Basic Information | |
---|---|
Family ID | F029200 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 189 |
Average Sequence Length | 45 residues |
Representative Sequence | AVGPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK |
Number of Associated Samples | 169 |
Number of Associated Scaffolds | 189 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.53 % |
% of genes near scaffold ends (potentially truncated) | 97.88 % |
% of genes from short scaffolds (< 2000 bps) | 94.18 % |
Associated GOLD sequencing projects | 158 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.16 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.238 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.053 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.101 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.683 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 0.00% Coil/Unstructured: 95.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 189 Family Scaffolds |
---|---|---|
PF00557 | Peptidase_M24 | 77.78 |
PF01321 | Creatinase_N | 8.99 |
PF01266 | DAO | 1.59 |
PF00496 | SBP_bac_5 | 1.06 |
PF00265 | TK | 1.06 |
PF12787 | EcsC | 0.53 |
PF02656 | DUF202 | 0.53 |
PF00296 | Bac_luciferase | 0.53 |
PF13474 | SnoaL_3 | 0.53 |
PF00211 | Guanylate_cyc | 0.53 |
PF06240 | COXG | 0.53 |
PF01323 | DSBA | 0.53 |
PF13407 | Peripla_BP_4 | 0.53 |
PF01872 | RibD_C | 0.53 |
COG ID | Name | Functional Category | % Frequency in 189 Family Scaffolds |
---|---|---|---|
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 8.99 |
COG1435 | Thymidine kinase | Nucleotide transport and metabolism [F] | 1.06 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.53 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.53 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.53 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.53 |
COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.53 |
COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.24 % |
Unclassified | root | N/A | 4.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q01DKZRP | Not Available | 525 | Open in IMG/M |
2170459014|G1P06HT01BTPX1 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_10732393 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300000956|JGI10216J12902_100575024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300001978|JGI24747J21853_1012492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
3300001979|JGI24740J21852_10143793 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300002239|JGI24034J26672_10044006 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300002239|JGI24034J26672_10070399 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300002547|JGI24973J35851_1036444 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300002568|C688J35102_118592668 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300003987|Ga0055471_10019871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1597 | Open in IMG/M |
3300003987|Ga0055471_10119622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → Leifsonia rubra | 785 | Open in IMG/M |
3300004156|Ga0062589_102813445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
3300005146|Ga0066817_1016252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
3300005162|Ga0066814_10100680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
3300005164|Ga0066815_10001884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1860 | Open in IMG/M |
3300005169|Ga0066810_10079662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300005177|Ga0066690_10846947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
3300005329|Ga0070683_101624394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
3300005329|Ga0070683_102086554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
3300005331|Ga0070670_101071917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
3300005333|Ga0070677_10034867 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
3300005364|Ga0070673_101884932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300005366|Ga0070659_100600320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
3300005436|Ga0070713_101128657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 758 | Open in IMG/M |
3300005439|Ga0070711_101901158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300005554|Ga0066661_10929035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
3300005556|Ga0066707_10887754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
3300005557|Ga0066704_10660375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
3300005560|Ga0066670_10602239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
3300005560|Ga0066670_10962471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
3300005566|Ga0066693_10477673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
3300005569|Ga0066705_10321341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
3300005764|Ga0066903_107529103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300005921|Ga0070766_10508768 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300006032|Ga0066696_11025213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300006034|Ga0066656_10821664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
