NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029200

Metagenome / Metatranscriptome Family F029200

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029200
Family Type Metagenome / Metatranscriptome
Number of Sequences 189
Average Sequence Length 45 residues
Representative Sequence AVGPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK
Number of Associated Samples 169
Number of Associated Scaffolds 189

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.53 %
% of genes near scaffold ends (potentially truncated) 97.88 %
% of genes from short scaffolds (< 2000 bps) 94.18 %
Associated GOLD sequencing projects 158
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.238 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.053 % of family members)
Environment Ontology (ENVO) Unclassified
(29.101 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.683 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.41%    β-sheet: 0.00%    Coil/Unstructured: 95.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 189 Family Scaffolds
PF00557Peptidase_M24 77.78
PF01321Creatinase_N 8.99
PF01266DAO 1.59
PF00496SBP_bac_5 1.06
PF00265TK 1.06
PF12787EcsC 0.53
PF02656DUF202 0.53
PF00296Bac_luciferase 0.53
PF13474SnoaL_3 0.53
PF00211Guanylate_cyc 0.53
PF06240COXG 0.53
PF01323DSBA 0.53
PF13407Peripla_BP_4 0.53
PF01872RibD_C 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 189 Family Scaffolds
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 8.99
COG1435Thymidine kinaseNucleotide transport and metabolism [F] 1.06
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.53
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.53
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.53
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.53
COG2149Uncharacterized membrane protein YidH, DUF202 familyFunction unknown [S] 0.53
COG3427Carbon monoxide dehydrogenase subunit CoxGEnergy production and conversion [C] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.24 %
UnclassifiedrootN/A4.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q01DKZRPNot Available525Open in IMG/M
2170459014|G1P06HT01BTPX1All Organisms → cellular organisms → Bacteria → Terrabacteria group565Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_10732393All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300000956|JGI10216J12902_100575024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria957Open in IMG/M
3300001978|JGI24747J21853_1012492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300001979|JGI24740J21852_10143793All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300002239|JGI24034J26672_10044006All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300002239|JGI24034J26672_10070399All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300002547|JGI24973J35851_1036444All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300002568|C688J35102_118592668All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300003987|Ga0055471_10019871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1597Open in IMG/M
3300003987|Ga0055471_10119622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → Leifsonia rubra785Open in IMG/M
3300004156|Ga0062589_102813445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300005146|Ga0066817_1016252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia647Open in IMG/M
3300005162|Ga0066814_10100680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300005164|Ga0066815_10001884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1860Open in IMG/M
3300005169|Ga0066810_10079662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300005177|Ga0066690_10846947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300005329|Ga0070683_101624394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300005329|Ga0070683_102086554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300005331|Ga0070670_101071917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria734Open in IMG/M
3300005333|Ga0070677_10034867All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300005364|Ga0070673_101884932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300005366|Ga0070659_100600320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300005436|Ga0070713_101128657All Organisms → cellular organisms → Bacteria → Terrabacteria group758Open in IMG/M
3300005439|Ga0070711_101901158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300005554|Ga0066661_10929035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300005556|Ga0066707_10887754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300005557|Ga0066704_10660375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300005560|Ga0066670_10602239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300005560|Ga0066670_10962471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300005566|Ga0066693_10477673All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300005569|Ga0066705_10321341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria980Open in IMG/M
