NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028610

Metagenome / Metatranscriptome Family F028610

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028610
Family Type Metagenome / Metatranscriptome
Number of Sequences 191
Average Sequence Length 50 residues
Representative Sequence VDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKTVTAPEYREKALQVVGH
Number of Associated Samples 177
Number of Associated Scaffolds 191

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.95 %
% of genes from short scaffolds (< 2000 bps) 92.15 %
Associated GOLD sequencing projects 169
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.518 % of family members)
Environment Ontology (ENVO) Unclassified
(22.513 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.550 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.36%    β-sheet: 0.00%    Coil/Unstructured: 63.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 191 Family Scaffolds
PF00005ABC_tran 92.67
PF00528BPD_transp_1 3.66
PF07683CobW_C 2.09
PF09084NMT1 0.52
PF13692Glyco_trans_1_4 0.52
PF07517SecA_DEAD 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 191 Family Scaffolds
COG0523Zinc metallochaperone YeiR/ZagA and related GTPases, G3E familyGeneral function prediction only [R] 2.09
COG0653Preprotein translocase subunit SecA (ATPase, RNA helicase)Intracellular trafficking, secretion, and vesicular transport [U] 0.52
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.52
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090004|P1_DRAFT_NODE_343436_len_2505_cov_14_041517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae2555Open in IMG/M
2124908032|Perma_A_C_ConsensusfromContig128794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii990Open in IMG/M
2170459024|GZRSKLJ01C5NRZAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45511Open in IMG/M
3300001904|JGI24736J21556_1051499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium634Open in IMG/M
3300002070|JGI24750J21931_1062391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium598Open in IMG/M
3300002239|JGI24034J26672_10120317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium507Open in IMG/M
3300004019|Ga0055439_10107645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45833Open in IMG/M
3300004058|Ga0055498_10123294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium545Open in IMG/M
3300005168|Ga0066809_10068183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium825Open in IMG/M
3300005330|Ga0070690_101569687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium533Open in IMG/M
3300005332|Ga0066388_106651555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium582Open in IMG/M
3300005332|Ga0066388_106847481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium574Open in IMG/M
3300005332|Ga0066388_108433905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45513Open in IMG/M
3300005345|Ga0070692_10361509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45905Open in IMG/M
3300005347|Ga0070668_101097973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium718Open in IMG/M
3300005364|Ga0070673_101246455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium697Open in IMG/M
3300005365|Ga0070688_100681227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45794Open in IMG/M
3300005445|Ga0070708_100321077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii1459Open in IMG/M
3300005466|Ga0070685_10016475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium3938Open in IMG/M
3300005468|Ga0070707_101471885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45648Open in IMG/M
3300005524|Ga0070737_10094863All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b1394Open in IMG/M
3300005536|Ga0070697_100547139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium1015Open in IMG/M
3300005542|Ga0070732_10271910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1016Open in IMG/M
3300005548|Ga0070665_101094413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45808Open in IMG/M
3300005617|Ga0068859_102853615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45530Open in IMG/M
3300005764|Ga0066903_107371080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium568Open in IMG/M
3300005833|Ga0074472_10204770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii788Open in IMG/M
3300005841|Ga0068863_101539800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45674Open in IMG/M
3300005844|Ga0068862_101028605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45816Open in IMG/M
3300005949|Ga0066791_10067442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45709Open in IMG/M
3300006047|Ga0075024_100185834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium966Open in IMG/M
3300006049|Ga0075417_10609439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium556Open in IMG/M
3300006052|Ga0075029_101126416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45546Open in IMG/M
3300006057|Ga0075026_100574654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45659Open in IMG/M
3300006058|Ga0075432_10140846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45920Open in IMG/M
3300006172|Ga0075018_10696781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45549Open in IMG/M
3300006175|Ga0070712_100462655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer1058Open in IMG/M
3300006175|Ga0070712_100508761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451010Open in IMG/M
3300006579|Ga0074054_12043832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45654Open in IMG/M