3300006046|Ga0066652_100333132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1360 | Open in IMG/M |
3300006046|Ga0066652_101762045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300006173|Ga0070716_101764435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
3300006178|Ga0075367_10470185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
3300006178|Ga0075367_10622427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 686 | Open in IMG/M |
3300006755|Ga0079222_10318905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1028 | Open in IMG/M |
3300006800|Ga0066660_11320946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
3300006953|Ga0074063_10037434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1113 | Open in IMG/M |
3300006954|Ga0079219_10445575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 881 | Open in IMG/M |
3300009012|Ga0066710_102142869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 819 | Open in IMG/M |
3300009012|Ga0066710_104293185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
3300009038|Ga0099829_11450382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 567 | Open in IMG/M |
3300009093|Ga0105240_12103892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
3300009137|Ga0066709_101965637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 811 | Open in IMG/M |
3300009147|Ga0114129_11254804 | Not Available | 920 | Open in IMG/M |
3300009148|Ga0105243_11313650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 741 | Open in IMG/M |
3300009162|Ga0075423_12219508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
3300009176|Ga0105242_12245268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
3300009177|Ga0105248_10181990 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
3300009553|Ga0105249_11131860 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300009649|Ga0105855_1149188 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300009698|Ga0116216_10603514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 661 | Open in IMG/M |
3300010039|Ga0126309_10538726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 725 | Open in IMG/M |
3300010042|Ga0126314_11363534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
3300010046|Ga0126384_11389249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
3300010130|Ga0127493_1147250 | Not Available | 750 | Open in IMG/M |
3300010335|Ga0134063_10579332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
3300010335|Ga0134063_10617433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
3300010360|Ga0126372_12661419 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300010379|Ga0136449_101031184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1319 | Open in IMG/M |
3300010396|Ga0134126_11256180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 821 | Open in IMG/M |
3300010396|Ga0134126_12589543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
3300010999|Ga0138505_100047602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
3300011119|Ga0105246_11230049 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300011119|Ga0105246_11772024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
3300012207|Ga0137381_11661063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
3300012212|Ga0150985_122703150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → Leifsonia rubra | 1667 | Open in IMG/M |
3300012350|Ga0137372_11181642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
3300012363|Ga0137390_11477785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
3300012500|Ga0157314_1024602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 638 | Open in IMG/M |
3300012943|Ga0164241_10348356 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300012955|Ga0164298_10016783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3024 | Open in IMG/M |
3300012958|Ga0164299_10660112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 725 | Open in IMG/M |
3300012958|Ga0164299_11305563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
3300012960|Ga0164301_10843108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 705 | Open in IMG/M |
3300012960|Ga0164301_11302106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
3300012960|Ga0164301_11429968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 566 | Open in IMG/M |
3300012961|Ga0164302_10624663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 785 | Open in IMG/M |
3300012977|Ga0134087_10207434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 880 | Open in IMG/M |
3300012985|Ga0164308_12185218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
3300013296|Ga0157374_11655980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
3300013297|Ga0157378_10256591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1676 | Open in IMG/M |
3300013306|Ga0163162_13220733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
3300014325|Ga0163163_11864581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 661 | Open in IMG/M |
3300014326|Ga0157380_10781906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 969 | Open in IMG/M |
3300014497|Ga0182008_10771354 | Not Available | 556 | Open in IMG/M |