3300005764|Ga0066903_107529103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300005921|Ga0070766_10508768All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300006032|Ga0066696_11025213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300006034|Ga0066656_10821664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300006046|Ga0066652_100333132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1360Open in IMG/M
3300006046|Ga0066652_101762045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300006173|Ga0070716_101764435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300006178|Ga0075367_10470185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia797Open in IMG/M
3300006178|Ga0075367_10622427All Organisms → cellular organisms → Bacteria → Terrabacteria group686Open in IMG/M
3300006755|Ga0079222_10318905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1028Open in IMG/M
3300006800|Ga0066660_11320946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300006953|Ga0074063_10037434All Organisms → cellular organisms → Bacteria → Terrabacteria group1113Open in IMG/M
3300006954|Ga0079219_10445575All Organisms → cellular organisms → Bacteria → Terrabacteria group881Open in IMG/M
3300009012|Ga0066710_102142869All Organisms → cellular organisms → Bacteria → Terrabacteria group819Open in IMG/M
3300009012|Ga0066710_104293185All Organisms → cellular organisms → Bacteria → Terrabacteria group533Open in IMG/M
3300009038|Ga0099829_11450382All Organisms → cellular organisms → Bacteria → Terrabacteria group567Open in IMG/M
3300009093|Ga0105240_12103892All Organisms → cellular organisms → Bacteria → Terrabacteria group586Open in IMG/M
3300009137|Ga0066709_101965637All Organisms → cellular organisms → Bacteria → Terrabacteria group811Open in IMG/M
3300009147|Ga0114129_11254804Not Available920Open in IMG/M
3300009148|Ga0105243_11313650All Organisms → cellular organisms → Bacteria → Terrabacteria group741Open in IMG/M
3300009162|Ga0075423_12219508All Organisms → cellular organisms → Bacteria → Terrabacteria group596Open in IMG/M
3300009176|Ga0105242_12245268All Organisms → cellular organisms → Bacteria → Terrabacteria group591Open in IMG/M
3300009177|Ga0105248_10181990All Organisms → cellular organisms → Bacteria2368Open in IMG/M
3300009553|Ga0105249_11131860All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300009649|Ga0105855_1149188All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300009698|Ga0116216_10603514All Organisms → cellular organisms → Bacteria → Terrabacteria group661Open in IMG/M
3300010039|Ga0126309_10538726All Organisms → cellular organisms → Bacteria → Terrabacteria group725Open in IMG/M
3300010042|Ga0126314_11363534All Organisms → cellular organisms → Bacteria → Terrabacteria group532Open in IMG/M
3300010046|Ga0126384_11389249All Organisms → cellular organisms → Bacteria → Terrabacteria group654Open in IMG/M
3300010130|Ga0127493_1147250Not Available750Open in IMG/M
3300010335|Ga0134063_10579332All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300010335|Ga0134063_10617433All Organisms → cellular organisms → Bacteria → Terrabacteria group553Open in IMG/M
3300010360|Ga0126372_12661419All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300010379|Ga0136449_101031184All Organisms → cellular organisms → Bacteria → Terrabacteria group1319Open in IMG/M
3300010396|Ga0134126_11256180All Organisms → cellular organisms → Bacteria → Terrabacteria group821Open in IMG/M
3300010396|Ga0134126_12589543All Organisms → cellular organisms → Bacteria → Terrabacteria group551Open in IMG/M
3300010999|Ga0138505_100047602All Organisms → cellular organisms → Bacteria → Terrabacteria group615Open in IMG/M
3300011119|Ga0105246_11230049All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300011119|Ga0105246_11772024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300012207|Ga0137381_11661063All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300012212|Ga0150985_122703150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → Leifsonia rubra1667Open in IMG/M
3300012350|Ga0137372_11181642All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300012363|Ga0137390_11477785All Organisms → cellular organisms → Bacteria → Terrabacteria group621Open in IMG/M
3300012500|Ga0157314_1024602All Organisms → cellular organisms → Bacteria → Terrabacteria group638Open in IMG/M
3300012943|Ga0164241_10348356All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300012955|Ga0164298_10016783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3024Open in IMG/M
3300012958|Ga0164299_10660112All Organisms → cellular organisms → Bacteria → Terrabacteria group725Open in IMG/M
3300012958|Ga0164299_11305563All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300012960|Ga0164301_10843108All Organisms → cellular organisms → Bacteria → Terrabacteria group705Open in IMG/M
3300012960|Ga0164301_11302106All Organisms → cellular organisms → Bacteria → Terrabacteria group589Open in IMG/M
3300012960|Ga0164301_11429968All Organisms → cellular organisms → Bacteria → Terrabacteria group566Open in IMG/M
3300012961|Ga0164302_10624663All Organisms → cellular organisms → Bacteria → Terrabacteria group785Open in IMG/M
3300012977|Ga0134087_10207434All Organisms → cellular organisms → Bacteria → Terrabacteria group880Open in IMG/M