3300006580|Ga0074049_10244086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium607Open in IMG/M
3300006604|Ga0074060_11838026All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300006636|Ga0075525_10079582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii628Open in IMG/M
3300006642|Ga0075521_10070615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii1561Open in IMG/M
3300006755|Ga0079222_11076899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45702Open in IMG/M
3300006806|Ga0079220_10301805All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4990Open in IMG/M
3300006806|Ga0079220_10714356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium739Open in IMG/M
3300006852|Ga0075433_10873085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45785Open in IMG/M
3300006864|Ga0066797_1035010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium1767Open in IMG/M
3300006914|Ga0075436_100439368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45949Open in IMG/M
3300006950|Ga0075524_10274695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45738Open in IMG/M
3300009029|Ga0066793_10802012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45535Open in IMG/M
3300009098|Ga0105245_11244100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45793Open in IMG/M
3300009166|Ga0105100_11016965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae520Open in IMG/M
3300009177|Ga0105248_11087061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45904Open in IMG/M
3300009296|Ga0103681_1210596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium774Open in IMG/M
3300009545|Ga0105237_10712819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451010Open in IMG/M
3300009660|Ga0105854_1378876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45511Open in IMG/M
3300009662|Ga0105856_1203108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriaceae → Corynebacterium → Corynebacterium glutamicum626Open in IMG/M
3300009792|Ga0126374_10327415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451040Open in IMG/M
3300010043|Ga0126380_12003893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45530Open in IMG/M
3300010359|Ga0126376_11700850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45666Open in IMG/M
3300010362|Ga0126377_10586350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451158Open in IMG/M
3300010362|Ga0126377_13492041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae508Open in IMG/M
3300010366|Ga0126379_11967084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45687Open in IMG/M
3300010366|Ga0126379_13095625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300010371|Ga0134125_10060727All Organisms → cellular organisms → Bacteria → Proteobacteria4205Open in IMG/M
3300010373|Ga0134128_11751826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45683Open in IMG/M
3300010396|Ga0134126_10307381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii1859Open in IMG/M
3300010397|Ga0134124_10036848All Organisms → cellular organisms → Bacteria → Proteobacteria4074Open in IMG/M
3300010401|Ga0134121_10733053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45941Open in IMG/M
3300011431|Ga0137438_1198629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45611Open in IMG/M
3300012210|Ga0137378_11110755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45705Open in IMG/M
3300012496|Ga0157353_1038350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45540Open in IMG/M
3300012500|Ga0157314_1028502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45614Open in IMG/M
3300012898|Ga0157293_10119695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45705Open in IMG/M
3300012906|Ga0157295_10038669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451077Open in IMG/M
3300012911|Ga0157301_10102479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45843Open in IMG/M
3300012913|Ga0157298_10168432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45673Open in IMG/M
3300012931|Ga0153915_12224254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45642Open in IMG/M
3300012948|Ga0126375_10722040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45779Open in IMG/M
3300012951|Ga0164300_10264470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45881Open in IMG/M
3300012961|Ga0164302_10601983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45797Open in IMG/M
3300012971|Ga0126369_10695907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451093Open in IMG/M
3300012985|Ga0164308_10706055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45870Open in IMG/M
3300012986|Ga0164304_10860465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45705Open in IMG/M
3300012987|Ga0164307_11006508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45678Open in IMG/M
3300012988|Ga0164306_10346754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451099Open in IMG/M
3300012989|Ga0164305_10458808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45992Open in IMG/M
3300012989|Ga0164305_11782672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45555Open in IMG/M
3300013092|Ga0163199_1149247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45945Open in IMG/M
3300013307|Ga0157372_10012748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes8955Open in IMG/M
3300014498|Ga0182019_11262782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45544Open in IMG/M
3300015197|Ga0167638_1096227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45572Open in IMG/M
3300015245|Ga0137409_11370925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45551Open in IMG/M