3300014501|Ga0182024_10566457 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
3300015208|Ga0167664_1034618 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
3300015356|Ga0134073_10166549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 708 | Open in IMG/M |
3300015371|Ga0132258_13138636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1141 | Open in IMG/M |
3300015372|Ga0132256_101314104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 836 | Open in IMG/M |
3300015372|Ga0132256_103432127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
3300015373|Ga0132257_100018226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7327 | Open in IMG/M |
3300015373|Ga0132257_100450012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1573 | Open in IMG/M |
3300015373|Ga0132257_102298408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 699 | Open in IMG/M |
3300015374|Ga0132255_103036705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
3300016404|Ga0182037_11991695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
3300016422|Ga0182039_10355437 | Not Available | 1231 | Open in IMG/M |
3300016445|Ga0182038_11498217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 606 | Open in IMG/M |
3300017924|Ga0187820_1254994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
3300017947|Ga0187785_10490542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 610 | Open in IMG/M |
3300017966|Ga0187776_10040378 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
3300017997|Ga0184610_1174005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 713 | Open in IMG/M |
3300018027|Ga0184605_10284455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 750 | Open in IMG/M |
3300018077|Ga0184633_10006692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5357 | Open in IMG/M |
3300019885|Ga0193747_1107024 | Not Available | 673 | Open in IMG/M |
3300019890|Ga0193728_1298637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
3300020069|Ga0197907_10449622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300020070|Ga0206356_10306186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1132 | Open in IMG/M |
3300021080|Ga0210382_10134786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1051 | Open in IMG/M |
3300022534|Ga0224452_1232352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
3300022756|Ga0222622_10714103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 729 | Open in IMG/M |
3300025893|Ga0207682_10087565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1345 | Open in IMG/M |
3300025904|Ga0207647_10053953 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
3300025913|Ga0207695_11250888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
3300025915|Ga0207693_11314123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
3300025926|Ga0207659_10410532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1134 | Open in IMG/M |
3300025927|Ga0207687_11948563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
3300025930|Ga0207701_11230139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
3300025931|Ga0207644_10445011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1064 | Open in IMG/M |
3300025932|Ga0207690_11313906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
3300025935|Ga0207709_11201063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
3300025936|Ga0207670_10507870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 980 | Open in IMG/M |
3300025938|Ga0207704_10737998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 818 | Open in IMG/M |
3300025941|Ga0207711_11317760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
3300025944|Ga0207661_10176861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 1861 | Open in IMG/M |
3300025944|Ga0207661_11747399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 567 | Open in IMG/M |
3300025945|Ga0207679_10123201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2067 | Open in IMG/M |
3300025949|Ga0207667_10895992 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300025960|Ga0207651_11532078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
3300025981|Ga0207640_11067034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 713 | Open in IMG/M |
3300025986|Ga0207658_11587126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 598 | Open in IMG/M |
3300026023|Ga0207677_11390284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 646 | Open in IMG/M |
3300026089|Ga0207648_11455354 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 644 | Open in IMG/M |
3300026142|Ga0207698_12123711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
3300026334|Ga0209377_1308560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
3300026550|Ga0209474_10718998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 519 | Open in IMG/M |
3300026746|Ga0207454_102622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
3300026757|Ga0207605_101158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 675 | Open in IMG/M |
3300027561|Ga0209887_1011237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2325 | Open in IMG/M |
3300027768|Ga0209772_10285076 | Not Available | 524 | Open in IMG/M |