3300012985|Ga0164308_12185218All Organisms → cellular organisms → Bacteria → Terrabacteria group515Open in IMG/M
3300013296|Ga0157374_11655980All Organisms → cellular organisms → Bacteria → Terrabacteria group664Open in IMG/M
3300013297|Ga0157378_10256591All Organisms → cellular organisms → Bacteria → Terrabacteria group1676Open in IMG/M
3300013306|Ga0163162_13220733All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300014325|Ga0163163_11864581All Organisms → cellular organisms → Bacteria → Terrabacteria group661Open in IMG/M
3300014326|Ga0157380_10781906All Organisms → cellular organisms → Bacteria → Terrabacteria group969Open in IMG/M
3300014497|Ga0182008_10771354Not Available556Open in IMG/M
3300014501|Ga0182024_10566457All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300015208|Ga0167664_1034618All Organisms → cellular organisms → Bacteria1724Open in IMG/M
3300015356|Ga0134073_10166549All Organisms → cellular organisms → Bacteria → Terrabacteria group708Open in IMG/M
3300015371|Ga0132258_13138636All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis1141Open in IMG/M
3300015372|Ga0132256_101314104All Organisms → cellular organisms → Bacteria → Terrabacteria group836Open in IMG/M
3300015372|Ga0132256_103432127All Organisms → cellular organisms → Bacteria → Terrabacteria group533Open in IMG/M
3300015373|Ga0132257_100018226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7327Open in IMG/M
3300015373|Ga0132257_100450012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1573Open in IMG/M
3300015373|Ga0132257_102298408All Organisms → cellular organisms → Bacteria → Terrabacteria group699Open in IMG/M
3300015374|Ga0132255_103036705All Organisms → cellular organisms → Bacteria → Terrabacteria group716Open in IMG/M
3300016404|Ga0182037_11991695All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300016422|Ga0182039_10355437Not Available1231Open in IMG/M
3300016445|Ga0182038_11498217All Organisms → cellular organisms → Bacteria → Terrabacteria group606Open in IMG/M
3300017924|Ga0187820_1254994All Organisms → cellular organisms → Bacteria → Terrabacteria group564Open in IMG/M
3300017947|Ga0187785_10490542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae610Open in IMG/M
3300017966|Ga0187776_10040378All Organisms → cellular organisms → Bacteria2627Open in IMG/M
3300017997|Ga0184610_1174005All Organisms → cellular organisms → Bacteria → Terrabacteria group713Open in IMG/M
3300018027|Ga0184605_10284455All Organisms → cellular organisms → Bacteria → Terrabacteria group750Open in IMG/M
3300018077|Ga0184633_10006692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5357Open in IMG/M
3300019885|Ga0193747_1107024Not Available673Open in IMG/M
3300019890|Ga0193728_1298637All Organisms → cellular organisms → Bacteria → Terrabacteria group613Open in IMG/M
3300020069|Ga0197907_10449622All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300020070|Ga0206356_10306186All Organisms → cellular organisms → Bacteria → Terrabacteria group1132Open in IMG/M
3300021080|Ga0210382_10134786All Organisms → cellular organisms → Bacteria → Terrabacteria group1051Open in IMG/M
3300022534|Ga0224452_1232352All Organisms → cellular organisms → Bacteria → Terrabacteria group565Open in IMG/M
3300022756|Ga0222622_10714103All Organisms → cellular organisms → Bacteria → Terrabacteria group729Open in IMG/M
3300025893|Ga0207682_10087565All Organisms → cellular organisms → Bacteria → Terrabacteria group1345Open in IMG/M
3300025904|Ga0207647_10053953All Organisms → cellular organisms → Bacteria2474Open in IMG/M
3300025913|Ga0207695_11250888All Organisms → cellular organisms → Bacteria → Terrabacteria group623Open in IMG/M
3300025915|Ga0207693_11314123All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300025926|Ga0207659_10410532All Organisms → cellular organisms → Bacteria → Terrabacteria group1134Open in IMG/M
3300025927|Ga0207687_11948563All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300025930|Ga0207701_11230139All Organisms → cellular organisms → Bacteria → Terrabacteria group616Open in IMG/M
3300025931|Ga0207644_10445011All Organisms → cellular organisms → Bacteria → Terrabacteria group1064Open in IMG/M
3300025932|Ga0207690_11313906All Organisms → cellular organisms → Bacteria → Terrabacteria group604Open in IMG/M
3300025935|Ga0207709_11201063All Organisms → cellular organisms → Bacteria → Terrabacteria group625Open in IMG/M
3300025936|Ga0207670_10507870All Organisms → cellular organisms → Bacteria → Terrabacteria group980Open in IMG/M
3300025938|Ga0207704_10737998All Organisms → cellular organisms → Bacteria → Terrabacteria group818Open in IMG/M
3300025941|Ga0207711_11317760All Organisms → cellular organisms → Bacteria → Terrabacteria group664Open in IMG/M
3300025944|Ga0207661_10176861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum1861Open in IMG/M
3300025944|Ga0207661_11747399All Organisms → cellular organisms → Bacteria → Terrabacteria group567Open in IMG/M
3300025945|Ga0207679_10123201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2067Open in IMG/M
3300025949|Ga0207667_10895992All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300025960|Ga0207651_11532078All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300025981|Ga0207640_11067034All Organisms → cellular organisms → Bacteria → Terrabacteria group713Open in IMG/M
