NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029169

Metagenome / Metatranscriptome Family F029169

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029169
Family Type Metagenome / Metatranscriptome
Number of Sequences 189
Average Sequence Length 92 residues
Representative Sequence MSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGRK
Number of Associated Samples 116
Number of Associated Scaffolds 189

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.30 %
% of genes near scaffold ends (potentially truncated) 92.59 %
% of genes from short scaffolds (< 2000 bps) 83.60 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.413 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(43.915 % of family members)
Environment Ontology (ENVO) Unclassified
(32.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.265 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 23.73%    β-sheet: 18.64%    Coil/Unstructured: 57.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 189 Family Scaffolds
PF00589Phage_integrase 2.65
PF00083Sugar_tr 2.65
PF11645PDDEXK_5 2.12
PF07883Cupin_2 2.12
PF13620CarboxypepD_reg 1.59
PF07642BBP2 1.59
PF07617DUF1579 1.06
PF00196GerE 1.06
PF03795YCII 1.06
PF00078RVT_1 1.06
PF13424TPR_12 1.06
PF01875Memo 1.06
PF12867DinB_2 1.06
PF13495Phage_int_SAM_4 1.06
PF00561Abhydrolase_1 1.06
PF00072Response_reg 0.53
PF00756Esterase 0.53
PF04255DUF433 0.53
PF13662Toprim_4 0.53
PF00579tRNA-synt_1b 0.53
PF02635DrsE 0.53
PF03449GreA_GreB_N 0.53
PF00534Glycos_transf_1 0.53
PF08281Sigma70_r4_2 0.53
PF12680SnoaL_2 0.53
PF00383dCMP_cyt_deam_1 0.53
PF00903Glyoxalase 0.53
PF00137ATP-synt_C 0.53
PF02652Lactate_perm 0.53
PF135322OG-FeII_Oxy_2 0.53
PF14319Zn_Tnp_IS91 0.53
PF03544TonB_C 0.53
PF13565HTH_32 0.53
PF00111Fer2 0.53
PF08327AHSA1 0.53
PF12146Hydrolase_4 0.53
PF05656DUF805 0.53
PF00005ABC_tran 0.53
PF00144Beta-lactamase 0.53
PF03372Exo_endo_phos 0.53
PF04240Caroten_synth 0.53
PF00677Lum_binding 0.53
PF01027Bax1-I 0.53
PF14743DNA_ligase_OB_2 0.53
PF13650Asp_protease_2 0.53
PF13673Acetyltransf_10 0.53
PF01261AP_endonuc_2 0.53
PF07676PD40 0.53
PF01799Fer2_2 0.53
PF00437T2SSE 0.53
PF03547Mem_trans 0.53
PF02518HATPase_c 0.53
PF00069Pkinase 0.53
PF02687FtsX 0.53
PF06197DUF998 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 189 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.12
COG1355Predicted class III extradiol dioxygenase, MEMO1 familyGeneral function prediction only [R] 1.06
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.06
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.53
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.53
COG0307Riboflavin synthase alpha chainCoenzyme transport and metabolism [H] 0.53
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 0.53
COG0679Predicted permease, AEC (auxin efflux carrier) familyGeneral function prediction only [R] 0.53
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.53
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.53
COG1620L-lactate permeaseEnergy production and conversion [C] 0.53
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.53
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.53
COG2324Uncharacterized membrane proteinFunction unknown [S] 0.53
COG2367Beta-lactamase class ADefense mechanisms [V] 0.53
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.53
COG3152Uncharacterized membrane protein YhaH, DUF805 familyFunction unknown [S] 0.53
COG3371Uncharacterized membrane proteinFunction unknown [S] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.41 %
UnclassifiedrootN/A1.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001084|JGI12648J13191_1000460All Organisms → cellular organisms → Bacteria5733Open in IMG/M
3300001084|JGI12648J13191_1000463All Organisms → cellular organisms → Bacteria5694Open in IMG/M
3300001175|JGI12649J13570_1008297All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1274Open in IMG/M
3300001593|JGI12635J15846_10641529All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli615Open in IMG/M
3300002245|JGIcombinedJ26739_100276962All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1564Open in IMG/M
3300002245|JGIcombinedJ26739_100454602All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1158Open in IMG/M
3300003220|JGI26342J46808_1020235All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli643Open in IMG/M
3300004091|Ga0062387_100720706All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli733Open in IMG/M
3300005541|Ga0070733_10025081All Organisms → cellular organisms → Bacteria3716Open in IMG/M
3300005591|Ga0070761_10196610Not Available1194Open in IMG/M
3300005610|Ga0070763_10642748All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli618Open in IMG/M
3300005921|Ga0070766_10280802All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1064Open in IMG/M
3300006176|Ga0070765_100279474All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1538Open in IMG/M
3300006176|Ga0070765_101607881All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli611Open in IMG/M
3300009700|Ga0116217_10074561All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli2372Open in IMG/M
3300014199|Ga0181535_10105810All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1807Open in IMG/M
3300014200|Ga0181526_10436234All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli830Open in IMG/M
3300017946|Ga0187879_10034035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli3066Open in IMG/M
3300017948|Ga0187847_10083820All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1768Open in IMG/M
3300017948|Ga0187847_10379826All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli775Open in IMG/M
3300017948|Ga0187847_10423266All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli733Open in IMG/M
3300017948|Ga0187847_10587976All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli621Open in IMG/M
3300017955|Ga0187817_10843727All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli585Open in IMG/M
3300017988|Ga0181520_10379310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1032Open in IMG/M
3300017998|Ga0187870_1130588All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli937Open in IMG/M