3300028597|Ga0247820_11285162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
3300028771|Ga0307320_10418413 | Not Available | 539 | Open in IMG/M |
3300028793|Ga0307299_10250823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
3300028800|Ga0265338_10711470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 693 | Open in IMG/M |
3300028803|Ga0307281_10008493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2835 | Open in IMG/M |
3300028811|Ga0307292_10351619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
3300028878|Ga0307278_10111974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1227 | Open in IMG/M |
3300030336|Ga0247826_10065104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2114 | Open in IMG/M |
3300030336|Ga0247826_10107149 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
3300030596|Ga0210278_1119001 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300030738|Ga0265462_12410633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
3300031152|Ga0307501_10105624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 718 | Open in IMG/M |
3300031226|Ga0307497_10097199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1140 | Open in IMG/M |
3300031226|Ga0307497_10696621 | Not Available | 524 | Open in IMG/M |
3300031234|Ga0302325_12492426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
3300031543|Ga0318516_10718005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300031640|Ga0318555_10442960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 704 | Open in IMG/M |
3300031670|Ga0307374_10379419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 831 | Open in IMG/M |
3300031670|Ga0307374_10652334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
3300031679|Ga0318561_10810428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani | 514 | Open in IMG/M |
3300031680|Ga0318574_10063928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1970 | Open in IMG/M |
3300031711|Ga0265314_10704797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300031712|Ga0265342_10181153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
3300031719|Ga0306917_11034019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 641 | Open in IMG/M |
3300031720|Ga0307469_11677946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 612 | Open in IMG/M |
3300031731|Ga0307405_11160701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
3300031771|Ga0318546_11305273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
3300031798|Ga0318523_10307592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 791 | Open in IMG/M |
3300031799|Ga0318565_10463565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
3300031821|Ga0318567_10684976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani | 582 | Open in IMG/M |
3300031834|Ga0315290_10290186 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
3300031942|Ga0310916_11529097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300031947|Ga0310909_11242689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
3300032001|Ga0306922_12154702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
3300032003|Ga0310897_10013272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2498 | Open in IMG/M |
3300032044|Ga0318558_10634629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 534 | Open in IMG/M |
3300032067|Ga0318524_10609362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300032160|Ga0311301_12041340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 667 | Open in IMG/M |
3300032180|Ga0307471_100567317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1291 | Open in IMG/M |
3300032782|Ga0335082_11051760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 679 | Open in IMG/M |
3300032828|Ga0335080_10649649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1104 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.65% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.12% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.12% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.59% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.59% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.59% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.06% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.06% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.06% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.06% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.06% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.06% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.06% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.06% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.06% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.06% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.06% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.06% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.06% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.06% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.53% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.53% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.53% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.53% |
Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 0.53% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.53% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.53% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.53% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.53% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.53% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.53% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.53% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.53% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.53% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.53% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.53% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
3300002547 | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005146 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015208 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026746 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes) | Environmental | Open in IMG/M |
3300026757 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K5-12 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_05019380 | 2170459005 | Grass Soil | TDSKAREKLFQQFQRQLNHDGAVLPADAADAGVVATSDLKNAVYNAVYSVDVTKVAPK |
2PV_01130970 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | QTVFRAIQRRLNAVGPFFPLIQPTQVFVATKDLRNAVFNAQYQVDVTRVSPK |
ICChiseqgaiiFebDRAFT_107323932 | 3300000363 | Soil | QTGPFIPLIQPTQVFVSTKDLRNAVFNPQYQIDVTRVAAR* |
JGI10216J12902_1005750242 | 3300000956 | Soil | MRGPYFPLFQPAQVFVATSDLRNAAFNAVYLVDVAQVSPKS* |
JGI24747J21853_10124922 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | ARAAIYRSIQRLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA* |
JGI24740J21852_101437932 | 3300001979 | Corn Rhizosphere | NAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR* |
JGI24034J26672_100440062 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | AARAAIYRSIQRLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA* |
JGI24034J26672_100703991 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | TIYRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR* |
JGI24973J35851_10364442 | 3300002547 | Polar Desert | NQTGPYFPLIQPTQVFASTKDLRGAVFNPLYSIDVRLARPAG* |
C688J35102_1185926682 | 3300002568 | Soil | ASGPYFPLMQPTQVFVATSDLKNAVYNAVYSIDVTKVAPK* |
Ga0055471_100198711 | 3300003987 | Natural And Restored Wetlands | RLNQVGPYFPLIQPTQVFVTTKDLSGAAFNAVYFVDITKVKPR* |
Ga0055471_101196222 | 3300003987 | Natural And Restored Wetlands | RLNQVGPYFPLIQPTQVFVNTKDLSGAAFNAVYFVDITKVKPR* |
Ga0062589_1028134451 | 3300004156 | Soil | QIQLQLNQRGPYFPLFQPAQVFVATSDLENAAFNAVYGVDITQISPKS* |
Ga0066817_10162522 | 3300005146 | Soil | VTSRASVRQTIYRQIQRRLNVVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR |
Ga0066814_101006802 | 3300005162 | Soil | VGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR* |
Ga0066815_100018843 | 3300005164 | Soil | YRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR* |
Ga0066810_100796621 | 3300005169 | Soil | QRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR* |
Ga0066690_108469472 | 3300005177 | Soil | RGPFIPLMQPTQVFVATSDLKNAVYNSVYSVDVTHVSPK* |
Ga0070683_1016243942 | 3300005329 | Corn Rhizosphere | RTALFQQFQRQLNTSGPYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK* |
Ga0070683_1020865541 | 3300005329 | Corn Rhizosphere | QLNASGPYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK* |
Ga0070670_1010719171 | 3300005331 | Switchgrass Rhizosphere | QLNQRGPYFPLIQPTQVFVSTTDLNNAVFNATYAVDVTRVTPK* |
Ga0070677_100348673 | 3300005333 | Miscanthus Rhizosphere | YRSIQRLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA* |
Ga0070673_1018849322 | 3300005364 | Switchgrass Rhizosphere | RQLNASGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK* |
Ga0070659_1006003201 | 3300005366 | Corn Rhizosphere | ARGPYFPLMQPTQVFVATSDLNNAVYNATYSIDVTKVSPK* |
Ga0070713_1011286571 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VRQTIYRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR* |
Ga0070711_1019011581 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LNQRGPFFPLMQPTQVFVNTTDLKNAVFNAEYEIDVTQVGAK* |
Ga0066661_109290352 | 3300005554 | Soil | PFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPR* |
Ga0066707_108877541 | 3300005556 | Soil | ARQTVYRQIQRRLNAVSPFFPLLQPTQVFVSTRDLKNAVFNAQYQVDVTQVAPR* |
Ga0066704_106603752 | 3300005557 | Soil | QLNQRGPFFPLLQPTQVFAATTDLKNAVFHAEYQIDVTQVSSR* |
Ga0066670_106022392 | 3300005560 | Soil | GPYFPLMQPTQVFVSTSDLRNAVYNAEYSIDVTQVSPK* |
Ga0066670_109624711 | 3300005560 | Soil | YQQLQQQLNQRGPYFPLIQPTQVFVATADLKNAVYNATYSIDVTQVSSR* |
Ga0066693_104776732 | 3300005566 | Soil | PLLQPTQVFVATTDLKNAVFNAEYEIDVTQAAAT* |
Ga0066705_103213411 | 3300005569 | Soil | QTVFRAIQRRLNAVGPFFPLIQPTQVFVATKDLRNAVFNAQYQVDVTRVSPK* |
Ga0066903_1075291031 | 3300005764 | Tropical Forest Soil | QRELNARGPYFPLMQPTQVFVATTDLNHAVFNATYAIDVTNVTPK* |
Ga0070766_105087681 | 3300005921 | Soil | EIYRAYQRMLNQSGPYFPLIQPTQVFVSTKDLKGAVYNAEYDTNITQISPA* |
Ga0066696_110252131 | 3300006032 | Soil | APAAREKIYRQIQQQLNQRGPFFPLLQPTQVFVATTDLKNAVFNAEYEIDVTQVSAK* |
Ga0066656_108216641 | 3300006034 | Soil | RQIQLQLNQRGPFFPLIQPTQVFVATNDLRNAVFNAEYEIDVTQVSPK* |