3300025986|Ga0207658_11587126All Organisms → cellular organisms → Bacteria → Terrabacteria group598Open in IMG/M
3300026023|Ga0207677_11390284All Organisms → cellular organisms → Bacteria → Terrabacteria group646Open in IMG/M
3300026089|Ga0207648_11455354All Organisms → cellular organisms → Bacteria → Nitrospirae644Open in IMG/M
3300026142|Ga0207698_12123711All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300026334|Ga0209377_1308560All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300026550|Ga0209474_10718998All Organisms → cellular organisms → Bacteria → Terrabacteria group519Open in IMG/M
3300026746|Ga0207454_102622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300026757|Ga0207605_101158All Organisms → cellular organisms → Bacteria → Terrabacteria group675Open in IMG/M
3300027561|Ga0209887_1011237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2325Open in IMG/M
3300027768|Ga0209772_10285076Not Available524Open in IMG/M
3300028597|Ga0247820_11285162All Organisms → cellular organisms → Bacteria → Terrabacteria group530Open in IMG/M
3300028771|Ga0307320_10418413Not Available539Open in IMG/M
3300028793|Ga0307299_10250823All Organisms → cellular organisms → Bacteria → Terrabacteria group665Open in IMG/M
3300028800|Ga0265338_10711470All Organisms → cellular organisms → Bacteria → Terrabacteria group693Open in IMG/M
3300028803|Ga0307281_10008493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2835Open in IMG/M
3300028811|Ga0307292_10351619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300028878|Ga0307278_10111974All Organisms → cellular organisms → Bacteria → Terrabacteria group1227Open in IMG/M
3300030336|Ga0247826_10065104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2114Open in IMG/M
3300030336|Ga0247826_10107149All Organisms → cellular organisms → Bacteria1753Open in IMG/M
3300030596|Ga0210278_1119001All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300030738|Ga0265462_12410633All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300031152|Ga0307501_10105624All Organisms → cellular organisms → Bacteria → Terrabacteria group718Open in IMG/M
3300031226|Ga0307497_10097199All Organisms → cellular organisms → Bacteria → Terrabacteria group1140Open in IMG/M
3300031226|Ga0307497_10696621Not Available524Open in IMG/M
3300031234|Ga0302325_12492426All Organisms → cellular organisms → Bacteria → Terrabacteria group618Open in IMG/M
3300031543|Ga0318516_10718005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300031640|Ga0318555_10442960All Organisms → cellular organisms → Bacteria → Terrabacteria group704Open in IMG/M
3300031670|Ga0307374_10379419All Organisms → cellular organisms → Bacteria → Terrabacteria group831Open in IMG/M
3300031670|Ga0307374_10652334All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300031679|Ga0318561_10810428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani514Open in IMG/M
3300031680|Ga0318574_10063928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1970Open in IMG/M
3300031711|Ga0265314_10704797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300031712|Ga0265342_10181153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1154Open in IMG/M
3300031719|Ga0306917_11034019All Organisms → cellular organisms → Bacteria → Terrabacteria group641Open in IMG/M
3300031720|Ga0307469_11677946All Organisms → cellular organisms → Bacteria → Terrabacteria group612Open in IMG/M
3300031731|Ga0307405_11160701All Organisms → cellular organisms → Bacteria → Terrabacteria group666Open in IMG/M
3300031771|Ga0318546_11305273All Organisms → cellular organisms → Bacteria → Terrabacteria group510Open in IMG/M
3300031798|Ga0318523_10307592All Organisms → cellular organisms → Bacteria → Terrabacteria group791Open in IMG/M
3300031799|Ga0318565_10463565All Organisms → cellular organisms → Bacteria → Terrabacteria group613Open in IMG/M
3300031821|Ga0318567_10684976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani582Open in IMG/M
3300031834|Ga0315290_10290186All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300031942|Ga0310916_11529097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300031947|Ga0310909_11242689All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300032001|Ga0306922_12154702All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300032003|Ga0310897_10013272All Organisms → cellular organisms → Bacteria → Terrabacteria group2498Open in IMG/M
3300032044|Ga0318558_10634629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae534Open in IMG/M
3300032067|Ga0318524_10609362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300032160|Ga0311301_12041340All Organisms → cellular organisms → Bacteria → Terrabacteria group667Open in IMG/M
3300032180|Ga0307471_100567317All Organisms → cellular organisms → Bacteria → Terrabacteria group1291Open in IMG/M
3300032782|Ga0335082_11051760All Organisms → cellular organisms → Bacteria → Terrabacteria group679Open in IMG/M