3300017999|Ga0187767_10107393All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli784Open in IMG/M
3300018003|Ga0187876_1264866All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli556Open in IMG/M
3300018008|Ga0187888_1155115All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli934Open in IMG/M
3300018013|Ga0187873_1105887All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1108Open in IMG/M
3300018019|Ga0187874_10124454All Organisms → cellular organisms → Bacteria → Acidobacteria1105Open in IMG/M
3300018030|Ga0187869_10629439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli505Open in IMG/M
3300018033|Ga0187867_10003733All Organisms → cellular organisms → Bacteria12044Open in IMG/M
3300018033|Ga0187867_10695947All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli554Open in IMG/M
3300018034|Ga0187863_10064890All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2067Open in IMG/M
3300018034|Ga0187863_10072716All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1942Open in IMG/M
3300018037|Ga0187883_10042415All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli2430Open in IMG/M
3300018040|Ga0187862_10758842All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli564Open in IMG/M
3300018042|Ga0187871_10395128All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli764Open in IMG/M
3300018043|Ga0187887_10044691All Organisms → cellular organisms → Bacteria → Acidobacteria2738Open in IMG/M
3300018044|Ga0187890_10154316All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1314Open in IMG/M
3300018044|Ga0187890_10189204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1170Open in IMG/M
3300018044|Ga0187890_10332344All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli853Open in IMG/M
3300018046|Ga0187851_10162506All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1346Open in IMG/M
3300018047|Ga0187859_10757702All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli555Open in IMG/M
3300018057|Ga0187858_10100439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1976Open in IMG/M
3300018060|Ga0187765_11079206All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli556Open in IMG/M
3300018062|Ga0187784_10765672All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli771Open in IMG/M
3300018062|Ga0187784_11078806All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli638Open in IMG/M
3300018085|Ga0187772_10661153All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli747Open in IMG/M
3300018085|Ga0187772_10826411All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli670Open in IMG/M
3300018088|Ga0187771_10290633All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1369Open in IMG/M
3300018088|Ga0187771_10381428All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1187Open in IMG/M
3300018088|Ga0187771_10957770All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli726Open in IMG/M
3300018088|Ga0187771_11420921All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli589Open in IMG/M
3300019786|Ga0182025_1302402All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1856Open in IMG/M
3300020582|Ga0210395_10086222All Organisms → cellular organisms → Bacteria → Acidobacteria2317Open in IMG/M
3300021181|Ga0210388_10558455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1003Open in IMG/M
3300021402|Ga0210385_10324811All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1145Open in IMG/M
3300021404|Ga0210389_10169158All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1699Open in IMG/M
3300021433|Ga0210391_10106739All Organisms → cellular organisms → Bacteria2206Open in IMG/M
3300021433|Ga0210391_10334810All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1187Open in IMG/M
3300021433|Ga0210391_10586681All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli875Open in IMG/M
3300021433|Ga0210391_10697469All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli795Open in IMG/M
3300021444|Ga0213878_10447733All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli565Open in IMG/M
3300021474|Ga0210390_10909603All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli723Open in IMG/M
3300021477|Ga0210398_10070774All Organisms → cellular organisms → Bacteria2838Open in IMG/M
3300021477|Ga0210398_11606216All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli504Open in IMG/M
3300021560|Ga0126371_12759189All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli596Open in IMG/M
3300023250|Ga0224544_1060516All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli547Open in IMG/M
3300025414|Ga0208935_1023880All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli809Open in IMG/M
3300025414|Ga0208935_1027425All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli754Open in IMG/M
3300027370|Ga0209010_1000294All Organisms → cellular organisms → Bacteria → Acidobacteria17040Open in IMG/M
3300027590|Ga0209116_1017105All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1481Open in IMG/M
3300027676|Ga0209333_1086719All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli856Open in IMG/M
3300027745|Ga0209908_10238664All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli509Open in IMG/M
3300027768|Ga0209772_10016432All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli2071Open in IMG/M
3300027829|Ga0209773_10381099All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli586Open in IMG/M
3300027879|Ga0209169_10032979All Organisms → cellular organisms → Bacteria2743Open in IMG/M
3300027879|Ga0209169_10064858All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1889Open in IMG/M
3300027884|Ga0209275_10614449All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli624Open in IMG/M
3300027889|Ga0209380_10180741All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1237Open in IMG/M
3300027889|Ga0209380_10447653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli755Open in IMG/M
3300027895|Ga0209624_10138710All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1604Open in IMG/M
3300027895|Ga0209624_10425451All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli885Open in IMG/M
3300027895|Ga0209624_10498631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli811Open in IMG/M
