereDCGKAYKGFWDKLEREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFDRLDKMKF
Ga0075433_1144450713300006852Populus RhizosphereEKFAKLSGDQLAAVSRWGLRAYDNCQAGDEAEAQEMFDRLHMTLF*
Ga0075420_10094990613300006853Populus RhizosphereREKYAKISAEQLAGISRLALRAYDACQAGDDADAKELFDRLERLAK*
Ga0075425_100000242513300006854Populus RhizosphereEKYAKISAEQLAGVSRMALRAYDACQAGDEQDARALFDRLNKMSF*
Ga0075434_10016165813300006871Populus RhizosphereDREKYAKISAEQLAGVSRMALRAYDACQAGDEQDARALFDRLSKMTF*
Ga0075429_10018060213300006880Populus RhizosphereKLEREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMRF*
Ga0068865_10061153713300006881Miscanthus RhizosphereAGVSRMALRAYDACQAGDEPDAGTLFGRLRRMQF*
Ga0075424_10000759313300006904Populus RhizosphereDREKYAKISAEQLAGVSRMALRAYDACQAGDEQDARALFDRLNKMSF*
Ga0075424_10174650013300006904Populus RhizosphereKAYKGFWDKLERDKYAKISPEQLAGVSRMALRAYDACQAGDEQDAKALFERLEKMKF*
Ga0075419_1010681943300006969Populus RhizosphereAEQLAGVSRMALRAYDACEAGDEQDAKALFDRLQRMNF*
Ga0075419_1066784813300006969Populus RhizosphereKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFDRLDKMKF*
Ga0075419_1102222513300006969Populus RhizosphereKISAERLAGVSRLALRAYDACQAGDDMDAKVQFDKLNKLSFWF*
Ga0075419_1136429313300006969Populus RhizosphereRLYKDFWEKFDQQKYAKISADQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF*
Ga0075419_1144945913300006969Populus RhizosphereWVKRDPQAYARLSAEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0075435_10022856513300007076Populus RhizosphereEKYAKISAEQLAGVSRMALRAYDACQAGDEQDARALFDRLSKMTF*
Ga0111539_1055999533300009094Populus RhizosphereEKYAKISPEQLAGVSRLALRAYDACQAGDDQDARALFERLDKMKF*
Ga0111539_1154761013300009094Populus RhizosphereEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF*
Ga0111539_1155351223300009094Populus RhizosphereANISGHQLASVTRLAVRAYDACQTRDEFEAKELFDRLRVKLF*
Ga0111539_1189811513300009094Populus RhizosphereYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFDRLDKMKF*
Ga0111539_1216661313300009094Populus RhizosphereKAYKGFWDKLEREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDRMKF*
Ga0111539_1226703013300009094Populus RhizosphereRLAGVSRLALRAYDACQAGDDMDAKVQFDKLNKLSFWF*
Ga0111539_1227484013300009094Populus RhizosphereKAYKGFWDKIEREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0075418_1015499113300009100Populus RhizosphereWDKLEREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMRF*
Ga0075418_1018639143300009100Populus RhizosphereYKGFWDKLDREKYAKISAEQLAGISRLALRAYDACQAGDDADAKELFDRLERLAK*
Ga0075418_1044907233300009100Populus RhizosphereSAERLAGVSRLALRAYDACQAGDDMDAKVQFDKLNKLSFWF*
Ga0075418_1069503523300009100Populus RhizosphereEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0075418_1207956813300009100Populus RhizosphereISAEQLAGVSRMALRAYDACQAGDEQDARALFDRLSKMTF*
Ga0105091_1006637013300009146Freshwater SedimentQLAGVSRMALRAYDACQAGDELDAKALFDRLDKMKF*
Ga0114129_1166733313300009147Populus RhizosphereQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0114129_1247483913300009147Populus RhizosphereQLAGVSRMALRAYDACQAGDEQDAKSLFERLGRSQF*