3300015372|Ga0132256_100582618All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300017792|Ga0163161_11047799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45699Open in IMG/M
3300017944|Ga0187786_10140452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45861Open in IMG/M
3300017947|Ga0187785_10011035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3069Open in IMG/M
3300017947|Ga0187785_10160564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45952Open in IMG/M
3300018029|Ga0187787_10000709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68606323Open in IMG/M
3300018058|Ga0187766_11142936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45561Open in IMG/M
3300018064|Ga0187773_11186567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45512Open in IMG/M
3300019362|Ga0173479_10130844All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4976Open in IMG/M
3300021560|Ga0126371_13543045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45527Open in IMG/M
3300022756|Ga0222622_10700246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45736Open in IMG/M
3300022883|Ga0247786_1121716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45574Open in IMG/M
3300022889|Ga0247785_1032977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45612Open in IMG/M
3300022892|Ga0247753_1000792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3065Open in IMG/M
3300025290|Ga0207673_1044205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45628Open in IMG/M
3300025464|Ga0208076_1041225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales805Open in IMG/M
3300025558|Ga0210139_1032707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451029Open in IMG/M
3300025558|Ga0210139_1060454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45769Open in IMG/M
3300025562|Ga0210099_1056826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45768Open in IMG/M
3300025582|Ga0209386_1066168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45641Open in IMG/M
3300025650|Ga0209385_1192418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45571Open in IMG/M
3300025854|Ga0209176_10039816All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T41022Open in IMG/M
3300025878|Ga0209584_10102664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451056Open in IMG/M
3300025888|Ga0209540_10100842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii1768Open in IMG/M
3300025898|Ga0207692_11179445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45508Open in IMG/M
3300025901|Ga0207688_10602586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45692Open in IMG/M
3300025905|Ga0207685_10167304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451009Open in IMG/M
3300025906|Ga0207699_11073656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45596Open in IMG/M
3300025907|Ga0207645_10330195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451018Open in IMG/M
3300025911|Ga0207654_10292958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451104Open in IMG/M
3300025916|Ga0207663_10268958All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300025918|Ga0207662_10720812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45700Open in IMG/M
3300025925|Ga0207650_10394864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451144Open in IMG/M
3300025928|Ga0207700_10277610All Organisms → cellular organisms → Bacteria1440Open in IMG/M
3300025932|Ga0207690_10627712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45879Open in IMG/M
3300025935|Ga0207709_11113190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45649Open in IMG/M
3300025941|Ga0207711_10088343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2721Open in IMG/M
3300025944|Ga0207661_11589280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45598Open in IMG/M
3300025945|Ga0207679_10125727All Organisms → cellular organisms → Bacteria → Proteobacteria2049Open in IMG/M
3300025945|Ga0207679_10687906All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4927Open in IMG/M
3300025953|Ga0210068_1011231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451211Open in IMG/M
3300025961|Ga0207712_10243928All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300026035|Ga0207703_10188137All Organisms → cellular organisms → Bacteria1826Open in IMG/M
3300026047|Ga0208658_1023050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae521Open in IMG/M
3300026075|Ga0207708_10118053All Organisms → cellular organisms → Bacteria2065Open in IMG/M
3300026088|Ga0207641_10719199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45984Open in IMG/M
3300026095|Ga0207676_10859327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales888Open in IMG/M
3300026116|Ga0207674_11255942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45710Open in IMG/M
3300026223|Ga0209840_1028307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1283Open in IMG/M
3300026485|Ga0256805_1059912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45516Open in IMG/M
3300026492|Ga0256802_1019409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45824Open in IMG/M
3300026494|Ga0257159_1056000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45672Open in IMG/M
3300026746|Ga0207454_102364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45638Open in IMG/M
3300026771|Ga0207552_102303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45701Open in IMG/M
3300026803|Ga0207549_105713All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300026833|Ga0207728_102927All Organisms → cellular organisms → Bacteria1811Open in IMG/M