3300027895|Ga0209624_10652615All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli696Open in IMG/M
3300027908|Ga0209006_10548057All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli960Open in IMG/M
3300028562|Ga0302151_10207019All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli664Open in IMG/M
3300028747|Ga0302219_10219380All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli735Open in IMG/M
3300028759|Ga0302224_10072283All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1308Open in IMG/M
3300028759|Ga0302224_10453073All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli523Open in IMG/M
3300028773|Ga0302234_10443429All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli555Open in IMG/M
3300028776|Ga0302303_10081956All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1202Open in IMG/M
3300028776|Ga0302303_10132204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli893Open in IMG/M
3300028780|Ga0302225_10154803All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. 5B51111Open in IMG/M
3300028780|Ga0302225_10230828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae885Open in IMG/M
3300028795|Ga0302227_10349152All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli561Open in IMG/M
3300028798|Ga0302222_10058108All Organisms → cellular organisms → Bacteria1564Open in IMG/M
3300028798|Ga0302222_10171536All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli852Open in IMG/M
3300028806|Ga0302221_10418110All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli584Open in IMG/M
3300028808|Ga0302228_10066583All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1715Open in IMG/M
3300028866|Ga0302278_10153323All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1199Open in IMG/M
3300028871|Ga0302230_10159943All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli881Open in IMG/M
3300028871|Ga0302230_10205388Not Available764Open in IMG/M
3300028874|Ga0302155_10395627All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli590Open in IMG/M
3300028906|Ga0308309_10054806All Organisms → cellular organisms → Bacteria2895Open in IMG/M
3300028906|Ga0308309_10444938All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1116Open in IMG/M
3300029882|Ga0311368_10184936All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1666Open in IMG/M
3300029907|Ga0311329_10572234All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli754Open in IMG/M
3300029910|Ga0311369_11187389All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli590Open in IMG/M
3300029913|Ga0311362_10690861All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli877Open in IMG/M
3300029939|Ga0311328_10495438All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli859Open in IMG/M
3300029943|Ga0311340_10351167All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1378Open in IMG/M
3300029943|Ga0311340_10931985All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli719Open in IMG/M
3300029943|Ga0311340_11253858All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli593Open in IMG/M
3300029944|Ga0311352_10347083All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1226Open in IMG/M
3300029951|Ga0311371_11196068All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli879Open in IMG/M
3300029951|Ga0311371_12354073All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli548Open in IMG/M
3300029982|Ga0302277_1291593All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli600Open in IMG/M
3300029999|Ga0311339_10654670All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1035Open in IMG/M
3300029999|Ga0311339_11673174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli558Open in IMG/M
3300030007|Ga0311338_10181987All Organisms → cellular organisms → Bacteria2449Open in IMG/M
3300030007|Ga0311338_10201004All Organisms → cellular organisms → Bacteria2298Open in IMG/M
3300030007|Ga0311338_10718375All Organisms → cellular organisms → Bacteria → Proteobacteria1008Open in IMG/M
3300030007|Ga0311338_11129686All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300030007|Ga0311338_11710609All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli570Open in IMG/M
3300030042|Ga0302300_1166986All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli628Open in IMG/M
3300030043|Ga0302306_10024058All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2505Open in IMG/M
3300030051|Ga0302195_10263828All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli772Open in IMG/M
3300030053|Ga0302177_10525953All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli609Open in IMG/M
3300030056|Ga0302181_10400757All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli592Open in IMG/M
3300030057|Ga0302176_10135299All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli974Open in IMG/M
3300030057|Ga0302176_10177945All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli846Open in IMG/M
3300030057|Ga0302176_10316643All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli627Open in IMG/M
3300030058|Ga0302179_10051875All Organisms → cellular organisms → Bacteria1844Open in IMG/M
3300030058|Ga0302179_10412868All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli594Open in IMG/M
3300030058|Ga0302179_10551344All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli505Open in IMG/M
3300030399|Ga0311353_10201115All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1871Open in IMG/M
3300030490|Ga0302184_10254188All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli719Open in IMG/M
3300030503|Ga0311370_10235401All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli2428Open in IMG/M
3300030503|Ga0311370_10977656All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli947Open in IMG/M
3300030509|Ga0302183_10022014All Organisms → cellular organisms → Bacteria2619Open in IMG/M
3300030520|Ga0311372_12464304All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli586Open in IMG/M
3300030520|Ga0311372_13018255All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli508Open in IMG/M
3300030580|Ga0311355_10490663All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1180Open in IMG/M