Ga0105243_1018214943300009148Miscanthus RhizosphereMDCSRLYKDFWEKRDPQAYARITPDQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF*
Ga0111538_1007972343300009156Populus RhizosphereQGKMDCGKAYKGFWDKLEREKYAKITPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0111538_1218758413300009156Populus RhizosphereQISAERLAGVSRLALRAYDACQAGDDMDAKVQFDKLNKLSFWF*
Ga0111538_1242232713300009156Populus RhizosphereLAGVSRLALRANDTCQAGDEQDAKALFDRLSKMTF*
Ga0111538_1396217013300009156Populus RhizosphereISPEQLAGVSRLALRAYDACQAGDDQDARALFERLDKMKF*
Ga0075423_1263803613300009162Populus RhizosphereQAYARITPDQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF*
Ga0075423_1290911723300009162Populus RhizosphereEQLAGISRLALRAYDACQAGDDADAKELFDRLERLAK*
Ga0126374_1143448823300009792Tropical Forest SoilPAEQLAGVSRMALRAYDACQAGDQLDAASLFGRLERMNF*
Ga0126384_1028985333300010046Tropical Forest SoilAKIPAEQLAGVSRLALRAYDACQAGDEQDAKALFDRLSKMAF*
Ga0126384_1037388323300010046Tropical Forest SoilSALYKDFWGKLDREKYARIPAEQLAGVSRMALRAYDACQAGDQLDANSLFGRLQRIDF*
Ga0126384_1088520623300010046Tropical Forest SoilLYKDFWQQFDREKFATISASRLAGTSRMALRAYDACEAGDEQDAKEIFERLSKVKF*
Ga0126384_1104611223300010046Tropical Forest SoilDFWEKFDREKYAKISAEQLAGVSRMALRAYDACQAGDEQDARALFDRLNRMSF*
Ga0126384_1197207313300010046Tropical Forest SoilDFWEKFDREKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKGLFDRLNRMQF*
Ga0126373_1145997823300010048Tropical Forest SoilWGKLENDNHTRISAEQLAGVSRLVLRAYDACQAGDEQDAKALFKRLDGIRF*
Ga0126370_1173881313300010358Tropical Forest SoilISAEQLAGVSRLALRAYDACQAGDEQDAKALFDRLSKMTF*
Ga0126370_1207867713300010358Tropical Forest SoilISAEQLAGVSRMALRAYDACQAGDEQDAKALFKRLDGIRF*
Ga0126376_1029556133300010359Tropical Forest SoilFDREKYAKISAEQLAGVSRLALRAYDACQAGDEQDAKALFDRLSKMTF*
Ga0126376_1036349513300010359Tropical Forest SoilEQLAGLSRMALRAYDACEAGDEQDARALFDRLHRVQF*
Ga0126376_1080178323300010359Tropical Forest SoilSPGTHPTSVSCGTRYKVFWEQFDRQKYARISAEQLAGLSRMALRAYDACEAGDDQDARSLFDRLRRVQF*
Ga0126376_1196569023300010359Tropical Forest SoilTAMECSRLYKEFWGKLENDNYARISAEQLAGVSRMALRAYDACRAGDELDAKALFKRLDRLQF*
Ga0126378_1032548833300010361Tropical Forest SoilAGVSRMALRAYDACQAGDEQDARALFDRLSKMTF*
Ga0126378_1059598843300010361Tropical Forest SoilRISAEHLAGLSRMALRAYDVCQAGDELDANALFRRLGRMQF*
Ga0126378_1220651813300010361Tropical Forest SoilLAGVSRMALRAYDACQAGDQLDAASLFGRLEKMNF*
Ga0126377_1019317213300010362Tropical Forest SoilKYARISADQLAGVSRMALRAYDACQAGDELDANALFKRLDHIRF*
Ga0134125_1131425923300010371Terrestrial SoilMDCSRLYKDFLEKMDREKLAKISAEQFAGVNRMALRAYDACLAGDELEAKALFDRLH
Ga0126381_10201401413300010376Tropical Forest SoilKEFWGKLEDDKFTRISAEHLAGLSRMALRAYDACQAGDELDANALFRRLGRMQF*
Ga0126383_1353843113300010398Tropical Forest SoilRISAEQLAGVSRMTLRAYDACQAGDELDANALFKRLDRLRF*
Ga0151489_163781723300011106SoilWETRDPQTYARISPEQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF*