3300032828|Ga0335080_10649649All Organisms → cellular organisms → Bacteria → Terrabacteria group1104Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.12%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.12%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.12%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.59%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.59%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.59%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.59%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.06%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.06%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.06%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.06%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.06%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.06%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.06%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.06%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.06%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.06%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.06%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.06%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.06%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.06%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.06%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.53%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.53%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.53%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.53%
Polar DesertEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert0.53%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.53%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.53%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.53%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.53%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.53%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.53%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.53%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.53%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.53%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.53%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.53%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.53%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459014Litter degradation PV2EngineeredOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300001979Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6Host-AssociatedOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300002547Polar desert microbial communities from Antarctic Dry Valleys - UQ889EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005146Soil and rhizosphere microbial communities from Laval, Canada - mgHABEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009649Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010130Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015208Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026746Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026757Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027561Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_050193802170459005Grass SoilTDSKAREKLFQQFQRQLNHDGAVLPADAADAGVVATSDLKNAVYNAVYSVDVTKVAPK
2PV_011309702170459014Switchgrass, Maize And Mischanthus LitterQTVFRAIQRRLNAVGPFFPLIQPTQVFVATKDLRNAVFNAQYQVDVTRVSPK
ICChiseqgaiiFebDRAFT_1073239323300000363SoilQTGPFIPLIQPTQVFVSTKDLRNAVFNPQYQIDVTRVAAR*
JGI10216J12902_10057502423300000956SoilMRGPYFPLFQPAQVFVATSDLRNAAFNAVYLVDVAQVSPKS*
JGI24747J21853_101249223300001978Corn, Switchgrass And Miscanthus RhizosphereARAAIYRSIQRLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA*
JGI24740J21852_1014379323300001979Corn RhizosphereNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR*
JGI24034J26672_1004400623300002239Corn, Switchgrass And Miscanthus RhizosphereAARAAIYRSIQRLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA*
JGI24034J26672_1007039913300002239Corn, Switchgrass And Miscanthus RhizosphereTIYRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR*
JGI24973J35851_103644423300002547Polar DesertNQTGPYFPLIQPTQVFASTKDLRGAVFNPLYSIDVRLARPAG*
C688J35102_11859266823300002568SoilASGPYFPLMQPTQVFVATSDLKNAVYNAVYSIDVTKVAPK*
Ga0055471_1001987113300003987Natural And Restored WetlandsRLNQVGPYFPLIQPTQVFVTTKDLSGAAFNAVYFVDITKVKPR*
Ga0055471_1011962223300003987Natural And Restored WetlandsRLNQVGPYFPLIQPTQVFVNTKDLSGAAFNAVYFVDITKVKPR*
Ga0062589_10281344513300004156SoilQIQLQLNQRGPYFPLFQPAQVFVATSDLENAAFNAVYGVDITQISPKS*
Ga0066817_101625223300005146SoilVTSRASVRQTIYRQIQRRLNVVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR
Ga0066814_1010068023300005162SoilVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR*
Ga0066815_1000188433300005164SoilYRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR*
Ga0066810_1007966213300005169SoilQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR*
Ga0066690_1084694723300005177SoilRGPFIPLMQPTQVFVATSDLKNAVYNSVYSVDVTHVSPK*
Ga0070683_10162439423300005329Corn RhizosphereRTALFQQFQRQLNTSGPYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK*
Ga0070683_10208655413300005329Corn RhizosphereQLNASGPYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK*