3300026841|Ga0207490_1002635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45799Open in IMG/M
3300026890|Ga0207781_1029504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45532Open in IMG/M
3300027024|Ga0207819_1036399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45608Open in IMG/M
3300027411|Ga0207519_100235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae1426Open in IMG/M
3300027420|Ga0207436_100422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451087Open in IMG/M
3300027444|Ga0207468_1001070All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300027485|Ga0207635_1019365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45501Open in IMG/M
3300027516|Ga0207761_1031223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451049Open in IMG/M
3300027560|Ga0207981_1023210All Organisms → cellular organisms → Bacteria → Proteobacteria1122Open in IMG/M
3300027815|Ga0209726_10240055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45923Open in IMG/M
3300027819|Ga0209514_10137685All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300027876|Ga0209974_10301683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45613Open in IMG/M
3300027907|Ga0207428_10199601All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300028379|Ga0268266_10772884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45927Open in IMG/M
3300028715|Ga0307313_10213543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45599Open in IMG/M
3300028720|Ga0307317_10047676All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300028807|Ga0307305_10340104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45681Open in IMG/M
3300029914|Ga0311359_10507990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45915Open in IMG/M
3300031199|Ga0307495_10000967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2841Open in IMG/M
3300031200|Ga0307496_10018396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45986Open in IMG/M
3300031232|Ga0302323_102572333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae581Open in IMG/M
3300031524|Ga0302320_10172231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3190Open in IMG/M
3300031547|Ga0310887_10122539All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300031562|Ga0310886_10010403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3399Open in IMG/M
3300031562|Ga0310886_10053404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii1839Open in IMG/M
3300031564|Ga0318573_10189651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L451088Open in IMG/M
3300031711|Ga0265314_10568487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45588Open in IMG/M
3300031833|Ga0310917_10370301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45973Open in IMG/M
3300032013|Ga0310906_10008628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3768Open in IMG/M
3300032063|Ga0318504_10659409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45503Open in IMG/M
3300032174|Ga0307470_11561244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45551Open in IMG/M
3300032180|Ga0307471_100513550All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300032562|Ga0316226_1200884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45829Open in IMG/M
3300033004|Ga0335084_11754108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45609Open in IMG/M
3300033233|Ga0334722_10422542All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300033475|Ga0310811_10405202All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300033475|Ga0310811_10494299All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300033475|Ga0310811_10926084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45780Open in IMG/M
3300033475|Ga0310811_11344218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae561Open in IMG/M
3300033500|Ga0326730_1017713All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300034090|Ga0326723_0159891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45991Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.28%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.19%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.19%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil4.71%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.14%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.62%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.09%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.09%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.57%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.57%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment1.05%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater1.05%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.05%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.05%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.05%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.05%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.05%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.05%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.05%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.52%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.52%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.52%
GroundwaterEnvironmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater0.52%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.52%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.52%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.52%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.52%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.52%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.52%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.52%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.52%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.52%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.52%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090004Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1EnvironmentalOpen in IMG/M
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300001904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2Host-AssociatedOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005949Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006636Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-twoEnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009296Microbial communities from groundwater in Rifle, Colorado, USA-3A_0.2umEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013092Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150mEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022889Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4EnvironmentalOpen in IMG/M
3300022892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5EnvironmentalOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025464Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025562Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025582Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-two (SPAdes)EnvironmentalOpen in IMG/M
3300025650Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025953Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026047Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026485Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6EnvironmentalOpen in IMG/M
3300026492Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026746Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026771Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026803Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026833Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes)EnvironmentalOpen in IMG/M
3300026841Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A3a-10 (SPAdes)EnvironmentalOpen in IMG/M
3300026890Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes)EnvironmentalOpen in IMG/M
3300027024Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes)EnvironmentalOpen in IMG/M
3300027411Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027420Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A1-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027444Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027485Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A3w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P1_DRAFT_004908602088090004SoilDAIEHKAVDPTLPLPAEKIQWIQEQMVKSGKLPKPLDIKVVTAPDYREKALKLVGK
Perma_A_C_034075002124908032SoilDPTLPLPAEKIQWIQEQMVKSGKLPKPLDIKIVTAPDYREKALKLVGK
FD1_058037302170459024Grass SoilWIQEQMVKAGRLKAPLDLKTVTAPEYREKALQVVGH
JGI24736J21556_105149913300001904Corn RhizosphereDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH*
JGI24750J21931_106239113300002070Corn, Switchgrass And Miscanthus RhizosphereLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH*
JGI24034J26672_1012031713300002239Corn, Switchgrass And Miscanthus RhizosphereYDDAIQHHAVDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH*
Ga0055439_1010764513300004019Natural And Restored WetlandsAEKFNWIQDQLVKAGKLKAPLDLKVVTAPEYREKALKLVNASH*
Ga0055498_1012329423300004058Natural And Restored WetlandsYDDAIQHHAVDPTLPLPAEKILWIQDQMVKAGKLKAALDLKAVTAPEYREKALKVIGH*
Ga0066809_1006818323300005168SoilAVDPTLPLPADKIQWIQEQMVKAGKLKAPLDLKTVTAPEYRERALKVIGH*
Ga0070690_10156968713300005330Switchgrass RhizosphereDPTLPLPADKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0066388_10665155513300005332Tropical Forest SoilFVYDDAVQHNAVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLSAVTAPEYREMALQVVGH
Ga0066388_10684748113300005332Tropical Forest SoilHAVDPTLPLPAEKIQWIQEQMVKAGRLKAPLDLNAVSAPEYREKALKVIGH*
Ga0066388_10843390513300005332Tropical Forest SoilEKIQWIQDQMVKAGRLKAPLDLKTVAAPEYREKALQVVGQ*
Ga0070692_1036150913300005345Corn, Switchgrass And Miscanthus RhizosphereAEKILWIQDQMVKAGKLKAALDLKAVTAPEYREKALKVIGH*
Ga0070668_10109797313300005347Switchgrass RhizosphereFVYDDAVQHNAVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH
Ga0070673_10124645513300005364Switchgrass RhizosphereHNAVDPTLPLPADKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0070688_10068122713300005365Switchgrass RhizosphereEKILWIQDQMVKAGKLKAPLDLKAVTAPEYREKALKVIGH*
Ga0070708_10032107733300005445Corn, Switchgrass And Miscanthus RhizosphereKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH*
Ga0070685_1001647553300005466Switchgrass RhizosphereAVDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH*
Ga0070707_10147188523300005468Corn, Switchgrass And Miscanthus RhizosphereKIQWIQEQMVKAGKLEAPLDLKVVTAPEYRERALKVLGH*
Ga0070737_1009486313300005524Surface SoilTLPLPMEKFAWIQDQLVKAGKLKAPLDLNSVVAPEYRQKALALVDGH*
Ga0070697_10054713923300005536Corn, Switchgrass And Miscanthus RhizosphereVYDDAVQHHAVDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH*
Ga0070732_1027191013300005542Surface SoilLPLPAEKIQWIQEQMAKAGKLAKPLDMKAVTAPEYRERALKLIGMSH*
Ga0070665_10109441313300005548Switchgrass RhizosphereIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0068859_10285361523300005617Switchgrass RhizosphereIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH*