3300030580|Ga0311355_10500158All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1166Open in IMG/M
3300030617|Ga0311356_10219257All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1937Open in IMG/M
3300030617|Ga0311356_10258597All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1758Open in IMG/M
3300030618|Ga0311354_10443039All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300030618|Ga0311354_10671570All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli995Open in IMG/M
3300030618|Ga0311354_10745684All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli931Open in IMG/M
3300030618|Ga0311354_11133000All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli712Open in IMG/M
3300030618|Ga0311354_11673622All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli557Open in IMG/M
3300030737|Ga0302310_10570490All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli600Open in IMG/M
3300030739|Ga0302311_10116125All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli2137Open in IMG/M
3300030739|Ga0302311_10265836All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1262Open in IMG/M
3300030878|Ga0265770_1026799All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli945Open in IMG/M
3300030906|Ga0302314_10585126All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1172Open in IMG/M
3300031027|Ga0302308_10427491All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli791Open in IMG/M
3300031234|Ga0302325_10010077All Organisms → cellular organisms → Bacteria20528Open in IMG/M
3300031234|Ga0302325_10059615All Organisms → cellular organisms → Bacteria7495Open in IMG/M
3300031234|Ga0302325_10070258All Organisms → cellular organisms → Bacteria → Proteobacteria6784Open in IMG/M
3300031234|Ga0302325_10133715All Organisms → cellular organisms → Bacteria → Acidobacteria4504Open in IMG/M
3300031234|Ga0302325_10156160All Organisms → cellular organisms → Bacteria4063Open in IMG/M
3300031234|Ga0302325_10930809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1200Open in IMG/M
3300031234|Ga0302325_11087599All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1079Open in IMG/M
3300031234|Ga0302325_11574564All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300031234|Ga0302325_12102952All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli691Open in IMG/M
3300031234|Ga0302325_12286183All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli654Open in IMG/M
3300031236|Ga0302324_100108537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4675Open in IMG/M
3300031236|Ga0302324_100383880All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli2104Open in IMG/M
3300031236|Ga0302324_100395380All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli2065Open in IMG/M
3300031236|Ga0302324_100880513All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1234Open in IMG/M
3300031236|Ga0302324_102163297All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli691Open in IMG/M
3300031236|Ga0302324_103165884All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli542Open in IMG/M
3300031525|Ga0302326_10222586Not Available3115Open in IMG/M
3300031525|Ga0302326_11515843All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli897Open in IMG/M
3300031525|Ga0302326_11573456All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli875Open in IMG/M
3300031525|Ga0302326_12919420All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli586Open in IMG/M
3300031525|Ga0302326_13323486All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli539Open in IMG/M
3300031708|Ga0310686_105789600All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli531Open in IMG/M
3300031708|Ga0310686_108311798All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300031708|Ga0310686_108460196All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli752Open in IMG/M
3300031837|Ga0302315_10205917All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1180Open in IMG/M
3300031910|Ga0306923_11895837All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli609Open in IMG/M
3300032898|Ga0335072_10929644All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli809Open in IMG/M
3300034124|Ga0370483_0184449All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli707Open in IMG/M
3300034163|Ga0370515_0098875All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli1260Open in IMG/M
3300034163|Ga0370515_0346168All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli628Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa43.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland13.23%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.41%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.82%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.29%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.23%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.12%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.59%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.59%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.06%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.53%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.53%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.53%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.53%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.53%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.53%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001084Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1EnvironmentalOpen in IMG/M
3300001175Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003220Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028562Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030042Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12648J13191_100046083300001084Forest SoilMSVPQRFLSFVLACASSAIVARAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGIDDCRWTADGFAVICETVLYRPGSKYSDTSFVYYDPTSKT*
JGI12648J13191_100046323300001084Forest SoilMSVPQRFLSFVLVCASSAIVARAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGIDDCRWTADGFAVICETVLYRPGSKYSDTSFVYYDPTSKT*
JGI12649J13570_100829723300001175Forest SoilIQMSVPQRFLSFVLACASSAIVARAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGIDDCRWTADGFAVICETVLYRPGSKYSDTSFVYYDPTSKT*