Ga0070670_10107191713300005331Switchgrass RhizosphereQLNQRGPYFPLIQPTQVFVSTTDLNNAVFNATYAVDVTRVTPK*
Ga0070677_1003486733300005333Miscanthus RhizosphereYRSIQRLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA*
Ga0070673_10188493223300005364Switchgrass RhizosphereRQLNASGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK*
Ga0070659_10060032013300005366Corn RhizosphereARGPYFPLMQPTQVFVATSDLNNAVYNATYSIDVTKVSPK*
Ga0070713_10112865713300005436Corn, Switchgrass And Miscanthus RhizosphereVRQTIYRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR*
Ga0070711_10190115813300005439Corn, Switchgrass And Miscanthus RhizosphereLNQRGPFFPLMQPTQVFVNTTDLKNAVFNAEYEIDVTQVGAK*
Ga0066661_1092903523300005554SoilPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPR*
Ga0066707_1088775413300005556SoilARQTVYRQIQRRLNAVSPFFPLLQPTQVFVSTRDLKNAVFNAQYQVDVTQVAPR*
Ga0066704_1066037523300005557SoilQLNQRGPFFPLLQPTQVFAATTDLKNAVFHAEYQIDVTQVSSR*
Ga0066670_1060223923300005560SoilGPYFPLMQPTQVFVSTSDLRNAVYNAEYSIDVTQVSPK*
Ga0066670_1096247113300005560SoilYQQLQQQLNQRGPYFPLIQPTQVFVATADLKNAVYNATYSIDVTQVSSR*
Ga0066693_1047767323300005566SoilPLLQPTQVFVATTDLKNAVFNAEYEIDVTQAAAT*
Ga0066705_1032134113300005569SoilQTVFRAIQRRLNAVGPFFPLIQPTQVFVATKDLRNAVFNAQYQVDVTRVSPK*
Ga0066903_10752910313300005764Tropical Forest SoilQRELNARGPYFPLMQPTQVFVATTDLNHAVFNATYAIDVTNVTPK*
Ga0070766_1050876813300005921SoilEIYRAYQRMLNQSGPYFPLIQPTQVFVSTKDLKGAVYNAEYDTNITQISPA*
Ga0066696_1102521313300006032SoilAPAAREKIYRQIQQQLNQRGPFFPLLQPTQVFVATTDLKNAVFNAEYEIDVTQVSAK*
Ga0066656_1082166413300006034SoilRQIQLQLNQRGPFFPLIQPTQVFVATNDLRNAVFNAEYEIDVTQVSPK*
Ga0066652_10033313213300006046SoilQLNQRGPYFPLIQPTQVFVSTTDLRNAVFNATYAVDVTQVSPK*
Ga0066652_10176204513300006046SoilGPYFPLIQPTQVFVATTDLKNAVYNATYSVDVTQVAPK*
Ga0070716_10176443513300006173Corn, Switchgrass And Miscanthus RhizosphereDLNASGPYFPLMQPTQVFVSTSDLKNAVFNAEYDVDVTQVSPK*
Ga0075367_1047018523300006178Populus EndosphereVGPFIPLLQPVQVFVSTRDLKGAVFNAQYQVDVTQVAPR*
Ga0075367_1062242723300006178Populus EndosphereGPYFPLIQPTQVFVNTKDLSGAAFNAVYFVDITKVKPR*
Ga0079222_1031890513300006755Agricultural SoilQQIQRELNQRGPYFPLIQPTQVFVSTVDLKGAVYNANFLVDLLQVSAK*
Ga0066660_1132094613300006800SoilQIQQQLNQRGPYFPLIQPTQVFVASTDLKNAVYNATYSIDVTKVSPR*
Ga0074063_1003743423300006953SoilFFPLLQPTQVFVSTKDLATAKFNAVYSIDVTQTKPKG*
Ga0079219_1044557523300006954Agricultural SoilPLIQPTQVFVSTKDLKNAVYNSVYDVDVTQVRPA*
Ga0066710_10214286913300009012Grasslands SoilQRGPFFPLLQPTQVFVATTDLKNAVFNAEYEIDVTQVSAK
Ga0066710_10429318513300009012Grasslands SoilRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK
Ga0099829_1145038223300009038Vadose Zone SoilQLQLNQRGPFIPLLQPTQVFVATSDLKNAVYNSVYSIDVTNVSPK*
Ga0105240_1210389223300009093Corn RhizospherePYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK*
Ga0066709_10196563723300009137Grasslands SoilYRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK*
Ga0114129_1125480423300009147Populus RhizospherePYFPLIQPTQVFASTVDMTGAVFNPLYSIDVRAPKPK*
Ga0105243_1131365013300009148Miscanthus RhizosphereQRLLNQSGPYFPLIQPTQVFVSTKDLRNAVYNAVYLVDVTQVSPK*
Ga0075423_1221950823300009162Populus RhizosphereDAKKRTALFQQFQRQLNTSGPYFPLMQPTQVFVATSDLKNAVYNAVYSVDVTKVAPK*
Ga0105242_1224526813300009176Miscanthus RhizosphereNAVGPFVPLLQPVQVFVSTKDLKGAVFNAQYQVDVTQVAPR*
Ga0105248_1018199013300009177Switchgrass RhizosphereQLNASGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK*
Ga0105249_1113186033300009553Switchgrass RhizosphereGPYFPLFQPAQVFVATSDLENAAFNAVYGVDITQISPKS*
Ga0105855_114918813300009649Permafrost SoilAVYQKIQTLLNQSGPYFPLIQPTQVFVSTKDLSGAVYNAEYDVDVSQITPG*
Ga0116216_1060351423300009698Peatlands SoilFPLMQPTQVFVATSDLKNAVYNAEYDVDVTQVSPK*
Ga0126309_1053872613300010039Serpentine SoilQHRLNSVGPFVPLLQPVQVFVSTKDLKGAVFNAQYQVDVTQVAPR*
Ga0126314_1136353423300010042Serpentine SoilPLIQPTQVFVSTRDLKGAVFNSQYQIDVTHVSPR*
Ga0126384_1138924913300010046Tropical Forest SoilYPLMQPTQVFVSTNDLRNAVFNAQYQIDVTRVSPK*
Ga0127493_114725023300010130Grasslands SoilMPLLQPTQVFVATSDLTNAVYNSVYSLDVTKVSPK*
Ga0134063_1057933213300010335Grasslands SoilTALFEQFQRQLNTSGPYFPLMQPTQVFVATSDLKNAVYNAVYSVDVTKLAPK*
Ga0134063_1061743313300010335Grasslands SoilLNARGPFVPLLQPTQVFVSTTDLKNAVFNAEYQIDVTQASPK*
Ga0126372_1266141923300010360Tropical Forest SoilVYRSIQRLLNQSGPFFPLIQPTQVFVSTKDLKGAVYNSVYTVDTLQVSPA*
Ga0136449_10103118423300010379Peatlands SoilIQLDLNASGPYFPLMQPTQVFVATSDLKNAVYNAEYDVDVTQVSPK*
Ga0134126_1125618013300010396Terrestrial SoilQSGPFFPLIQPTQVFVATKDLRGAVYNSVYTVDVSQVSPA*
Ga0134126_1258954323300010396Terrestrial SoilQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR*
Ga0138505_10004760233300010999SoilQQTIYRQIQRRLNQIGPYFPLIQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPR*
Ga0105246_1123004913300011119Miscanthus RhizosphereLFQQFQRQLNTSGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK*
Ga0105246_1177202413300011119Miscanthus RhizosphereRKALYQKIQTQLNQRGPYFPLIQPTQVFVSTTDLNNAVFNATYAVDVTRVTPK*
Ga0137381_1166106313300012207Vadose Zone SoilLQLNQRGPFIPLMQPTQVFVATSDLTNAVYNSVYSVDVTHVSPK*
Ga0150985_12270315013300012212Avena Fatua RhizosphereALFQQFQRQLNQSGPYFPLMQPTQVFVGTSDLKNAVYNAVYSVDVTKVAPK*
Ga0137372_1118164213300012350Vadose Zone SoilPLIQPTQVFVSTADLANAVFNPVYQVDVTQVRAR*
Ga0137390_1147778513300012363Vadose Zone SoilRGPFFPLIQPTQVFVSTADLKNAVYNAEYDVDVTQVSPK*