Ga0105246_1084599923300011119Miscanthus RhizosphereSKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0105246_1213467313300011119Miscanthus RhizosphereITPDQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF*
Ga0137426_118858813300011435SoilKGFWDKLEREKYAKINPEQLAGVSRMALRAYDACQAGDELDAKALFDKLDKMKF*
Ga0157283_1031977813300012907SoilCGKAYKGFWDKLEREKYSKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0164303_1138917613300012957SoilEKMDREKYAKISAEQLAGVSRLALRAYDACQAGDDMDAKAQFDKLNKLSFWF*
Ga0164302_1069212113300012961SoilKMDREKYAKISAEQLAGVSRLALRAYDACQAGDELDAKALFDKLSAMKF*
Ga0126369_1239271823300012971Tropical Forest SoilREKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKGLFDRLNRMQF*
Ga0126369_1259147823300012971Tropical Forest SoilSGEQLAGVSRSALRAYDACQAGDQLEAKEMFDRLHMKLF*
Ga0126369_1358179313300012971Tropical Forest SoilQKYARISAEQLAGLSRMALRAYDACEAGDDQDAKALFDRLRRMQF*
Ga0164308_1153652323300012985SoilFWRKLDRDKYAKISGEQLAGVSRMALRAYDACQAGDAPDADSLFGRLRRMQF*
Ga0164307_1090683223300012987SoilLAGVSRMALRAYDACEAGDEQDAKALFDRLSRMTF*
Ga0075327_129690813300014272Natural And Restored WetlandsKLEREKYAKVSAEQLAGISRLALRAYDACQAGDDLDARQLFERLDRLAK*
Ga0075342_115795923300014320Natural And Restored WetlandsEPFGPGAPARMDCGSLYKSFWEKRDREMYQRISPEQLAGVSRMALRAFDACEAGDEQDAKALFERLDRMRY*
Ga0180064_108741523300014876SoilFFEKLDREKYAKISPEQLAGVSRLALRAYDACQAGDELDAKALFDRLDKMKF*
Ga0157379_1216947213300014968Switchgrass RhizospherePQAYARITPDQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF*
Ga0157376_1232580923300014969Miscanthus RhizosphereLYKDFWEKMDRERYAKISAEQLAGVSRLALRAYDACQAGDELDAKALFDKLSAMKF*
Ga0167658_105033913300015195Glacier Forefield SoilRGKHARISAEQLAGVSRMALRAYDACEAGDEQDAKALFERLQKMSF*
Ga0167658_111406313300015195Glacier Forefield SoilLAGVSRLALRAYDACQAGDDLDAKAQFDNLNKLTFWF*
Ga0173478_1043046513300015201SoilLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF*
Ga0132258_1158817713300015371Arabidopsis RhizosphereKMDCGKAYKGFWDKLEREKYSKISPEQLAGVSRLALRAYDACQAGDELDAKALFEKLDKMKY*
Ga0132257_10046793613300015373Arabidopsis RhizosphereDFWEKMDRERYAKISAEQLAGVSRLALRAYDACQAGDELDAKALFDKLSAMKF*
Ga0132255_10425663913300015374Arabidopsis RhizosphereMDCGKAYKGFWEKLESQKYAKISADQLAGVSRMALRAYDACQAGDAQDARALFQKLERMKF*
Ga0132255_10500634223300015374Arabidopsis RhizosphereQLAGISRMALRAYDACEAGDEQDARGLFDRLHRM*
Ga0182036_1003214343300016270SoilEKFDREKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMAF
Ga0182033_1085915323300016319SoilKISAEQLAGVSRMALRACDGCQTGDEQDAKALFDRLSKMTF
Ga0182035_1060539023300016341SoilYKDFWEKFDREKYAKISAKQLAGVSRMALRAYDACQAGDEQDARALFDRLSKMTF
Ga0182032_1091444013300016357SoilRYKDFWEQFDQQKYARISAEQLAGLSRMALRAYDACEAGDDQDARSLFDRLRRMQF
Ga0182037_1002347863300016404SoilSVSCGTRYKDFWEQFDQQKYARISAEQLAGLSRMALRAYDVCEAGDDQDARSLFDRLRRMQF
Ga0182039_1141876523300016422SoilCSTLYKDFWQQFDREKFATISASRLAGTSRMALRAYDACEAGDEQDAKEIFERLSKVKF
Ga0184635_1018491813300018072Groundwater SedimentARITPDQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF
Ga0190265_1093587113300018422SoilEQLAGVSRLALRAYDACQAGDDMDAKVQFDKLNKLSFWF