Ga0066903_10737108013300005764Tropical Forest SoilRPAFVYDDAVQHNAVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0074472_1020477023300005833Sediment (Intertidal)VYDDAIKYKAVDPTLPIPAEKIRWIQEQMVKAGKLAKPLDLSAVSAPEYRARALKLVGP*
Ga0068863_10153980023300005841Switchgrass RhizosphereKIQWIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH*
Ga0068862_10102860523300005844Switchgrass RhizosphereADKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0066791_1006744223300005949SoilPTLPLPAEKILWIQEQMVKAGKLSKPLDVSVVTAPEYRERALKLVGK*
Ga0075024_10018583423300006047WatershedsVQHNAVDPTLPLPAEKIQWIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH*
Ga0075417_1060943923300006049Populus RhizosphereVYDDAIQNRAVDPTLPLPADKIQWIQEQMVKAGRLKAPLDLGIVTAPEFREKALKAIGH*
Ga0075029_10112641623300006052WatershedsVQEQLVKAGNIKEPLDLKTVVAPEIREKALKLSGS*
Ga0075026_10057465423300006057WatershedsIQEQMVKAGKLTKALDMQTVTAPEYRERALKHVGK*
Ga0075432_1014084623300006058Populus RhizosphereIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH*
Ga0075018_1069678113300006172WatershedsPLPADKIQWIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH*
Ga0070712_10046265533300006175Corn, Switchgrass And Miscanthus RhizosphereAVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH*
Ga0070712_10050876133300006175Corn, Switchgrass And Miscanthus RhizosphereIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0074054_1204383223300006579SoilLWIQDQMVKAGKLKAPLDLTAVTAPEYREKALKVIGH*
Ga0074049_1024408613300006580SoilDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEFREKALKVIGH*
Ga0074060_1183802633300006604SoilQHNAVDPTLPLPVDKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0075525_1007958223300006636Arctic Peat SoilDAIEHRAVDPTLPLPAEKIQWIQEQMVKSGKLPKPLDIKIVTAPDYREKALNLVGK*
Ga0075521_1007061533300006642Arctic Peat SoilIQWLQEQMVAAGKLPKPLDFNLVTAPEYREKALKLVGPNG*
Ga0079222_1107689923300006755Agricultural SoilVQHHAIDPTLPLPEEKIQWIQEQMVKAGKLKAPLDLKTVTAPEYREKALKVIGH*
Ga0079220_1030180513300006806Agricultural SoilPTEKIQWIQEQMVKAGKLKAPLDLSAVAAPEYREKALKVIGH*
Ga0079220_1071435613300006806Agricultural SoilPRPAFVYDDAIQHHAVDPTLPLPGEKILWIQDQMVKAGKLKAALDLKAVTAPEYREKALRVIGH*
Ga0075433_1087308513300006852Populus RhizosphereKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0066797_103501013300006864SoilAFVYDDAIEHKAVDPTLPLPAEKIQWIQEQMVKSGKLPKPLDIKVVTAPDYREKALKLVGK*
Ga0075436_10043936823300006914Populus RhizosphereAEKIQWIQDQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH*
Ga0075524_1027469523300006950Arctic Peat SoilWIQEQMVKAGKLAKPLDLAVVTAPEYREKALKLVGK*
Ga0066793_1080201213300009029Prmafrost SoilPDSPRPAVVFDDAVEHKAVDPTLPLPAAKILWIQEQMVKAGKLAKPLDLALVTAPEYREKALKLVGK*
Ga0105245_1124410013300009098Miscanthus RhizosphereYDDAIQHHAVDATLPLPADKIQWIQEQMVKAGKLKAPLDLKTVTAPEYREKALKVIGH*
Ga0105100_1101696513300009166Freshwater SedimentRAVDPTLPLPFDKFNWIQDQLVQAGKLKARLDLKDVTAPEYREKALKVVGH*
Ga0105248_1108706123300009177Switchgrass RhizosphereQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0103681_121059623300009296GroundwaterVFDDALKHKAVDPTLPIPAEKIQWIQEQMVKAGKLAKPLALSAVSAPEYRARALKLVDK*
Ga0105237_1071281923300009545Corn RhizosphereDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLKTVTAPEYREKALQILGH*
Ga0105854_137887623300009660Permafrost SoilFDDAVTHQAVDPALPLPGEKILWIQEQMVKGGNLAKALDLSIVTAPEYREKALKLLGK*
Ga0105856_120310823300009662Permafrost SoilGEKILWIHEQMVKGGNLAKALDLSIVTAPEYREKALKLVGK*
Ga0126374_1032741513300009792Tropical Forest SoilRPAFVYDDAIQYHAVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLKTVTAPEYRERALKVAGH*
Ga0126380_1200389323300010043Tropical Forest SoilVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLKTVTAPEYRERALKVIGH*
Ga0126376_1170085023300010359Tropical Forest SoilVYDDAIQHNAVDPTLPLPSEKIQWIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH*
Ga0126377_1058635023300010362Tropical Forest SoilDAIQNRAVDPTLPLPADKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALKAIGQ*
Ga0126377_1349204113300010362Tropical Forest SoilDDPRPTFVYDDAVAHNAVDPALPLPLDKINWIQEQLVKAGKMKAPLEPKAVTAPEYRERALKLIGHE*
Ga0126379_1196708413300010366Tropical Forest SoilTLPLPAEKIQWIQDQMVKAGRLKAPLDLNAVTAPEYREKALKVVGH*
Ga0126379_1309562513300010366Tropical Forest SoilTIALTRELIHAKPDDQRPAFVYDDAIKHKAVDATLPLPAEKIQWIQEQMVKAGKLPKPLETSAVTAPEYREKALKLVGTGH*
Ga0134125_1006072753300010371Terrestrial SoilDDAVQHHAVDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH*
Ga0134128_1175182623300010373Terrestrial SoilVDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKTVTAPEYREKALQVVGH*
Ga0134126_1030738113300010396Terrestrial SoilHHAVDPALPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYREKALKVIGH*
Ga0134124_1003684853300010397Terrestrial SoilDPTLPLPADKIQWIQEQMVKAGKLKAPLDLKIVTAPEYRERALKVIGH*
Ga0134121_1073305313300010401Terrestrial SoilDKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0137438_119862923300011431SoilELTRQITHAKPDDKRPGFVFDDAVAHKAVDPTLPLPAEKIQWIQEQMVKAGNIPKALDPKAVTAPEYREKALKLVDK*
Ga0137378_1111075513300012210Vadose Zone SoilAFVYDDAVQHHAVDPTLPLPAEKIQWIQDQMVKAGKLKGPLDLKTVTAPEYREKALQVVGH*
Ga0157353_103835013300012496Unplanted SoilFVYDDAVQHNAVDPTLPLPADKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH
Ga0157314_102850223300012500Arabidopsis RhizosphereAFVYDDAVQHNAVDPTLPLPADKIQWIQEQMVKAGRLKAPLDLSSVTAPEYREKALQVVGH*
Ga0157293_1011969513300012898SoilEKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH*
Ga0157295_1003866913300012906SoilTLPLSAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH*
Ga0157301_1010247923300012911SoilADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH*
Ga0157298_1016843213300012913SoilPADKIQWIQEQMVKAGKLKAPLDLKTVTAPEYREKALKVIGH*
Ga0153915_1222425423300012931Freshwater WetlandsDPTLPIPAEKIQWIQEQMVKAGKLAKPIELNVVSAPEYRARALKLVGP*