Ga0157314_102460223300012500Arabidopsis RhizosphereFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA*
Ga0164241_1034835613300012943SoilKMLTTVRVATKDAVRTQLYQSIQRRLNQVGPYFPLLQPTQVFVNTRDLSGAAFNAVYFVDVTKVKPR*
Ga0164298_1001678353300012955SoilYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK*
Ga0164299_1066011213300012958SoilPYFPLLQPTQVFVNTKDLSGAAFNAVYFVDVTKVKPR*
Ga0164299_1130556313300012958SoilMPCQKDSNIVRTIQRRLNAVGPFVPLLQPVQVFVSTKDLKGAVFNAQYQVDVTQVAPR*
Ga0164301_1084310823300012960SoilVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVTPR*
Ga0164301_1130210623300012960SoilQALYQQFQRGLNARGPYFPLMQPTQVFVATKDLVNAVYNATYSIDVTQVAPK*
Ga0164301_1142996813300012960SoilPRLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA*
Ga0164302_1062466323300012961SoilRPVLPLMQPTQVFVATKDLVNAVYNATYSIDVTQVAPK*
Ga0134087_1020743423300012977Grasslands SoilTTKASARQTVYRQIQRRLNAVSPFFPLLQPTQVFVSTRDLKNAVFNAQYQVDVTQVAPR*
Ga0164308_1218521813300012985SoilLYQTIQQRLNAYGPFFPLLQPTQVFVATKDLATAKFNAVYSIDVTQTKPKG*
Ga0157374_1165598023300013296Miscanthus RhizosphereFFPLIQPTQVFVSTKDINGAVYNPVYTVDFTQVSPK*
Ga0157378_1025659133300013297Miscanthus RhizospherePLLQPTQVFVATKDLATAKFNAVYSIDVTQTKPKG*
Ga0163162_1322073313300013306Switchgrass RhizosphereFPLLQPAQVFVNTKDLSGAAFNAVYFVDITKVKPR*
Ga0163163_1186458123300014325Switchgrass RhizosphereLYQSIQRRLNQVGPYFPLLQPAQVFVNTKDLSGAAFNAVYFVDITKVKPR*
Ga0157380_1078190613300014326Switchgrass RhizosphereKRLNGYGPFFPLLQPTQVFVSTKDLANAKFNAVYSIDVTQTKPKG*
Ga0182008_1077135423300014497RhizosphereGPFFPLIQPTQVFVSTKDLKNAKFHPVYQIDVTQVAPK*
Ga0182024_1056645723300014501PermafrostLVTTAPSARESLYRRYQIVLNQSGPFFPLIQPTQVFVSTKDLMGAVYNAEYDTNITQISPA*
Ga0167664_103461833300015208Glacier Forefield SoilPFFPLLQPTQVFVATKDLATAKFNAVYSIDVTQTKPKG*
Ga0134073_1016654913300015356Grasslands SoilQIQLHLNQRGPFFPLLQPTQVFAATTDLRNAVFNPEYEIDVTQVSAK*
Ga0132258_1313863613300015371Arabidopsis RhizosphereSGPFFPLIQPTQVFAPTKDLRGAIYNPVYTVDTLQVSPA*
Ga0132256_10131410413300015372Arabidopsis RhizosphereYRSIQRLLNQSSPFFPLIQPTQVFVSTKDLKGAVYNSVYTVDTLQVSPS*
Ga0132256_10343212713300015372Arabidopsis RhizosphereLSQPTQVFVATKDLKNAVYNSVYDVDVTQVTPAS*
Ga0132257_10001822693300015373Arabidopsis RhizosphereGPYFPLMQPTQVFVTTKDLSGAAFNAVYFVDVTKVKPR*
Ga0132257_10045001213300015373Arabidopsis RhizosphereRQLNASGPYFPLMQPTQVFVSTSDLKNAVYNAVYSVDVTKVAPK*
Ga0132257_10229840813300015373Arabidopsis RhizosphereQVGPYFPLMQPTQVFVTTKDLSGAAFNAVYFVDVTKVKPR*
Ga0132255_10303670523300015374Arabidopsis RhizosphereVPVARAAVYRQFQNALNARGPYFPLIQPTQVFVATTDLKNALFNAVYQIDVTRTAAK*
Ga0182037_1199169513300016404SoilQRLLNQSGPFFPLIQPTQVFVSTKDLRGAVYNSVYTVDTLQVSPA
Ga0182039_1035543723300016422SoilGPYFPLIQPTQVFVATSDLNNAVYNATYSVDVTQVSPK
Ga0182038_1149821713300016445SoilNQSSPFFPLIQPTQVFVATKDLRGAIYNSVYTVDVSQVSPA
Ga0187820_125499413300017924Freshwater SedimentQQDLNATGPYFPLIQPTQVFVATSDLKNAVYNAVYSVDVTQLSPK
Ga0187785_1049054213300017947Tropical PeatlandYQQIQTQLNDRGPYFPLIQPTQVFVSTSDLKGAVYNATYSVDVTAVSPK
Ga0187776_1004037843300017966Tropical PeatlandLYQQIQRELNQRGPYFPLMQPTQVFVSTTDLKNAVYNAEYSVDVTQVSPR
Ga0184610_117400513300017997Groundwater SedimentLNTVGPFFPLLQPTQVFVATKDLKNAVFNAQYQVDVTRVAPK
Ga0184605_1028445523300018027Groundwater SedimentNAVGPYFPLVQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK
Ga0184633_1000669263300018077Groundwater SedimentSGPYFPLIQPTQVFVATSDLKGAVFNPLYQIDVRLPQPAA
Ga0193747_110702423300019885SoilNQSGPFFPLIQPAQVFVATRDLTNAVFNPVYEIDVTRVSPK
Ga0193728_129863713300019890SoilAAKRKTLYQQIQQQLNQRGPYFPLIQPTQVFVSTSDLRGATYNAEFLVDPLQVSPK
Ga0197907_1044962223300020069Corn, Switchgrass And Miscanthus RhizosphereGPYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK
Ga0206356_1030618613300020070Corn, Switchgrass And Miscanthus RhizosphereSIQRRLNQVGPYFPLLQPAQVFVNTKDLSGAAFNAVYFVDVTKVKPR
Ga0210382_1013478623300021080Groundwater SedimentQIQRRLNAAGPFFPLLQPTQVFVSTKDLKNAFFNAQYQVDVTQVSPK
Ga0224452_123235223300022534Groundwater SedimentAVGPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK
Ga0222622_1071410313300022756Groundwater SedimentRLNQTGPYFPLIQPTQVFVSTTDLRNAVFNATYAVDVTQVSPK
Ga0207682_1008756523300025893Miscanthus RhizosphereAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA
Ga0207647_1005395343300025904Corn RhizosphereAAIYRSIQRLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA
Ga0207695_1125088813300025913Corn RhizosphereQQFQRQLNTSGPYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK
Ga0207693_1131412313300025915Corn, Switchgrass And Miscanthus RhizosphereRQLNASGPYFPLMQPTQVFVATSDLKNAVYNAVYSIDVTKVAPK
Ga0207659_1041053213300025926Miscanthus RhizosphereLLNQGGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA
Ga0207687_1194856323300025927Miscanthus RhizosphereNASGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK
Ga0207701_1123013913300025930Corn, Switchgrass And Miscanthus RhizospherePFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR
Ga0207644_1044501113300025931Switchgrass RhizosphereQLNASGPYFPLMQPTQVFVATSDLKNAVYNAVYSIDVTKVAPS
Ga0207690_1131390623300025932Corn RhizosphereYGPFFPLLQPTQVFVSTKDLATAKFNAVYSIDVTQTKPKG
Ga0207709_1120106323300025935Miscanthus RhizospherePYFPLMQPTQVFVATSDLKNAVYNAVYSVDVTKVAPK