JGI12635J15846_1064152923300001593Forest SoilMSVPRRFLSFVLACASSAIVVCAQSQTTPSQEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYR
JGIcombinedJ26739_10027696233300002245Forest SoilMSVPQRFLSFVLACASSAIVACAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYRPGSKYSDTSFVYYDPTSKT*
JGIcombinedJ26739_10045460233300002245Forest SoilMSGPQMLISFVLACASSAIVAGAQSQTTPSPEVKRLAVMVGQFTVEDELKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICETVLNRPGKKYSDT
JGI26342J46808_102023513300003220Bog Forest SoilMRGRKRLLSFVLACASSAIAGDQSQTTPPKRGPGPEVEKLAVMVGKFTVEDELKAGVMGPNSPAMKYTGTDDCRWSAGGFAVICTA
Ga0062387_10072070613300004091Bog Forest SoilMNDPQRLLSFVLACASSVIVVPAQSQTTPSPEVKKLAAMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICE
Ga0070733_1002508153300005541Surface SoilMRYLTTLLSFVLACASSVIVARAQSQTTPSPEVKKLAVMVGKFTVEDEVKAGALGSNSPATKFSGTDDCRWTAGGFAVICEATLYRPGRKYSEASFVYYDP
Ga0070761_1019661013300005591SoilMSGPQKLVSFVLACASSVIVAGAQSQTTPGPEVKKLAVMVGRFTIEDELKAGAMGPNSPALKFRGTDDCRWTAGGF
Ga0070763_1064274823300005610SoilVLACASSAIVACAQSQTTPSPEVKKLAVMVGRFTVEDELKAGAMGPNSPVMKFTGTDDCRWTADGFAVICETVLYRP
Ga0070766_1028080223300005921SoilMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAIGPNSPAMKFSGIDDCKWTAGGFAVICEAALYRPGRKYSEASFVYYDPTSRTYRYHAV
Ga0070765_10027947433300006176SoilMCGPKRLLSFVLACASTVIAGDQSQTTPPKPGPGPEVKKLAVMVGRFTIEDELKAGAMAPNSHAMKYTGIDDCRWTAGGFAVICTTVLHMGARKYTDTSFTYYDPTARTYRYLAVDSSGGIENKTGTVSRDTWTLVGDSTIAGKVYHTRYIM
Ga0070765_10160788123300006176SoilMCRHAKLLAFVLACASRPIAARVQSQPTRGPEVKKMAVMVGKFTVEDELKAGAMGPTSPAMKFSGTDDCRWTAGGFAV
Ga0116217_1007456113300009700Peatlands SoilMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGTIMGPNSPATKFSGTEDCRWTAGGF
Ga0181535_1010581013300014199BogMRYLTTLLSFVLTCASIVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALY
Ga0181526_1043623413300014200BogMSYLTTLLSFVLTCASIVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAIGPNSPATKFSGTDDCRWTAGGFAVICE
Ga0187879_1003403533300017946PeatlandMRYLATLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYSDASSSTTIRAPRHTDTTQSTVQEE
Ga0187847_1008382013300017948PeatlandMNGPQRLVSFVLACASSVIVAGAQSQTTPGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKYTGTDDCRWAARGFAVICETALHRPGRKYSEA
Ga0187847_1037982613300017948PeatlandMCGPKRLLSFVLASALSVIAGDQSQTKPPKRGPGPEVEKLAVMVGRFTVEDELKAGAMGPNSPAMKYTGTDDCRWAARGFAVICETALHRPGRKYSEA
Ga0187847_1042326623300017948PeatlandMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYR
Ga0187847_1058797613300017948PeatlandMRYLTTLLSFVVACASRGIVARAQSQTTPGPEVKKLAIMVGKFTVEDEVKAGAMAPDSPATKFRGTDDCRWTAGGFAV
Ga0187817_1084372713300017955Freshwater SedimentMSVPQRLFSFVLACASSVIVARAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTAG
Ga0181520_1037931013300017988BogMSRTQRLASFVLACASSVIVAGAQSQTTRGPEVEKLAVIVGRFTIEDELKAGAMGPNSPAMKFTGTEDCRWTPGGFAVICDATL
Ga0187870_113058823300017998PeatlandMSVPQRLFSFVLACASSVIVARAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYRPGRKYSDASFVYYDPTAK
Ga0187767_1010739323300017999Tropical PeatlandMSGRQRLLSFVLAHVSSVIVARAQSQTMPGPEVKKLAVMVGKFTVEDEVKAGAMGPSSPAMKFSGTEDCRWTAGGFAVIC
Ga0187876_126486613300018003PeatlandMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYSE
Ga0187888_115511513300018008PeatlandMRYLATLFSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEASSSTTIRAPRHTDTTQS
Ga0187873_110588723300018013PeatlandMSGPQRLISFVLACASSVFVAGAQSQTTPGPEVKKLAVIVGRFTIEDELKAGAMGPNSPAMKYTGTDDCRWTASGFAVICEAALHRPGKKYSET
Ga0187874_1012445423300018019PeatlandRAQSQTTPSPEVKKLAVMVGKFTIEDELKAGVMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEASSSTTIRAPRHTDTTQSTVQEEQKTRLVR
Ga0187869_1062943913300018030PeatlandMSGPQRLISFVLACASSVFVAGAQSQTTPGPEVKKLAVIVGRFTIEDELKAGAMGPNSPAMKYTGTDDCRWTASGFAVICEAALHRPGKKYSETSFVYYDPTSKT
Ga0187867_1000373333300018033PeatlandMRYLATLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEASSSTTIRAPRHTDTTQSTVQEE
Ga0187867_1069594723300018033PeatlandMSYLTTLLSFVLTCASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAIGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEASFVYYD
Ga0187863_1006489013300018034PeatlandMSVPQRFLSFVLACASIAIVACAQSQTTPGPEVKKLGVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYRPGTKYSDTSFV
Ga0187863_1007271633300018034PeatlandMSVLQKFLSFVLACASSATVARAQSQTTPSSEVKKLAVMVGKFAIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYRPGTKYSDTSFV
Ga0187883_1004241533300018037PeatlandMSYLTTLLSFVLTCASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEASSSTTIRAPRHTDTTQSTVQEE
Ga0187862_1075884213300018040PeatlandMRYLTTSLSLVLACASIVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGALGPNSPATKFSGTDDCRWTAGGFAVI
Ga0187871_1039512823300018042PeatlandMSGPQRLVSFVLACASTVIAGAQSQTTRGPEVKKLAVMVGTFTVEDEVKAGAMGPNSPAMKFNGTDDCRWRAGGFAVICEAALSRPGRKYS
Ga0187887_1004469113300018043PeatlandMSRTQRLASFVLACASSVSVAGAQSQTTRGPEVEKLAVLVGRFSIEDEVKAGAMGPNSPAMKYTGTDDCRWTPGGFAVICETTLYRPGKEYSETSFSYYDPTSKTYQYH
Ga0187890_1015431623300018044PeatlandMRYLTTLLSLVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKY
Ga0187890_1018920423300018044PeatlandMRYLTTSLSLVLACASIVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGALGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPG
Ga0187890_1033234413300018044PeatlandMSPQSLVSFVLACASSVIVAGAQSQTTRGPEVEKLGVMVGRFTVEDEVKAGAMGPKSPAMKFSGTDDCRWTAGGFAVFCEAALHRPGRKYSEASFVYYDSASKTYLYRAVDSSG
Ga0187851_1016250613300018046PeatlandMSRTQRLASFVLACASSVSVAGAQSQTTRGPEVEKLAVLVGRFSIEDEVKAGAMGPNSPAMKYTGTDDCRWTPGGFAVICETTLYRPGKEYSETSFSYYD
Ga0187859_1075770213300018047PeatlandMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYS
Ga0187858_1010043923300018057PeatlandMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEASSSTTIRAPRHTDTTQSTVQEE
Ga0187765_1107920613300018060Tropical PeatlandMSVLQQLFSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTAGGLAVICESVLYRPGRKY
Ga0187784_1076567223300018062Tropical PeatlandMSGSQRLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKDLASGPMKFKGTDDCRWTAGGFAVICDAALNRPGRKYSEA
Ga0187784_1107880623300018062Tropical PeatlandMSGPQRLFSFLLACASSVIVAPAQSQTTPGPEVKQLAVMVGKFTVEDEVKDLASGPMKFKGTDDCRWTAGGFAVICDAALYRPGRKYS
Ga0187772_1066115313300018085Tropical PeatlandMRCLTTLLSIVLACASSVIVAPAQSQTTPGPEVKKLAVMVGKFTVEDEVKDLASGPMKFKGTDDCRWTAGGFAVICDAALYRPGRKY