Ga0126375_1072204013300012948Tropical Forest SoilVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLGAVTAPEYREKALQVVGH*
Ga0164300_1026447013300012951SoilPRPAFVYDDAVQHHAVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLKTVTAPEYREKALQILGH*
Ga0164302_1060198323300012961SoilAFVYDDAIQHHAVDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH*
Ga0126369_1069590733300012971Tropical Forest SoilPLPAEKIQWIQDQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH*
Ga0164308_1070605523300012985SoilLPAEKIQWIQEQMVKAGRLKAPLDLKTVTAPEYRGRALQVLGH*
Ga0164304_1086046523300012986SoilQWIQEQMVKAGKLKAPLDLKTVTAPEYREKALKVIGH*
Ga0164307_1100650823300012987SoilAVQHSAVDPTLPLPAEKIQWIQEQMVKAGRLKAPLDLNAVTAPEYRENALQVVGH*
Ga0164306_1034675433300012988SoilPTLPLPAEKIQWIQEQMVKAGRLKAPLDLNAVTAPEYRKKALQVVGH*
Ga0164305_1045880823300012989SoilVYDDAVQHSAVDPTLPLPAEKIQWIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH*
Ga0164305_1178267223300012989SoilLPAEKIQWIQEQMVKSGKLKAPLDLKTVTAPEYREKALQVAGH*
Ga0163199_114924713300013092FreshwaterIQMQLVKAGKLAHPLDLKTVTAPEFREKALKKVGM*
Ga0157372_1001274813300013307Corn RhizosphereKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH*
Ga0182019_1126278213300014498FenIQWLQEQMVAAGKLPKPLDFNIVTAPEYREKALKLVGPNG*
Ga0167638_109622723300015197Glacier Forefield SoilIQWIQEQMVNAGKLAKPLDMNAVTAPEYREKALKLVGMSH*
Ga0137409_1137092523300015245Vadose Zone SoilPAEKILWIQEQMVKAGRLAKPLDLKAVTAPEYRERALKLVDKHG*
Ga0132256_10058261833300015372Arabidopsis RhizospherePTLPLPADKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH*
Ga0163161_1104779923300017792Switchgrass RhizosphereDAIQHHAVDATLPLPADKIQWIQEQMVKAGKLKAPLDLKTVTAPEYREKALQVVGH
Ga0187786_1014045213300017944Tropical PeatlandNAVDPTLPLPADKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH
Ga0187785_1001103553300017947Tropical PeatlandPRPAFVYDDAIQHHAVDATLPLPADKIQWIQEQMMKAGRLKAPLDLKTVTAPEYREKALQVVGH
Ga0187785_1016056423300017947Tropical PeatlandPTLPLPAEKIQWIQEQMVKAGKLKAPLELKVVTAPGYREKALNIIGH
Ga0187787_1000070913300018029Tropical PeatlandIQWIQEQMVKAGKLKAPLDLKVVTAPEYREKALNIIGP
Ga0187766_1114293613300018058Tropical PeatlandRPGFVYDDAIAHHAVDPTLPLPADKIQWIQEQMVKAGKLKAPLDLKVVTAPEYREKALTIIGH
Ga0187773_1118656723300018064Tropical PeatlandIQHHAVDATLPLPADKIQWIQEQMMKAGRLKAPLDLKTVTAPEYREKALQVVGH
Ga0173479_1013084423300019362SoilPAFVYDDAIQYHAVDPTLPLPAEKIQWIQEQMVKAGRLKTPLDLKTVTAPEYREKALQVLGH
Ga0126371_1354304523300021560Tropical Forest SoilPAEKIQWIQDQMVKAGRLKAPLDLNAVTAPEYREKALKVVGH
Ga0222622_1070024623300022756Groundwater SedimentDPTLPLPTAKIQWIQEQMVKAGRLKAPLDLATVTAPEFRERALKVLGH
Ga0247786_112171623300022883SoilVDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0247785_103297723300022889SoilRPAFVYDDAIQHRAVDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0247753_100079213300022892SoilPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0207673_104420523300025290Corn, Switchgrass And Miscanthus RhizosphereKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0208076_104122523300025464Arctic Peat SoilIQEQMVKAGKLSKPLEVSVVTAPEYRERALKLVGK
Ga0210139_103270713300025558Natural And Restored WetlandsAEKFNWIQDQLVKAGKLKAPLDLKVVTAPEYREKALKLVNASH
Ga0210139_106045413300025558Natural And Restored WetlandsIQDQMVKAGKLKAALDLKAVTAPEYREKALKVIGH
Ga0210099_105682613300025562Natural And Restored WetlandsLPAEKLNWLQGQLVKAGKLKAPLDLKTVTAPEYRAKALKLSGS
Ga0209386_106616813300025582Arctic Peat SoilAFVYDDAIEHKAVDPTLPLPAEKIQWIQEQMVKSGKLPKPLDIKIVTAPDYREKALNLVG
Ga0209385_119241823300025650Arctic Peat SoilQEQLVKAGKLKAPLDLATVTAPEYREKALKMVSTGH
Ga0209176_1003981613300025854Arctic Peat SoilTLPLPAEKIQWIQEQMVKSGKLPKPLDIKIVTAPDYREKALNLVGK
Ga0209584_1010266413300025878Arctic Peat SoilLKSSGFGSLPAEKIQWLQEQMVAAGKLPKPLDFNLVTAPEYREKALKLVGPNG
Ga0209540_1010084233300025888Arctic Peat SoilPRPAFVYDDAIEHKAVDPTLPLPAEKIQWIQEQMVKSGKLPKPLDIKIVTAPDYREKALKLVGK
Ga0207692_1117944513300025898Corn, Switchgrass And Miscanthus RhizosphereAEKIQWIQEQMVKAGRLKAPLDLKTVTAPEYREKALQVLGH
Ga0207688_1060258613300025901Corn, Switchgrass And Miscanthus RhizosphereTLPLPADKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH
Ga0207685_1016730433300025905Corn, Switchgrass And Miscanthus RhizosphereEKIQWIQEQMVKAGRLKAPLDLKTVTAPEYREKALQVLGH
Ga0207699_1107365613300025906Corn, Switchgrass And Miscanthus RhizospherePLPAEKIQWIQDQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH
Ga0207645_1033019523300025907Miscanthus RhizospherePAFVYDDAIQHHAVDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0207654_1029295813300025911Corn RhizosphereYDDAIQHHAVDATLPLPADKIQWIQEQMVKAGKLKAPLDLKTVTAPEYREKALKVIGH
Ga0207663_1026895813300025916Corn, Switchgrass And Miscanthus RhizosphereTLPLPAEKIQWIQEQMVKAGKLKAPLDLKTVTAPEYREKALKVIGH
Ga0207662_1072081213300025918Switchgrass RhizospherePLPAEKILWIQDQMVKAGKLKAPLDLKAVTAPEYREKALKVIGH
Ga0207650_1039486413300025925Switchgrass RhizospherePRPAFVYDDAIQHRAVDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0207700_1027761013300025928Corn, Switchgrass And Miscanthus RhizosphereWIQEQMVKAGKLKAPLDLKTVTAPEYREKALKVIGH
Ga0207690_1062771223300025932Corn RhizosphereIQEQLVKAHKLSKPLPVEQVTAPEIREKALKLVGHS
Ga0207709_1111319013300025935Miscanthus RhizospherePTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0207711_1008834313300025941Switchgrass RhizosphereFVYDDAVQHHAVDPTLPLPAEKILWIQDQMVKAGKLKAPLDLKAVTAPEYREKALKVIGH
Ga0207661_1158928013300025944Corn RhizosphereIQEQMVKAGKLKAPLDLKTVTAPEYREKALKVIGH
Ga0207679_1012572713300025945Corn RhizosphereSAVDPTLPLPAEKIQWIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH
Ga0207679_1068790623300025945Corn RhizosphereLPLPADKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH
Ga0210068_101123113300025953Natural And Restored WetlandsLWIQDQMVKAGKLKAALDLKAVTAPEYREKALKVIGH
Ga0207712_1024392833300025961Switchgrass RhizosphereQHHAVDPTLPPPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0207703_1018813733300026035Switchgrass RhizospherePAFVYDDAIQHRAVDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0208658_102305023300026047Natural And Restored WetlandsPRPAFVYDDAIQHHAVDPTLPLPAEKILWIQDQMVKAGKLKAPLDLKTVTAPEYRERALKVIGH
Ga0207708_1011805323300026075Corn, Switchgrass And Miscanthus RhizosphereVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLKTVTAPEYREKALQILGH
Ga0207641_1071919913300026088Switchgrass RhizosphereLPAEKIQWIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH
Ga0207676_1085932723300026095Switchgrass RhizosphereAVDPTLPLPAEKILWIQDQMVKAGKLKAPLDLKAVTAPEYREKALKVIGH
Ga0207674_1125594223300026116Corn RhizosphereVQHSAVDPTLPLPAEKIQWIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH
Ga0209840_102830733300026223SoilLPAEKIQWIQEQMVKSGKLPKPLDIKVVTAPDYREKALKLVGK
Ga0256805_105991213300026485SedimentIRWIQEQMVKAGKLKAPLDLKDVTAPEYREKALKVIGH
Ga0256802_101940913300026492SedimentVYDDAIQHHAVDPTLPLPAEKILWIQDQMVKAGKLKAALDLKAVTAPEYREKALKVIGH
Ga0257159_105600023300026494SoilPRPAFVYDDAIQYHAVDPTLPLPAEKIQWIQEQMVKAGRLKAPLDLKAVTAPEYREKALQVLGH
Ga0207454_10236413300026746SoilDDAVQHHAVDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH
Ga0207552_10230313300026771SoilDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0207549_10571313300026803SoilQHHAVDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH
Ga0207728_10292713300026833Tropical Forest SoilHELIHAKSDDARPAFVYDDAVKHKAVDPTLPLPAAKILWIQEQMAKAGKLAKPLDVATVTAPEYRDKALKLVGP
Ga0207490_100263523300026841SoilWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH
Ga0207781_102950413300026890Tropical Forest SoilKSDDARPAFVYDDAVKHKAVDPTLPLPAAKILWIQEQMAKAGKLAKPLDVATVTAPEYRDKALKLVGP
Ga0207819_103639913300027024Tropical Forest SoilRPAFVFDDALKHHAVDPTLPLPAEKIQWIQEQMVKAGKLKAPLELSAVAAPEYREKALKVLGH
Ga0207519_10023513300027411SoilTLPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH
Ga0207436_10042233300027420SoilAVDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH
Ga0207468_100107033300027444SoilAFVYDDAIQHHAVDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIG
Ga0207635_101936523300027485SoilLPLPADKIQWIQEQMVKAGKLKAPLDLKTVTAPEYREKALKVIGH
Ga0207761_103122313300027516Tropical Forest SoilKIQWIQEQMVKAGKLKAPLELSAVAAPEYREKALKVLGH
Ga0207981_102321013300027560SoilHHAVDPTLPLPADKIQWIQEQMVKAGKLKAPLDLKTVTAPEYRERALKVIGH
Ga0209726_1024005513300027815GroundwaterPAFVYDDAIKYKAVDPTLPIPAEKIQWIQEQMAKAGKLAKPLDLLAVSAPEYRAKALKLVGP
Ga0209514_1013768533300027819GroundwaterIPADKIQWIQEQMVKAGKLAKPLELKTVTAPEYRDKALKLVGK
Ga0209974_1030168313300027876Arabidopsis Thaliana RhizosphereAVDPTLPLPAEKIQWIQEQMGKAGKLKTPLDLKIVTAPEYRERALKVLGH
Ga0207428_1019960113300027907Populus RhizosphereQHHAVDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKTVTAPEYRERALKIIGH
Ga0268266_1077288423300028379Switchgrass RhizosphereDPTLPLPAEKIQWIQEQMVKAGRLKAPLDLKTVTAPEYREKALQVLGH
Ga0307313_1021354323300028715SoilEHKAVDPTLPLPTAKIQWIQEQMVKAGRLKAPLDLATVTAPEFRERALKVLGH
Ga0307317_1004767633300028720SoilDKIQWIQEQMVKAGRLKAPLDLKTVTAPEYREKALQVVGH
Ga0307305_1034010413300028807SoilAFVYDDAVQHQAVDPTLPLPTDKIQWIQEQMVKAGRLKAPLDLKTVTAPEYREKALQVVG
Ga0311359_1050799013300029914BogRPAFVFDDAVAHNAVDPTLPLPAEKLNWIQDQLIKAGKMSKRLDLKDIAAPEFREQALKLAGPHG
Ga0307495_1000096743300031199SoilRPAFVYDDAVEHQAVDPTLPLPTDKIQWIQEQMVKAGRLKAPLDLKTVTAPEYREKALQVVGH
Ga0307496_1001839613300031200SoilIQEQMVKAGRLKAPLDLKTVTAPEYREKALQVVGH
Ga0302323_10257233323300031232FenLHKAVDPTLPLPGEKIMWIQEQMVKAGSMTKPLDLATVTAPEYRERALKKVGM
Ga0302320_1017223113300031524BogVDPALPLPAEKILWVQEQMVKAGSIPKALDLKTVTAPEYRERALKLVGPNG
Ga0310887_1012253913300031547SoilDKIQWIQEQMVKAGRLKAPLDLSAVTAPEYREKALQVVGH
Ga0310886_1001040353300031562SoilAVQHHAVDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH
Ga0310886_1005340413300031562SoilQHSAVDPTLPLPAEKIQWIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH
Ga0318573_1018965113300031564SoilFVYDDAVQHNAVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLNTVTAPEYREKALQVVGH
Ga0265314_1056848723300031711RhizospherePLPAEKILWIQEQMVKAGSIPKPLDLAVVTAPEYREKALKLVGQ
Ga0310917_1037030113300031833SoilAFVYDDAVQHHAVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLKTVTAPEYRERAQQVVG
Ga0310906_1000862853300032013SoilTLPLPAEKIQWIQEQMVKAGRLKAPLDLNAVTAPEYREKALQVVGH
Ga0318504_1065940913300032063SoilEKIQWIQDQMVKAGRLKAPLDLNTVTAPEYREKALQVVGH
Ga0307470_1156124413300032174Hardwood Forest SoilIQHHAVDPTLPLPAEKIQWIQEQMVKAGKLKAPLDLKVVTAPEYRERALKVLGH
Ga0307471_10051355013300032180Hardwood Forest SoilKIQWIQEQMVKAGRLKAPLDLKTVTAPEYREKALQVLGH
Ga0316226_120088423300032562FreshwaterKIMWIQEQMVKAGSMNKALDLAAVTAPEYRERALKKAGM
Ga0335084_1175410823300033004SoilWIQEQMVKAGKLAKPLDLNTVSAPEYREKALKLVGK
Ga0334722_1042254223300033233SedimentKAVDPTLPIPAEKIQWIQEQMAKAGKLAKPLDLLAVSAPEYREKALKLVGQ
Ga0310811_1040520213300033475SoilHHAVDPALPLPAEKIQWIQEQMVKAGKLKAPLDLKKVTAPEYREKALKVIGH
Ga0310811_1049429933300033475SoilAVDPTLPLPADKIQWIQEQMVKAGKLKAPLDLKIVTAPEYRERALKVIGH
Ga0310811_1092608413300033475SoilAVDPTLPLPADKIQWIQEQMVKAGKLKVPLDLKAVTAPEYREKALKVIGH
Ga0310811_1134421823300033475SoilKKVTHEKSDDPRAAFVYDDAVEHHAVDPTLPLPKQKFEWIEDQLVKAHKLNKALPVEQVTAPEYREKAFKLAGHS
Ga0326730_101771333300033500Peat SoilVDPTLPLPAEKIQWIQDQMVKAGRLKAPLDLKTVTAPEYREKALQVVGH
Ga0326723_0159891_848_9913300034090Peat SoilPTLPLPAEKIQWIQDQMVKAGRLKAPLDLKTVTAPEYREKALQVVGH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.