Ga0066652_1003331321 | 3300006046 | Soil | QLNQRGPYFPLIQPTQVFVSTTDLRNAVFNATYAVDVTQVSPK* |
Ga0066652_1017620451 | 3300006046 | Soil | GPYFPLIQPTQVFVATTDLKNAVYNATYSVDVTQVAPK* |
Ga0070716_1017644351 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DLNASGPYFPLMQPTQVFVSTSDLKNAVFNAEYDVDVTQVSPK* |
Ga0075367_104701852 | 3300006178 | Populus Endosphere | VGPFIPLLQPVQVFVSTRDLKGAVFNAQYQVDVTQVAPR* |
Ga0075367_106224272 | 3300006178 | Populus Endosphere | GPYFPLIQPTQVFVNTKDLSGAAFNAVYFVDITKVKPR* |
Ga0079222_103189051 | 3300006755 | Agricultural Soil | QQIQRELNQRGPYFPLIQPTQVFVSTVDLKGAVYNANFLVDLLQVSAK* |
Ga0066660_113209461 | 3300006800 | Soil | QIQQQLNQRGPYFPLIQPTQVFVASTDLKNAVYNATYSIDVTKVSPR* |
Ga0074063_100374342 | 3300006953 | Soil | FFPLLQPTQVFVSTKDLATAKFNAVYSIDVTQTKPKG* |
Ga0079219_104455752 | 3300006954 | Agricultural Soil | PLIQPTQVFVSTKDLKNAVYNSVYDVDVTQVRPA* |
Ga0066710_1021428691 | 3300009012 | Grasslands Soil | QRGPFFPLLQPTQVFVATTDLKNAVFNAEYEIDVTQVSAK |
Ga0066710_1042931851 | 3300009012 | Grasslands Soil | RQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK |
Ga0099829_114503822 | 3300009038 | Vadose Zone Soil | QLQLNQRGPFIPLLQPTQVFVATSDLKNAVYNSVYSIDVTNVSPK* |
Ga0105240_121038922 | 3300009093 | Corn Rhizosphere | PYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK* |
Ga0066709_1019656372 | 3300009137 | Grasslands Soil | YRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK* |
Ga0114129_112548042 | 3300009147 | Populus Rhizosphere | PYFPLIQPTQVFASTVDMTGAVFNPLYSIDVRAPKPK* |
Ga0105243_113136501 | 3300009148 | Miscanthus Rhizosphere | QRLLNQSGPYFPLIQPTQVFVSTKDLRNAVYNAVYLVDVTQVSPK* |
Ga0075423_122195082 | 3300009162 | Populus Rhizosphere | DAKKRTALFQQFQRQLNTSGPYFPLMQPTQVFVATSDLKNAVYNAVYSVDVTKVAPK* |
Ga0105242_122452681 | 3300009176 | Miscanthus Rhizosphere | NAVGPFVPLLQPVQVFVSTKDLKGAVFNAQYQVDVTQVAPR* |
Ga0105248_101819901 | 3300009177 | Switchgrass Rhizosphere | QLNASGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK* |
Ga0105249_111318603 | 3300009553 | Switchgrass Rhizosphere | GPYFPLFQPAQVFVATSDLENAAFNAVYGVDITQISPKS* |
Ga0105855_11491881 | 3300009649 | Permafrost Soil | AVYQKIQTLLNQSGPYFPLIQPTQVFVSTKDLSGAVYNAEYDVDVSQITPG* |
Ga0116216_106035142 | 3300009698 | Peatlands Soil | FPLMQPTQVFVATSDLKNAVYNAEYDVDVTQVSPK* |
Ga0126309_105387261 | 3300010039 | Serpentine Soil | QHRLNSVGPFVPLLQPVQVFVSTKDLKGAVFNAQYQVDVTQVAPR* |
Ga0126314_113635342 | 3300010042 | Serpentine Soil | PLIQPTQVFVSTRDLKGAVFNSQYQIDVTHVSPR* |
Ga0126384_113892491 | 3300010046 | Tropical Forest Soil | YPLMQPTQVFVSTNDLRNAVFNAQYQIDVTRVSPK* |
Ga0127493_11472502 | 3300010130 | Grasslands Soil | MPLLQPTQVFVATSDLTNAVYNSVYSLDVTKVSPK* |
Ga0134063_105793321 | 3300010335 | Grasslands Soil | TALFEQFQRQLNTSGPYFPLMQPTQVFVATSDLKNAVYNAVYSVDVTKLAPK* |
Ga0134063_106174331 | 3300010335 | Grasslands Soil | LNARGPFVPLLQPTQVFVSTTDLKNAVFNAEYQIDVTQASPK* |
Ga0126372_126614192 | 3300010360 | Tropical Forest Soil | VYRSIQRLLNQSGPFFPLIQPTQVFVSTKDLKGAVYNSVYTVDTLQVSPA* |
Ga0136449_1010311842 | 3300010379 | Peatlands Soil | IQLDLNASGPYFPLMQPTQVFVATSDLKNAVYNAEYDVDVTQVSPK* |
Ga0134126_112561801 | 3300010396 | Terrestrial Soil | QSGPFFPLIQPTQVFVATKDLRGAVYNSVYTVDVSQVSPA* |
Ga0134126_125895432 | 3300010396 | Terrestrial Soil | QIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR* |
Ga0138505_1000476023 | 3300010999 | Soil | QQTIYRQIQRRLNQIGPYFPLIQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPR* |
Ga0105246_112300491 | 3300011119 | Miscanthus Rhizosphere | LFQQFQRQLNTSGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK* |
Ga0105246_117720241 | 3300011119 | Miscanthus Rhizosphere | RKALYQKIQTQLNQRGPYFPLIQPTQVFVSTTDLNNAVFNATYAVDVTRVTPK* |
Ga0137381_116610631 | 3300012207 | Vadose Zone Soil | LQLNQRGPFIPLMQPTQVFVATSDLTNAVYNSVYSVDVTHVSPK* |
Ga0150985_1227031501 | 3300012212 | Avena Fatua Rhizosphere | ALFQQFQRQLNQSGPYFPLMQPTQVFVGTSDLKNAVYNAVYSVDVTKVAPK* |
Ga0137372_111816421 | 3300012350 | Vadose Zone Soil | PLIQPTQVFVSTADLANAVFNPVYQVDVTQVRAR* |
Ga0137390_114777851 | 3300012363 | Vadose Zone Soil | RGPFFPLIQPTQVFVSTADLKNAVYNAEYDVDVTQVSPK* |
Ga0157314_10246022 | 3300012500 | Arabidopsis Rhizosphere | FFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA* |
Ga0164241_103483561 | 3300012943 | Soil | KMLTTVRVATKDAVRTQLYQSIQRRLNQVGPYFPLLQPTQVFVNTRDLSGAAFNAVYFVDVTKVKPR* |
Ga0164298_100167835 | 3300012955 | Soil | YFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK* |
Ga0164299_106601121 | 3300012958 | Soil | PYFPLLQPTQVFVNTKDLSGAAFNAVYFVDVTKVKPR* |
Ga0164299_113055631 | 3300012958 | Soil | MPCQKDSNIVRTIQRRLNAVGPFVPLLQPVQVFVSTKDLKGAVFNAQYQVDVTQVAPR* |
Ga0164301_108431082 | 3300012960 | Soil | VGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVTPR* |
Ga0164301_113021062 | 3300012960 | Soil | QALYQQFQRGLNARGPYFPLMQPTQVFVATKDLVNAVYNATYSIDVTQVAPK* |
Ga0164301_114299681 | 3300012960 | Soil | PRLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA* |
Ga0164302_106246632 | 3300012961 | Soil | RPVLPLMQPTQVFVATKDLVNAVYNATYSIDVTQVAPK* |
Ga0134087_102074342 | 3300012977 | Grasslands Soil | TTKASARQTVYRQIQRRLNAVSPFFPLLQPTQVFVSTRDLKNAVFNAQYQVDVTQVAPR* |
Ga0164308_121852181 | 3300012985 | Soil | LYQTIQQRLNAYGPFFPLLQPTQVFVATKDLATAKFNAVYSIDVTQTKPKG* |