Ga0187772_1082641113300018085Tropical PeatlandMSCQKLLSFVLACASSALVARAQSQTTPSPEVKKLAVMVGKFTVEDEVKAGAMGPNSPAMKFSGTEDCRWTADGFAVICEAALYRPGRKYSEASFVYYDPT
Ga0187771_1029063323300018088Tropical PeatlandMRCLITLLSFVLACASSVVVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKDLALGPMKFKGTDDCRWTAGGFAVICDAALYRPGRKYSEASFYY
Ga0187771_1038142833300018088Tropical PeatlandMRRPTRLLSFVLACASSAIVARAQSQTTRGPEVKKLAVMVGKFTVEDEVKDSALGPMKFKGTDDCRWTAGGFAVICDAALYRP
Ga0187771_1095777013300018088Tropical PeatlandMSGPQKLLSFLLACTSSVIVARAQSQTMPGPEVKKLAVMVGKFTVEDEVKAGALGPNSPATKWSGTEDCRWTAAGFAVIC
Ga0187771_1142092123300018088Tropical PeatlandMSGPQRLLAFVLACASSVIVARAQSHTTPGPEVKKLAVMVGKFTVEDEVKDLVSGPMKFKGTDDCRWTAGGFAVICDAALYRPGRKYSEASFYYYDPTSKVYQRHAVDSL
Ga0182025_130240223300019786PermafrostMSGSQKLVSFVLACASSVIVAGAQSQTTRGPEVQKLAVMVGRFTVEDEVKAGAMGPNSPAMKYAGTDDCRWAADGFAVICTAVLHMGARKIYRNFLHLLRSDCQDLPISRS
Ga0210395_1008622243300020582SoilMSGPKRFLSFVLACASSVIVAGAQSQTTRGPEVEKLAVIVGRFTVEDEVKAGAMGPNSPAMKYTGTDDCRWTQGG
Ga0210388_1055845513300021181SoilMRRRLTTLLSFVLASASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWT
Ga0210385_1032481133300021402SoilVRYLTTLLYFVLACASSVIVARTQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEATLDRPGK
Ga0210389_1016915813300021404SoilMSVPQRLLSFVLACASSAIMACAQSQTMPSPEVNKLAVIVGNFTIEEKLKAGFMGPNSPAMKFSGTDDCRWTADGFSVVCETVLYRPGRKYSDTSFVYYELTSKTYRHHAIDGSGGTEDKSDLNT
Ga0210391_1010673933300021433SoilMCGPKRLLSFVLACASSVIAGDQSQTTPPKPGPDPEVEKLAVMVGRFTVEDELKAGVMGPNSPAMKYTGTEDCRWTAGGFAVICEAALYRPGTKYSEASFVYYDP
Ga0210391_1033481013300021433SoilIVACAQSQTTPSPEVKKLAVMVGRFTVEDELKAGAMGPNSPVMKFTGTDDCRWTADGFAVICETVLYRPGSKYSDTSFVYFDPTSKSYR
Ga0210391_1058668123300021433SoilLRYLTTLLSCVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICE
Ga0210391_1069746913300021433SoilMSRAQKLFSFVLACASSAIVACAQSQTTPSPDVKKLAVMVGRFTVEDELKAGAMGPNSPVMKFTGTDDCRWTAD
Ga0213878_1044773313300021444Bulk SoilMADPKKLLSLVLACALSTTVAHAQSQTTPGPEVKKLAVVVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTAEGFAVICEAALYGPGRKYSETSFYYYDLTSKAYRYHGVDSSGGVEDKTGTVS
Ga0210390_1090960313300021474SoilMSIPQRRLSFALACASSAIIACAQSQTMTSPEVNKLAVIVGNFTIEEKLKAGFMGPNSPAMKFSGTDDCRWTADGFSVVCETVLYRPGRKYSDTSFVYYELTSKTYRYHAIDGSGGTEDKSDLNT
Ga0210398_1007077423300021477SoilLRYLTTLLSCVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGF
Ga0210398_1160621613300021477SoilMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAIGPNSPAMKFSGIDDCKWTAGGFAVICEAALYRPGRKYSEASFVYYDPTSRTYRYHAVDSSGGIENKTGTVN
Ga0126371_1275918913300021560Tropical Forest SoilMSGPQRLLSFALACASSVIIVPAQSQTTPSPEVKKLAVMVGKFTVEDELKAGAMGPNSPAMKFSGTHDCRWTADSFAVICEAALSRPGRKYSEASFVYYDPT
Ga0224544_106051613300023250SoilMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTEDCRWTAGGFAVICEAALHRPGMKYSEAS
Ga0208935_102388013300025414PeatlandMSVPQRFLSFVLACASSAIVARAQSQTTPSPEVKKLAVMVGKFTIEDELKAGVMGPNSPAMKFSGTDDCRWTADGFAVICETVL
Ga0208935_102742523300025414PeatlandMSGPQKFVSFVLACASSVIVPGAQSQTTRSPEVKKLAVMVGKFTIEDELKAGAMAPDSPAMKFTGTEDCRWTAGGFGVICEAALYRPGSKKYSEASFV
Ga0209010_100029423300027370Forest SoilMSVPQRFLSFVLACASSAIVARAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGIDDCRWTADGFAVICETVLYRPGSKYSDTSFVYYDPTSKT
Ga0209116_101710513300027590Forest SoilGTSERKIQMSVPQRFLSFVLACASSAIVACAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYRPGSKYSDTSFVYYDPTSKT
Ga0209333_108671913300027676Forest SoilMSGLQRLVSFVLACGSSVIMAGAQSKTTRGPEVKKLAVMVGRFTVEDEVKSGAMGPNSPEMKFSGTDDCRWTAGGFAVIC
Ga0209908_1023866413300027745Thawing PermafrostMSRPQKLFLFVLACASSAIVACAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGNDDCRWTADGFAVICETVLYRPGRKYSDLSLIHI
Ga0209772_1001643233300027768Bog Forest SoilMSGPQRLLSFVLACASSVIVVRAQSQTTRGPEVKKLAVMIGKFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEASFVYYDPT
Ga0209773_1038109923300027829Bog Forest SoilVAPKRLLSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTSGGFAVICEAALYRPGRKYSEASFVYY
Ga0209169_1003297963300027879SoilMSVPQRFLSFVLACASSAIVACAQSQTTPSPEVKKLAVMVGRFTVEDELKAGAMGPNSPVMKFTGTDDCRWTADGFAVI
Ga0209169_1006485813300027879SoilMSGPQRLVSFVLVCASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAIGPNSPAMKFSGIDDCKWTAGGFAVICEAALYRPGRKYSEASFVYYDPT
Ga0209275_1061444923300027884SoilMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLEVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALY
Ga0209380_1018074133300027889SoilMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVQKLAVMVGRFTVEDEVKAGAMGPNSPAMKYAGTDDCRWAADGFAVLCTAVLHMGARKYTE
Ga0209380_1044765313300027889SoilMSRAQKLFSFVLACTSSAIVACAQSQTTPSPEVKKLAVMVGRFTVEDELKAGAMGPNSPVMKFTGTDDCRWTADGFAVICETVLYRPGSKYSDTSFVYFDPT
Ga0209624_1013871033300027895Forest SoilMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAIGPNSPAMKFSGIDDCKWTAGGLAVICE
Ga0209624_1042545113300027895Forest SoilMSVPQRLLSFVLACASSAIMACAQSQTTPSPEVNKLAVIVGNFTIEEKLKAGFMGPNSPAMKFSGTDDCRWTADGFSVVCETVLYRPGRKYSDTSFVYYDLTSKTYRYHAVDGSGGTEDKSDLKT
Ga0209624_1049863113300027895Forest SoilMRCLPTLLSFVLACASSVIVARAQSRTTPGPEVKKLAIMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVI
Ga0209624_1065261523300027895Forest SoilMIRIQRLVSFVLACASSIIVARAQSQTTPGPEVQRMAVMVGKFTVEDEVKAGAMGPNSPAMKFSGTEDCRWTQ
Ga0209006_1054805713300027908Forest SoilMSVPQRFLSFVLACASSAIVAAAQSQTTPGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTDDCRWTADGFAVICETVLDRPGTK
Ga0302151_1020701913300028562BogMRAPKKLVSFVLACASSLIVARAQSQTTPGPEVKKLAAIVGKFTIEDELKAGAMGPNSPAMKYSGTDDCKWTARGFAVICETELHSL
Ga0302219_1021938023300028747PalsaMSVLQKFLSFVLACASSATVARAQSQTAPSPEVKKLAVMVGRFTVEDELKAGAMGPNSPVMKFTGTDDCRWTADGFAVICETVLYR
Ga0302224_1007228313300028759PalsaMSVLQKFLSFVLACASSATVARAQSQTTPSLEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYRPGTKYSDTSFVYYDPTAKTYRYHS
Ga0302224_1045307313300028759PalsaMSIPQTFLSFVLACASSAIVARAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGANSPAMKFSGTDDCRWTADGFAVICETVLYRPGT
Ga0302234_1044342923300028773PalsaMSRPQKLFLFVLACASSAIVACAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYR
Ga0302303_1008195623300028776PalsaMRGPKRLLPFVLACASSAIAGGQSQTTPKPGPPPEVEKLAMMVGRFTVEDELKAGVMGPNSPATKYTGTEDCRWVAGGFAVICTAVLDT
Ga0302303_1013220423300028776PalsaMRYLTTLLSFVLACASSVIVARAQSQKTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGSDDCRWTAGG
Ga0302225_1015480323300028780PalsaMSRYQRLVSFVLACASSVTVAGAQSQTTPGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAG
Ga0302225_1023082823300028780PalsaMSGSQRLISFVLACASGVVAAGAQSPSTPGPEVKKLAVMVGKFTVEDELKAGAMGPNSPATKFSGTDDCRWTAGDFALICEA
Ga0302227_1034915213300028795PalsaMRGPKRLLPFVLACASSAIAGGQSQTTPKPGPPPEVEKLAMMVGRFTVEDELKAGVMGPNSPATKYTGTEDCRWVAG
Ga0302222_1005810813300028798PalsaMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGG
Ga0302222_1017153613300028798PalsaMSVLQRFLSFVLACASSAIVARAQSQTTPGPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYRPGS
Ga0302221_1041811023300028806PalsaMSRYQRLVSFVLACASSVTVAGAQSQTTPGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICDA
Ga0302228_1006658323300028808PalsaMSGPQRLVSFVLACASSVLVAGAQSQTTRGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMKFSGADDCRWTAGGFAVICEAALYRPGRKYSEASF
Ga0302278_1015332313300028866BogMRYLTTLFSFVLACASSVIVAHAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDNCRWTAGGFAVICEAALYRPGSKYSEA
Ga0302230_1015994323300028871PalsaMSDPQKLLSFVLACASIVIVAGAQSQTTRGPEVKKLAVMVGRFTIEDELKAGAMGPNSPAMKFSGTENCRWTASGFAVICEASLHRPGTNYSETSFTYYDPA
Ga0302230_1020538813300028871PalsaMRGPKRLLPFVLACASSAIAGGQSQTTPKPGPPPEVEKLAMMVGRFTVEDELKAGVMGPNSPATKYTGTEDCRWVAGG
Ga0302155_1039562713300028874BogMCGPKRLLSFVLASALSVIAGDQSQTKPPKRGPGPEVEKLAVMVGRFTVEDELKAGAMGPNSPAMKYTGTDDCRWASGG
Ga0308309_1005480613300028906SoilMGGPQRLVSFVLACVSSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDEVKAVAMRPNSPAMKFSGTDDSRWTAGGFAVIC
Ga0308309_1044493813300028906SoilMCRHAKLLAFVLACASSPIAARAQSQPTRGPEVKKMAVMVGKFTVEDELKAGAMGPTSPAMKFSGTDDCRWTAGGFAVICEAALYRPGR
Ga0311368_1018493613300029882PalsaMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTIEDEVKAGAMGPNSPATKFSGTDNCRWTAGGFAVICEAALYRPGRKY
Ga0311329_1057223423300029907BogMRGPKRLLSFVLACALSVMAGDQSQTKPPKRGPGPEVEKLAVMVGRFTVEDELKAGAMGPNSPAMKYAGTDDCRWASGGFSVICTTVLHMGAKKYSETSFIYYDPT
Ga0311369_1118738913300029910PalsaMSVLQKFLSFVLACASSATVARAQSQTTPSLEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYRPGTKYSDTSFVYYDPTSKTYRYHAVD
Ga0311362_1069086123300029913BogMSGPQRLISFVLACASSVFVAGAQSQTTPGPEVKKLAVIVGRFTIEDELKAGAMGPNSPAMKYTGTDDCRWTASGFAVICEAALHRPGKKYSETSFVY
Ga0311328_1049543813300029939BogMRYIPTLLSFVLAGPSSVIVARAQSQTAPGPEVKKLAVMVGKFTVEDEVKAGAMGTNSPATKFSGTDDCGWTAGGFAVICEAVFYRPGGNYS
Ga0311340_1035116723300029943PalsaMSVLQKFLSFVLACASSATVARAQSQTTPSLEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYRPGTKYSDTSFVYYDPT
Ga0311340_1093198513300029943PalsaMSGSQRWVSFVLACASSVIVAGAQSQTTRGPEVQKLAVMVGRFTVEDEVKAGAMGPNSPAMKYAGTDDCRWAADGFAVVCTAVLHMGARK
Ga0311340_1125385813300029943PalsaMRGPKRLLPFVLACASSAIAGGQSQTTPKPGPPPEVEKLAMMVGRFTVEDELKAGVMGPNSPATKYTGTEDCRWVAGGFAVICTAVLDTG
Ga0311352_1034708313300029944PalsaMSGPQRLIPFVLACAWSVIIAGAQSQTTPPNPSPSPEVKRLAVMVGRFTVEDEVKAGAMGPNSPAMKFGGTDDCRWTAGGFAVICEAALYRPGRKYSEASF
Ga0311371_1119606823300029951PalsaMGTPQTFLLFVLACASSVIVAYAQSQPTPGQEVKKLAVLVGKFTVEDEVKAGAMGADSPAMKFTGTEDCRWTAGGFAVICEAALHRPGRKYLET
Ga0311371_1235407313300029951PalsaMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKRLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGF
Ga0302277_129159313300029982BogMRAPKKLVSFVLACASSLIVARAQSQTTPGPEVKKLAAIVGKFTIEDELKAGAMGPNSPAMKYSGTDDCKWTARGFAVICETELHSLGSKSPATKYSETSFTYYDPTSKAYQYHAVDSSGGVENKT
Ga0311339_1065467013300029999PalsaMSVPQRFLSLVLACASSAIVACAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVI
Ga0311339_1167317413300029999PalsaMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEAS
Ga0311338_1018198743300030007PalsaMSGTQRLVSFVLACASSVIVAGAQSQATRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGKKY
Ga0311338_1020100413300030007PalsaMRYLTTLLSFVLACAASVIVARAQSQTAPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYG
Ga0311338_1071837533300030007PalsaMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTDDCRWT
Ga0311338_1112968623300030007PalsaMSGPQRLISFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAGGF
Ga0311338_1171060923300030007PalsaMCGPKRLLSFVLACASSVIASAQSQTTPPKPGPGPEVEKLALMVGKFTVEDELKAGAMGPNSPAMKYTGTDDCRWAAGGFAVICTAVLHMGARKYTETSFIYYDP
Ga0302300_116698613300030042PalsaMSVLQKFLSFVLACASSATVARAQSQTTPSLEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYR
Ga0302306_1002405813300030043PalsaMSGPQRLVSFVLACASSVIVAGAQSQTTRSPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMQYTGTDDCRWTASGYAVICETTLHRPGKKYS
Ga0302195_1026382823300030051BogMCGPKRLLSFVLASALSVIAGDQSQTKPPKRGPGPEVEKLAVMVGRFTVEDELKAGAMGPNSPAMKYTGTDDCRWASGGFAVICTTVLHMGAKKYTDTSF
Ga0302177_1052595313300030053PalsaMSGSQRWVSFVLACASSVIVAGAQSQTTRGPEVQKLAVMVGRFTVEDEVKAGAMGPNSPAMKYAGTDDCRWAADGF
Ga0302181_1040075723300030056PalsaMRGPKRLLPFVLACASSAIAGGQSQTTSKPGPPPEVEKLAMMVGRFTVEDELKAGVMGPNSPATKYTGTEDCRWVAGGFAVICTAVLD
Ga0302176_1013529913300030057PalsaMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWT
Ga0302176_1017794513300030057PalsaMSIPQTFLSFVLACASSAIVARAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGANSPAMKFSGTDDCRWTADGFAVICETVLYRPGTKYSDTSFVYYDSTSKTYRYHAVDSSGGTED
Ga0302176_1031664313300030057PalsaMSVLQRFLSFVLACASSAIVARAQSQTTPGPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTA
Ga0302179_1005187523300030058PalsaMRYLTTLLSFVLACAASVIVARAQSQTAPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGG
Ga0302179_1041286813300030058PalsaMSGPQRLIPFVLACAWSVIIAGAQSQTTPPNPSPSPEVKRLAVMVGRFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAGGF
Ga0302179_1055134413300030058PalsaMSIPQTFLSFVLACASSAIVARAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGANSPAMKFSGTDDCRWTADGFAVICETVLYRPGTKYSDTSFVYYDSTSKTYRYHA
Ga0311353_1020111523300030399PalsaMSRYQRLVSFVLACASSVTVAGAQSQTTPGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAGGFAAICEAALDRPGRKYSEASFVY
Ga0302184_1025418813300030490PalsaMRYLTTLLSSVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPHSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEASFVY
Ga0311370_1023540113300030503PalsaMSVLQKFLSFVLACASSATVARAQSQTTPSLEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETV
Ga0311370_1097765613300030503PalsaMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEASFVYYDPTSKT
Ga0302183_1002201413300030509PalsaMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGRKY
Ga0311372_1246430413300030520PalsaMNGPQRLVSFVLACASSAIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTEDCRWAAGGFAVICE
Ga0311372_1301825513300030520PalsaMSGPQRLFSFLLACASSVIVARAQSQTTPSPEVRKLAVMVGRFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVTCEAAL
Ga0311355_1049066333300030580PalsaMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTEDCRWTAGGFA
Ga0311355_1050015813300030580PalsaMRYLTTLLSFVLACASSVIVARAQSQKTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGF
Ga0311356_1021925713300030617PalsaMSRYQRLVSFVLACASSVTVAGAQSQTTPGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAGGFAAICEAALDRPGRK
Ga0311356_1025859713300030617PalsaMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGRK
Ga0311354_1044303933300030618PalsaMNGPQRLVSFVLACASSAIVAGAQSQTTRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTEDCRWAAGGFAVICEATLY
Ga0311354_1067157013300030618PalsaMSGPQRLVSFVLACASSVIMAGAQSQTAPGPEVKKLGVMVGKFTVQDELKAGAMGPNSPAMRFSGTDDCRWTASGFAVICEAALQRPGSKYSEASFIYYDP
Ga0311354_1074568413300030618PalsaMCGPKRLLSFMLACASSVIAGGQSQTTSPKPGPGPEVEKLAVMVGRFTVEDELKAGVMGPTSPAMKYTGTDDCRWAAGGFAVICTAVLHMGAR
Ga0311354_1113300023300030618PalsaMSCPQRLVSFVLACASSAIVAGAQSQTTRGPEVKRLAVMVGSFTVEDEVKAGAMAPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPG
Ga0311354_1167362213300030618PalsaMSSPQRLVSFVLACASSITVAGAQSQTTRGPEVKKLAVMVGRFTVEDEVKAGTMGPNSPAMKFSGADDCRWTAGGFAVICEAALYRPGKKYSEASFVYYDP
Ga0302310_1057049013300030737PalsaMSGSQRLISFVLACASGVVAAGAQSPSTPGPEVKKLAVMVGKFTVEDELKAGAMGPNSPATKFSGTDNCRWTAGGFAVICEAALNRPGRKYSET
Ga0302311_1011612533300030739PalsaMSGPQRLVSFVLACASSVLVAGAQSQTTRGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPALKFSGTDNCRWTAGGFAVICEAALYR
Ga0302311_1026583613300030739PalsaMCGPKRLLLFVLACASSVIARDQSQTTPPKPGPGPEVEKLAVMVGRFTVEDELKAGAMGPNSPAMKYTGTDDCRWASGGFAVICTTVLHMGAKKY
Ga0265770_102679913300030878SoilMSGLQRLVSFVLACASSLIVAGAQSQTTPGAEVKKLAVIVGRFTVEDEVKAGAMGPNSPAMKYTGTDDCRWTANGFAVICEA
Ga0302314_1058512623300030906PalsaMSGPQRLVSLVLACASSVMVAGAQSPTTPGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMKFTGTDDCRWTAGGF
Ga0302308_1042749113300031027PalsaMRYLTTLLSFVLACASSVIVARAQSQKTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEVALY
Ga0302325_1001007713300031234PalsaMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKRLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTA
Ga0302325_1005961513300031234PalsaMSVPQRFLSLVLACASSAIVACAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTAD
Ga0302325_1007025813300031234PalsaMRYLTTLFSFVLACASSVIVVHAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPHSPATKFSGTDDCRWTAGGFAVICEAALYRPGS
Ga0302325_1013371573300031234PalsaMRYLTTLLSLVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPKSPATKFSGTDDCRWT
Ga0302325_1015616053300031234PalsaMSGPPRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGRK
Ga0302325_1093080923300031234PalsaMRYLTTLLSFVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTIEDQVKAGAMGPNSPATNFSGTDDCRWTAGGFAVICEAELHRPGRKYSEVSFVY
Ga0302325_1108759913300031234PalsaMHGILKKSPMRYLTTLLSFVPACASSVIVARAQSQTTPGPEVKKLAVMVGKFAVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEATL
Ga0302325_1157456423300031234PalsaMSGPQRLISFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAA
Ga0302325_1210295213300031234PalsaMRFLTTLLSFALACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYSE
Ga0302325_1228618313300031234PalsaMRYLRTLLSFALACASSVIAARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPAAKFSGTDDCRWTAGGFAVIC
Ga0302324_10010853773300031236PalsaMSGTQRLVSFVLACAASVIVAGAQSQTTAGPEVKKLAVMVGRFTVEDELKAGAMGPNSPALKFSGTDDCRWTAGG
Ga0302324_10038388013300031236PalsaMSGPQRLVSFVLACTSSVIVAGSQSQTTRGPEVKKLAVMVGRFTVEDEVKAGTMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGRKYSEASFV
Ga0302324_10039538013300031236PalsaMHGILKKSPMRYLTTLLSFVPACASSVIVARAQSQTTPGPEVKKLAVMVGKFAVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEATLYRPGR
Ga0302324_10088051313300031236PalsaMSVPQRFLSFVLACASSAIVARAQSQTTPSPEVKKLAVMVGKFTVEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVL
Ga0302324_10216329713300031236PalsaMRYLTTLLSFVLACAASVIVARAQSQTAPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGGFAVICEAALYGPGRKYSEASFVYYD
Ga0302324_10316588413300031236PalsaMRVTNRLLSLVLVCASSLIAGDQSETIPPKPGPGPEVQKLAVIVGRFTVEDELKAGVMGPNSPAMKYTGTDDCKWASAGFSVICTAVLHMGARKYTETSFIYYD
Ga0302326_1022258653300031525PalsaMRYLTTLLSLVLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPKSPATKFSGTDDCRWTAGGFAVICEAALYRPGRKYS
Ga0302326_1151584333300031525PalsaMSGPQRLFSFLLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPAMKFSGTDDCRWTAGGFAVT
Ga0302326_1157345613300031525PalsaMSVPQRFLSFLLACASSAIVACAQSQTTPSPEVKKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICETVLYRPG
Ga0302326_1291942023300031525PalsaMSGTQRLVSFVLACASSVIVAGAQSQATRGPEVKKLAVMVGRFTVEDELKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAALYRPGKKYSEASFV
Ga0302326_1332348613300031525PalsaMSGPQRLVSFVLACASSVIVAGAQSQTTRGPEVKKLAVMVGRFTVEDEVQAGTMGPNSPAMKFSGTDDCRWTAGGFA
Ga0310686_10578960023300031708SoilMRYLTTLLSFVLACTSSVIVARAQPQTTPGPEVKKLAVMVGKFTVEDEVKAGAMGPNSPATKFSGTDDCRWTAGG
Ga0310686_10831179843300031708SoilMTGSRRLLSFVLACASSVIVTRAQSQTTPSPEVKKLAVMVGKFTVEDEMKAGAMGPNSPAMKFSGTEDCRWTADGYAVICEAALYRPG
Ga0310686_10846019613300031708SoilMSVPQRFLSFVLACGSSAIVACAQSQTTPSPEVRKLAVMVGKFTIEDELKAGFMGPNSPAMKFSGTDDCRWTADGFAVICET
Ga0302315_1020591723300031837PalsaMSGPQKLVLFVLACASSVIVTGAQSQTARGPEVKKLAVMVGKFTVEDELKAGAMGPNSPALKFSGTDDCRWTAGGFAVICQTALYRP
Ga0306923_1189583723300031910SoilMVGRVRLLSFALACASSVIAARARSQTMRGPEVKTLAVMVGKFTVEDEVKAGAMGSNSPAMKFSGTEDCRWTAEGF
Ga0335072_1092964423300032898SoilMSVPQRFLSFVLACASSVIVARAQSQTTPSSEVKKLAVMVGKFTVEDELRAGFMGPNSPALKFSGTDDCRWTADGFAVICETVLYRPGRKYSDTSFVYYDPT
Ga0370483_0184449_3_2513300034124Untreated Peat SoilMSGPQKLFSFLLACASSVIVARAQSQTTPGPEVKKLAVMVGKFTVEDELKAGAMGPNSPAMKFSGTDDCRWTAGGFAVICEAA
Ga0370515_0098875_2_3313300034163Untreated Peat SoilMSVPQRLFSFVLACASSVIVARAQSQTTPSPDVKKLAVMVGKFTIEDELKAGFMGPNSPATKFSGTDDCRWTADGFAVICETVLYRPGRKYSDASFVYYDPTAKTYRYHA
Ga0370515_0346168_275_6283300034163Untreated Peat SoilMCGSKRLLSFVLACASSVIAGGQSQTTPPKRGPDPEVEKLAVMVGRFTVEDELKAGVMGSNSPAMKYTGTDDCRWAAGGFAVICTAVLHMGARKYTETSFIYYDPIAKTYQYHAVDSS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.