Ga0207670_1050787023300025936Switchgrass RhizosphereTIQRRLNAYGPFFPLLQPTQVFVSTKDLATAKFNAVYSIDVTQTKPKG
Ga0207704_1073799813300025938Miscanthus RhizospherePFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA
Ga0207711_1131776023300025941Switchgrass RhizosphereFPLLQPTQVFVSTKDLATAKFNAVYSIDVTQTKPKG
Ga0207661_1017686133300025944Corn RhizosphereYFPLLQPAQVFVNTKDLSGAAFNAVYFVDITKVKPR
Ga0207661_1174739923300025944Corn RhizosphereNTSGPYFPLMQPTQVFVATSDLKNAVYNSVYSIDVTKVAPK
Ga0207679_1012320143300025945Corn RhizosphereQIGPYFPLLQPTQVFVNTRDLSGAAFNAVYFVDVTKVKPR
Ga0207667_1089599213300025949Corn RhizosphereKRTALFQQFQRQLNTSGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK
Ga0207651_1153207823300025960Switchgrass RhizosphereRQLNASGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK
Ga0207640_1106703423300025981Corn RhizosphereLNQVGPYFPLLQPAQVFVNTKDLSGAAFNAVYFVDITKVKPR
Ga0207658_1158712613300025986Switchgrass RhizosphereLYQTIQRRLNAAGPFFPLLQPTQVFVSTKDLKNAFFNAQYQVDVTQVAPR
Ga0207677_1139028413300026023Miscanthus RhizosphereQRQLNASGPYFPLMQPTQVFVSTSDLKNAVYNSVYSIDVTKVAPK
Ga0207648_1145535423300026089Miscanthus RhizospherePFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVAQVSPA
Ga0207698_1212371113300026142Corn RhizosphereNARGPYFPLMQPTQVFVATKDLVNAVYNATYSIDVTQVAPK
Ga0209377_130856013300026334SoilGPFIPLMQPTQVFVATSDLKNAVYNATYDVDVTAVSPK
Ga0209474_1071899813300026550SoilAKARESLYRQIQLQLNQRGPFFPLIQPTQVFVSTSDLKGATYNAEFLVDPLQVSPK
Ga0207454_10262223300026746SoilTSRASVRQTIYRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR
Ga0207605_10115823300026757SoilLLNQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA
Ga0209887_101123733300027561Groundwater SandPFVPLLQPTQVFVSTKDLKGAVFNAQYQVDVTQVSPK
Ga0209772_1028507623300027768Bog Forest SoilDLNQTGPFFPLIQPTQVFVSTADLKGAVYNAEYDTNITQISPA
Ga0247820_1128516213300028597SoilQAGPFFPLIQPTQVFVKTKDLRGAVYNSVYTVDVSQVSPA
Ga0307320_1041841323300028771SoilGPFFPLLQPGHGFVATKDLRNAFFNSQYELDVTQVSPK
Ga0307299_1025082323300028793SoilRGPYFPLIQPTQVFVSTTDLRNAVFNATYAVDVTQVSPK
Ga0265338_1071147013300028800RhizosphereGPYFPLIQPTQVFVSTADLKGAVYNAEYDVDVTQVSPK
Ga0307281_1000849313300028803SoilRRLNAAGPFFPLLQPTQVFVSTKDLKNAFFNAQYQVDVTQVSAK
Ga0307292_1035161923300028811SoilKARITTATKALQTIYRQIQRRLNAVGPFFPLLQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPK
Ga0307278_1011197413300028878SoilNAVGPYFPLVQPTQVFVSTKDLKNAVFNAQYQVDVTQVAPR
Ga0247826_1006510433300030336SoilRLNSVGPYFPLIQPTQVFVATTDLKNAVFHPVYQIDVTQVGAK
Ga0247826_1010714913300030336SoilIYRQIQRRLNAVGPFVPLLQPVQVFVSTRDLRGAVFNAQYQVDVTRVAPR
Ga0210278_111900123300030596SoilIYQQIQRLLNQSGPFYPLIQPTQVFVSTKDLRGAVYNAEYDVDVSQITPA
Ga0265462_1241063313300030738SoilRQGIYRAYQRLLNESGPYFPLIQPTQVFVSTKDLLGAVYNAEYDTNITQIAPA
Ga0307501_1010562423300031152SoilRLNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR
Ga0307497_1009719913300031226SoilNAVGPFFPLLQPTQVFVSTKDLKNAAFNAQYQVDVTRVAPR
Ga0307497_1069662123300031226SoilYGPFFPLLQPTQVFVATKDLSVAKFNAVYSIDVTQTKP
Ga0302325_1249242623300031234PalsaSGPYFPLIQPTQVFVSTKDLKGAAYSAEYDTNITQISPA
Ga0318516_1071800523300031543SoilKREALYQQFQRDLNTSGPYFPLIQPTQVFVATSDMRNAVYNAVYSVDVTQVSPK
Ga0318555_1044296023300031640SoilRQKLYQQFQIALNQRGPYFPLIQPTQVFVSTTDLKNAVYNAVTLLDITQVAPK
Ga0307374_1037941923300031670SoilYFPLIQPTQVFVSTKDLNGAVYNAEYDVDVTQISPR
Ga0307374_1065233413300031670SoilGPYYPLIQPTQVFVSTKDLKGAVYNAEFDVDVTQISPA
Ga0318561_1081042823300031679SoilLNGPFYPLIQPTQVFVSTKDLRNAFYNAVYQVDVTAVSPA
Ga0318574_1006392833300031680SoilKSLYQAYQRELNQRGPYFPLIQPTQVFVSTSDLNGAVYNATYSIDVTQVSPK
Ga0265314_1070479723300031711RhizosphereAARKSLYQQIQLQLNARGPYFPLMQPTQVFVSTSDLKNAVYNSEYDVDVTQISPK
Ga0265342_1018115323300031712RhizospherePAARKSLYQQIQTDLNQQGPYFPLIQPTQVFVSTADLKGAVYNAEYDVDVTQVSPK
Ga0306917_1103401923300031719SoilNQRGPYFPLIQPTQVFVSTSDLNGAVYNATYSIDVTQVSPK
Ga0307469_1167794623300031720Hardwood Forest SoilYRQIQRRLNTVGPFIPLMQPVQVFVSTKDLKNAVFNAQYQVDVTQVAPR
Ga0307405_1116070123300031731RhizosphereQVGPYFPLIQPTQVFVNTKDLSGAAFNAVYFVDITKVKPR
Ga0318546_1130527313300031771SoilVTTAPASRAVVYRSIQRLLNQGSPFFPLIQPTQVFVSTKDLRGAVFNAVYTVDTRQVSPA
Ga0318523_1030759223300031798SoilPYFPLIQPTQVFVSTSDLNGAVYNATYSIDVTQVSPK
Ga0318565_1046356523300031799SoilPFFPLIQPTQVFVATKDLRGAVYNSVYTVDVSQVSPA
Ga0318567_1068497623300031821SoilTTQPAARAVVYRSIQRLLNLNGPFYPLIQPTQVFVSTKDLRNAFYNAVYQVDVTAVSPA
Ga0315290_1029018613300031834SedimentDSAREKIYQTIQKRLNAYGPFFPLLQPTQVFVATNDFANAKFNAVYSIDVTQTKPKG
Ga0310916_1152909713300031942SoilSLYQAYQRELNQRGPYFPLIQPTQVFVSTSDLNGAVYNATYSIDVTQVSPK
Ga0310909_1124268913300031947SoilELNQRGPYFPLIQPTQVFVSTSDLNGAVYNATYSIDVTQVSPK
Ga0306922_1215470223300032001SoilPFFPLIQPTQVFVSTKDLRGAVYNSVYTVDVSQVSPA
Ga0310897_1001327243300032003SoilGPYFPLMQPTQVFVTTKDLSGAAFNAVYFVDVTKVKPR
Ga0318558_1063462923300032044SoilIQRLLNQSGPFFPLIQPTQVFVSTKDLRGAVYNSVYTVDVSQVRPA
Ga0318524_1060936213300032067SoilYQQYQRELNQRGPYFPLIQPTQVFVATSDLNNAVYNATYSVDVTQVSPK
Ga0311301_1204134023300032160Peatlands SoilSGPYFPLMQPTQVFVATSDLKSAVYNAEYDVDVTQVSPK
Ga0307471_10056731723300032180Hardwood Forest SoilRSIQRLLNQSGPFFPLIQPTQVFVATKDLRGAVYNSVYTVDTLQVSPA
Ga0335082_1105176013300032782SoilQIQNQLNARGPFFPLMQPTQVFVSTSDLSNAVYNATYSIDVTQVSPK
Ga0335080_1064964913300032828SoilLNLNGPFYPLIQPTQVFVSTKDLKNAVYNSVYDVDVTQVSPAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.