Ga0157374_116559802 | 3300013296 | Miscanthus Rhizosphere | FFPLIQPTQVFVSTKDINGAVYNPVYTVDFTQVSPK* |
Ga0157378_102565913 | 3300013297 | Miscanthus Rhizosphere | PLLQPTQVFVATKDLATAKFNAVYSIDVTQTKPKG* |
Ga0163162_132207331 | 3300013306 | Switchgrass Rhizosphere | FPLLQPAQVFVNTKDLSGAAFNAVYFVDITKVKPR* |
Ga0163163_118645812 | 3300014325 | Switchgrass Rhizosphere | LYQSIQRRLNQVGPYFPLLQPAQVFVNTKDLSGAAFNAVYFVDITKVKPR* |
Ga0157380_107819061 | 3300014326 | Switchgrass Rhizosphere | KRLNGYGPFFPLLQPTQVFVSTKDLANAKFNAVYSIDVTQTKPKG* |
Ga0182008_107713542 | 3300014497 | Rhizosphere | GPFFPLIQPTQVFVSTKDLKNAKFHPVYQIDVTQVAPK* |
Ga0182024_105664572 | 3300014501 | Permafrost | LVTTAPSARESLYRRYQIVLNQSGPFFPLIQPTQVFVSTKDLMGAVYNAEYDTNITQISPA* |
Ga0167664_10346183 | 3300015208 | Glacier Forefield Soil | PFFPLLQPTQVFVATKDLATAKFNAVYSIDVTQTKPKG* |
Ga0134073_101665491 | 3300015356 | Grasslands Soil | QIQLHLNQRGPFFPLLQPTQVFAATTDLRNAVFNPEYEIDVTQVSAK* |
Ga0132258_131386361 | 3300015371 | Arabidopsis Rhizosphere | SGPFFPLIQPTQVFAPTKDLRGAIYNPVYTVDTLQVSPA* |
Ga0132256_1013141041 | 3300015372 | Arabidopsis Rhizosphere | YRSIQRLLNQSSPFFPLIQPTQVFVSTKDLKGAVYNSVYTVDTLQVSPS* |
Ga0132256_1034321271 | 3300015372 | Arabidopsis Rhizosphere | LSQPTQVFVATKDLKNAVYNSVYDVDVTQVTPAS* |
Ga0132257_1000182269 | 3300015373 | Arabidopsis Rhizosphere | GPYFPLMQPTQVFVTTKDLSGAAFNAVYFVDVTKVKPR* |
Ga0132257_1004500121 | 3300015373 | Arabidopsis Rhizosphere | RQLNASGPYFPLMQPTQVFVSTSDLKNAVYNAVYSVDVTKVAPK* |
Ga0132257_1022984081 | 3300015373 | Arabidopsis Rhizosphere | QVGPYFPLMQPTQVFVTTKDLSGAAFNAVYFVDVTKVKPR* |
Ga0132255_1030367052 | 3300015374 | Arabidopsis Rhizosphere | VPVARAAVYRQFQNALNARGPYFPLIQPTQVFVATTDLKNALFNAVYQIDVTRTAAK* |
Ga0182037_119916951 | 3300016404 | Soil | QRLLNQSGPFFPLIQPTQVFVSTKDLRGAVYNSVYTVDTLQVSPA |
Ga0182039_103554372 | 3300016422 | Soil | GPYFPLIQPTQVFVATSDLNNAVYNATYSVDVTQVSPK |
Ga0182038_114982171 | 3300016445 | Soil | NQSSPFFPLIQPTQVFVATKDLRGAIYNSVYTVDVSQVSPA |
Ga0187820_12549941 | 3300017924 | Freshwater Sediment | QQDLNATGPYFPLIQPTQVFVATSDLKNAVYNAVYSVDVTQLSPK |
Ga0187785_104905421 | 3300017947 | Tropical Peatland | YQQIQTQLNDRGPYFPLIQPTQVFVSTSDLKGAVYNATYSVDVTAVSPK |
Ga0187776_100403784 | 3300017966 | Tropical Peatland | LYQQIQRELNQRGPYFPLMQPTQVFVSTTDLKNAVYNAEYSVDVTQVSPR |
Ga0184610_11740051 | 3300017997 | Groundwater Sediment | LNTVGPFFPLLQPTQVFVATKDLKNAVFNAQYQVDVTRVAPK |
Ga0184605_102844552 | 3300018027 | Groundwater Sediment | NAVGPYFPLVQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK |
Ga0184633_100066926 | 3300018077 | Groundwater Sediment | SGPYFPLIQPTQVFVATSDLKGAVFNPLYQIDVRLPQPAA |
Ga0193747_11070242 | 3300019885 | Soil | NQSGPFFPLIQPAQVFVATRDLTNAVFNPVYEIDVTRVSPK |
Ga0193728_12986371 | 3300019890 | Soil | AAKRKTLYQQIQQQLNQRGPYFPLIQPTQVFVSTSDLRGATYNAEFLVDPLQVSPK |
Ga0197907_104496222 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | GPYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK |
Ga0206356_103061861 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | SIQRRLNQVGPYFPLLQPAQVFVNTKDLSGAAFNAVYFVDVTKVKPR |
Ga0210382_101347862 | 3300021080 | Groundwater Sediment | QIQRRLNAAGPFFPLLQPTQVFVSTKDLKNAFFNAQYQVDVTQVSPK |
Ga0224452_12323522 | 3300022534 | Groundwater Sediment | AVGPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK |
Ga0222622_107141031 | 3300022756 | Groundwater Sediment | RLNQTGPYFPLIQPTQVFVSTTDLRNAVFNATYAVDVTQVSPK |
Ga0207682_100875652 | 3300025893 | Miscanthus Rhizosphere | AGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA |
Ga0207647_100539534 | 3300025904 | Corn Rhizosphere | AAIYRSIQRLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA |
Ga0207695_112508881 | 3300025913 | Corn Rhizosphere | QQFQRQLNTSGPYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK |
Ga0207693_113141231 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RQLNASGPYFPLMQPTQVFVATSDLKNAVYNAVYSIDVTKVAPK |
Ga0207659_104105321 | 3300025926 | Miscanthus Rhizosphere | LLNQGGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA |
Ga0207687_119485632 | 3300025927 | Miscanthus Rhizosphere | NASGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK |
Ga0207701_112301391 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR |
Ga0207644_104450111 | 3300025931 | Switchgrass Rhizosphere | QLNASGPYFPLMQPTQVFVATSDLKNAVYNAVYSIDVTKVAPS |
Ga0207690_113139062 | 3300025932 | Corn Rhizosphere | YGPFFPLLQPTQVFVSTKDLATAKFNAVYSIDVTQTKPKG |
Ga0207709_112010632 | 3300025935 | Miscanthus Rhizosphere | PYFPLMQPTQVFVATSDLKNAVYNAVYSVDVTKVAPK |
Ga0207670_105078702 | 3300025936 | Switchgrass Rhizosphere | TIQRRLNAYGPFFPLLQPTQVFVSTKDLATAKFNAVYSIDVTQTKPKG |
Ga0207704_107379981 | 3300025938 | Miscanthus Rhizosphere | PFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA |
Ga0207711_113177602 | 3300025941 | Switchgrass Rhizosphere | FPLLQPTQVFVSTKDLATAKFNAVYSIDVTQTKPKG |
Ga0207661_101768613 | 3300025944 | Corn Rhizosphere | YFPLLQPAQVFVNTKDLSGAAFNAVYFVDITKVKPR |
Ga0207661_117473992 | 3300025944 | Corn Rhizosphere | NTSGPYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK |
Ga0207679_101232014 | 3300025945 | Corn Rhizosphere | QIGPYFPLLQPTQVFVNTRDLSGAAFNAVYFVDVTKVKPR |
Ga0207667_108959921 | 3300025949 | Corn Rhizosphere | KRTALFQQFQRQLNTSGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK |
Ga0207651_115320782 | 3300025960 | Switchgrass Rhizosphere | RQLNASGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK |
Ga0207640_110670342 | 3300025981 | Corn Rhizosphere | LNQVGPYFPLLQPAQVFVNTKDLSGAAFNAVYFVDITKVKPR |
Ga0207658_115871261 | 3300025986 | Switchgrass Rhizosphere | LYQTIQRRLNAAGPFFPLLQPTQVFVSTKDLKNAFFNAQYQVDVTQVAPR |
Ga0207677_113902841 | 3300026023 | Miscanthus Rhizosphere | QRQLNASGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK |
Ga0207648_114553542 | 3300026089 | Miscanthus Rhizosphere | PFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVAQVSPA |
Ga0207698_121237111 | 3300026142 | Corn Rhizosphere | NARGPYFPLMQPTQVFVATKDLVNAVYNATYSIDVTQVAPK |
Ga0209377_13085601 | 3300026334 | Soil | GPFIPLMQPTQVFVATSDLKNAVYNATYDVDVTAVSPK |
Ga0209474_107189981 | 3300026550 | Soil | AKARESLYRQIQLQLNQRGPFFPLIQPTQVFVSTSDLKGATYNAEFLVDPLQVSPK |
Ga0207454_1026222 | 3300026746 | Soil | TSRASVRQTIYRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR |
Ga0207605_1011582 | 3300026757 | Soil | LLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA |
Ga0209887_10112373 | 3300027561 | Groundwater Sand | PFVPLLQPTQVFVSTKDLKGAVFNAQYQVDVTQVSPK |
Ga0209772_102850762 | 3300027768 | Bog Forest Soil | DLNQTGPFFPLIQPTQVFVSTADLKGAVYNAEYDTNITQISPA |
Ga0247820_112851621 | 3300028597 | Soil | QAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA |
Ga0307320_104184132 | 3300028771 | Soil | GPFFPLLQPGHGFVATKDLRNAFFNSQYELDVTQVSPK |
Ga0307299_102508232 | 3300028793 | Soil | RGPYFPLIQPTQVFVSTTDLRNAVFNATYAVDVTQVSPK |
Ga0265338_107114701 | 3300028800 | Rhizosphere | GPYFPLIQPTQVFVSTADLKGAVYNAEYDVDVTQVSPK |
Ga0307281_100084931 | 3300028803 | Soil | RRLNAAGPFFPLLQPTQVFVSTKDLKNAFFNAQYQVDVTQVSAK |
Ga0307292_103516192 | 3300028811 | Soil | KARITTATKALQTIYRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK |
Ga0307278_101119741 | 3300028878 | Soil | NAVGPYFPLVQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPR |
Ga0247826_100651043 | 3300030336 | Soil | RLNSVGPYFPLIQPTQVFVATTDLKNAVFHPVYQIDVTQVGAK |
Ga0247826_101071491 | 3300030336 | Soil | IYRQIQRRLNAVGPFVPLLQPVQVFVSTRDLRGAVFNAQYQVDVTRVAPR |
Ga0210278_11190012 | 3300030596 | Soil | IYQQIQRLLNQSGPFYPLIQPTQVFVSTKDLRGAVYNAEYDVDVSQITPA |
Ga0265462_124106331 | 3300030738 | Soil | RQGIYRAYQRLLNESGPYFPLIQPTQVFVSTKDLLGAVYNAEYDTNITQIAPA |
Ga0307501_101056242 | 3300031152 | Soil | RLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR |
Ga0307497_100971991 | 3300031226 | Soil | NAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR |
Ga0307497_106966212 | 3300031226 | Soil | YGPFFPLLQPTQVFVATKDLSVAKFNAVYSIDVTQTKP |
Ga0302325_124924262 | 3300031234 | Palsa | SGPYFPLIQPTQVFVSTKDLKGAAYSAEYDTNITQISPA |
Ga0318516_107180052 | 3300031543 | Soil | KREALYQQFQRDLNTSGPYFPLIQPTQVFVATSDMRNAVYNAVYSVDVTQVSPK |
Ga0318555_104429602 | 3300031640 | Soil | RQKLYQQFQIALNQRGPYFPLIQPTQVFVSTTDLKNAVYNAVTLLDITQVAPK |
Ga0307374_103794192 | 3300031670 | Soil | YFPLIQPTQVFVSTKDLNGAVYNAEYDVDVTQISPR |
Ga0307374_106523341 | 3300031670 | Soil | GPYYPLIQPTQVFVSTKDLKGAVYNAEFDVDVTQISPA |
Ga0318561_108104282 | 3300031679 | Soil | LNGPFYPLIQPTQVFVSTKDLRNAFYNAVYQVDVTAVSPA |
Ga0318574_100639283 | 3300031680 | Soil | KSLYQAYQRELNQRGPYFPLIQPTQVFVSTSDLNGAVYNATYSIDVTQVSPK |
Ga0265314_107047972 | 3300031711 | Rhizosphere | AARKSLYQQIQLQLNARGPYFPLMQPTQVFVSTSDLKNAVYNSEYDVDVTQISPK |
Ga0265342_101811532 | 3300031712 | Rhizosphere | PAARKSLYQQIQTDLNQQGPYFPLIQPTQVFVSTADLKGAVYNAEYDVDVTQVSPK |
Ga0306917_110340192 | 3300031719 | Soil | NQRGPYFPLIQPTQVFVSTSDLNGAVYNATYSIDVTQVSPK |
Ga0307469_116779462 | 3300031720 | Hardwood Forest Soil | YRQIQRRLNTVGPFIPLMQPVQVFVSTKDLKNAVFNAQYQVDVTQVAPR |
Ga0307405_111607012 | 3300031731 | Rhizosphere | QVGPYFPLIQPTQVFVNTKDLSGAAFNAVYFVDITKVKPR |
Ga0318546_113052731 | 3300031771 | Soil | VTTAPASRAVVYRSIQRLLNQGSPFFPLIQPTQVFVSTKDLRGAVFNAVYTVDTRQVSPA |
Ga0318523_103075922 | 3300031798 | Soil | PYFPLIQPTQVFVSTSDLNGAVYNATYSIDVTQVSPK |
Ga0318565_104635652 | 3300031799 | Soil | PFFPLIQPTQVFVATKDLRGAVYNSVYTVDVSQVSPA |
Ga0318567_106849762 | 3300031821 | Soil | TTQPAARAVVYRSIQRLLNLNGPFYPLIQPTQVFVSTKDLRNAFYNAVYQVDVTAVSPA |
Ga0315290_102901861 | 3300031834 | Sediment | DSAREKIYQTIQKRLNAYGPFFPLLQPTQVFVATNDFANAKFNAVYSIDVTQTKPKG |
Ga0310916_115290971 | 3300031942 | Soil | SLYQAYQRELNQRGPYFPLIQPTQVFVSTSDLNGAVYNATYSIDVTQVSPK |
Ga0310909_112426891 | 3300031947 | Soil | ELNQRGPYFPLIQPTQVFVSTSDLNGAVYNATYSIDVTQVSPK |
Ga0306922_121547022 | 3300032001 | Soil | PFFPLIQPTQVFVSTKDLRGAVYNSVYTVDVSQVSPA |
Ga0310897_100132724 | 3300032003 | Soil | GPYFPLMQPTQVFVTTKDLSGAAFNAVYFVDVTKVKPR |
Ga0318558_106346292 | 3300032044 | Soil | IQRLLNQSGPFFPLIQPTQVFVSTKDLRGAVYNSVYTVDVSQVRPA |
Ga0318524_106093621 | 3300032067 | Soil | YQQYQRELNQRGPYFPLIQPTQVFVATSDLNNAVYNATYSVDVTQVSPK |
Ga0311301_120413402 | 3300032160 | Peatlands Soil | SGPYFPLMQPTQVFVATSDLKSAVYNAEYDVDVTQVSPK |
Ga0307471_1005673172 | 3300032180 | Hardwood Forest Soil | RSIQRLLNQSGPFFPLIQPTQVFVATKDLRGAVYNSVYTVDTLQVSPA |
Ga0335082_110517601 | 3300032782 | Soil | QIQNQLNARGPFFPLMQPTQVFVSTSDLSNAVYNATYSIDVTQVSPK |
Ga0335080_106496491 | 3300032828 | Soil | LNLNGPFYPLIQPTQVFVSTKDLKNAVYNSVYDVDVTQVSPAS |
⦗Top⦘ |