Ga0190270_1018832733300018469SoilFWDKLEREKYAKINPEQLAGVSRMALRAYDACQAGDELDAKALFDKLDKMKF
Ga0190270_1153100413300018469SoilEKYAKINPEQLAGVSRMALRAYDACQAGDELEAKELFERLDRLRF
Ga0190270_1255543723300018469SoilSKISPEQLAGVSRMALRAYDACQAGDEQDARALFERLDRMKF
Ga0173481_1085997023300019356SoilEKYSKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF
Ga0210399_1040620623300020581SoilEHLAGVSRMVLRAYDACQAGDELDANALFRRLDRMQF
Ga0210399_1072463923300020581SoilKLDGETYARIPAEQLAGVSRMALRAYDACQAGDQLDAASLFGRLERMNF
Ga0126371_1041715813300021560Tropical Forest SoilEKYARIPAEQLAGVSRMALRAYDACQAGDQLDANSLFGRLQRIDF
Ga0207692_1035293213300025898Corn, Switchgrass And Miscanthus RhizosphereMDREKYAKISAEQLAGVSRLALRAYDACQAGDELDAKALFDKLSAMKF
Ga0207654_1070877713300025911Corn RhizosphereREKVARMPAEQLAGVSRMALRAYDACEAGDEQDAKALFDRLSKMTF
Ga0207704_1022544013300025938Miscanthus RhizosphereLDRDKFAKISAEQLAGVSRMALRAYDACQAGDEPDAGTLFGRLRRMQF
Ga0207711_1167164313300025941Switchgrass RhizosphereEQLAGVSRMALRAYDACEAGDEQDAKALFDRLSKMTF
Ga0207712_1115303723300025961Switchgrass RhizosphereEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF
Ga0207712_1150730723300025961Switchgrass RhizosphereRTTPEQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF
Ga0207640_1213617013300025981Corn RhizosphereQQPPAPQLYARMDCSRLYKDFWEKRDPQAYARITPDQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF
Ga0207675_10169185623300026118Switchgrass RhizosphereCGKAYKGFWDKLEREKYSKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF
Ga0207591_10181123300026827SoilSRLYKDFWEKRDPQAYARITPDQLAGVSRMALRAYDACEAGDEQDAKALFDRLGRMNF
Ga0209813_1047886313300027866Populus EndosphereLLNEPFGPGAPARMDCGSLYKSFWERRDREMYQRISPEQLAGVSRMALRAFDACEAGDEQDAKALFERLDRMRY
Ga0209465_1021692113300027874Tropical Forest SoilDREKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMAF
Ga0209481_1039036523300027880Populus RhizosphereAYARLSAEQLAGVSRMALRAYDACEAGDEQDAKALFDRLQRMNF
Ga0209486_1086384413300027886Agricultural SoilERIDRERFAKISPEQLSGVNRMALRAYDACQAGDEADARELFARIERISK
Ga0207428_1103456123300027907Populus RhizosphereFASTRSLHQLAGVSRLALRANDTCQAGDEQDAKALFDRLSKMTF
Ga0209382_1070844923300027909Populus RhizosphereLAGVSRMALRAYDACQAGDDQDARALFERLDKMRF
Ga0268264_1044087223300028381Switchgrass RhizosphereVGCSSRYKDFWQGFDREKVARMPAEQLAGVSRMALRAYDACEAGDEQDAKALFDRLSKMT
Ga0307302_1047787923300028814SoilREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF
Ga0311337_1127070413300030000FenDQQKYARISAEQLAGISRMALRAYDACEAGDDQDAKALFERLRKMSY
Ga0318538_1048881623300031546SoilSGLYKNFWGKLDREKYARIPAEQLAGVSRMALRAYDACQAGDQLDAASLFGRLERMNF
Ga0318561_1039676423300031679SoilYARIPAEQLAGVSRMALRAYDACQAGDQLDAASLFGRLERMNF
Ga0310813_1173836813300031716SoilISAEQLAGVSRMALRAYDACQAGDEPDAGTLFGRLRRMQF
Ga0318493_1085119013300031723SoilLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF
Ga0307468_10060129723300031740Hardwood Forest SoilKGFWDKIEREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF
Ga0306918_1096156113300031744SoilSAEQLAGVSRMALRAYDACQAGDELDANALFKRLDHLRF
Ga0318509_1009943323300031768SoilDCSGLYKDFWGKLDREKYARIPAEQLAGVSRMALRAYDACQAGDQLDAASLFGRLERMNF
Ga0318543_1033042623300031777SoilREKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF
Ga0318552_1028481423300031782SoilAKISAEQLAGVSRLALRAYDACQAGDEQDAKALFDRLNRMQF
Ga0318550_1008558123300031797SoilSGLYKDFWGKLDREKYARIPAEQLAGVSRMALRAYDACQAGDQLDAASLFGRLERMNF
Ga0318523_1024543213300031798SoilYAKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF
Ga0318565_1045967813300031799SoilGKLDREKYARIPAEQLAGVSRMALRAYDACQAGDQLDAASLFGRLERMNF
Ga0318512_1023385723300031846SoilQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF
Ga0310904_1045711613300031854SoilKDFWEKFDREKYAKISAEQLAGVSRLALRAYDACQAGDEQDARALFDRLSKMTF
Ga0310892_1053886613300031858SoilDKLEREKYAKISPEQLAGVSRMALRAYDACQAGDDQDARALFERLDKMKF
Ga0306919_1118260213300031879SoilDREKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF
Ga0306925_1036843423300031890SoilHLAGLSRMALRAYDACQAGDELDANALFKRLGRMQF
Ga0318520_1024922123300031897SoilEQFDQQKYARISAEQLAGLSRMALRAYDACEAGDDQDARSLFDRLRRMQF
Ga0214473_1077908633300031949SoilPEQLAGVSRLALRAYDACQAGDEQDAKALFDRLERMKF
Ga0306922_1071982713300032001SoilAKISAEQLDGVSRLALRAYDACQAGDEQDAKALFDRLSKMTF
Ga0310902_1138824513300032012SoilFNFVHVGPNGPPPQARMDCGVLYKDFWVKFDREKLARISADHLAAVSRMALRAHDACQAGDAQDARALFEKLQRMHF
Ga0310906_1047857413300032013SoilMDCGKAYKGFWDKLDREKYAKISPEQLAGVSRMALRAYDACQAGDEQDARALFERLDRMK
Ga0310911_1008207023300032035SoilARIPAEQLAGVSRMALRAYDACQAGDQLDAASLFGRLERMNF
Ga0310911_1016340533300032035SoilDFWEKFDREKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMAF
Ga0310911_1066114713300032035SoilDQLAGVSRSALRAYDACQAGDQLEAKEMFDRLHMKLF
Ga0318533_1041635213300032059SoilEKYAKISAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF
Ga0310890_1117565413300032075SoilSFDRQKVARMPAEQLAGVSRMALRAYDACEAGDEQDAKALFERLDRMRY
Ga0306924_1010107553300032076SoilAEQLAGVSRMALRAYDACQAGDEQDAKALFDRLSKMTF
Ga0306924_1240094323300032076SoilRMDCGRLYKDFWEKLDREKFAKLSGDRLAAVSRWALRAYDNCQAGDAAEAQEMFDRLHMTLF
Ga0247829_1028523223300033550SoilYAKISAEQRAGVSRMALRAYDACQAGDEQDARALFDRLSKMTF
Ga0247830_1010156823300033551SoilREKLARISADHLAAVSRMALRAHDACQAGDAQDARALFEKLQRMHF
Ga0326723_0304567_3_1403300034090Peat SoilEKYAKISAEQLAGVSRMALRAYDACQAGDEPDADALFGRLRRMRF
Ga0364937_075795_493_6603300034113SedimentYKGFWDKLEREKYAKINPEQLAGVSRMALRAYDACQAGDELDAKALFDRLDKMKF
Ga0364925_0061070_3_1193300034147SedimentPEQLAGVNRMALRAYDACQAGDEQDARALFSRLESMKF
Ga0364927_0049083_912_10973300034148SedimentLDCGNAYKGFWDMLDSEKYAKISPEQLAGVSRMALRAYDACQAGDELDAKALFDRLDKMK
Ga0364934_0210567_600_7373300034178SedimentEKYAKINPEQLAGVSRMALRAYDACQAGDDQDARALFERLDRMKF
Ga0370545_092525_4_1893300034643SoilMDCGKAYKGFWDKLEREKYAKINPEQLAGVSRMALRAYDACQAGDDQDAKALFERLDRMK
Ga0314780_188812_3_1283300034659SoilKISPEQLAGVNRMALRAFDACQAGDEQDARALFTRLESMKF
Ga0314796_158588_426_5333300034671SoilLAGVSRLALRAYDACQAGDELDAKALFDKLSAMKF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.