Metagenome Family F030258

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F030258
Family Type	Metagenome
Number of Sequences	186
Average Sequence Length	36 residues
Representative Sequence	MIEFLAQMPTDTKIFLTMAVLGLAAMLIALRRLI
Number of Associated Samples	91
Number of Associated Scaffolds	186

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	45.95 %
% of genes near scaffold ends (potentially truncated)	24.19 %
% of genes from short scaffolds (< 2000 bps)	83.87 %
Associated GOLD sequencing projects	86
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (53.763 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (23.656 % of family members)
Environment Ontology (ENVO)	Unclassified (51.075 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (72.043 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.77% β-sheet: 0.00% Coil/Unstructured: 53.23%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 186 Family Scaffolds
PF04392	ABC_sub_bind	3.23
PF04862	DUF642	1.08
PF06411	HdeA	1.08
PF00805	Pentapeptide	1.08
PF13586	DDE_Tnp_1_2	1.08
PF00589	Phage_integrase	1.08
PF00239	Resolvase	1.08
PF01381	HTH_3	1.08
PF01068	DNA_ligase_A_M	1.08
PF03401	TctC	0.54
PF13458	Peripla_BP_6	0.54
PF13276	HTH_21	0.54
PF03781	FGE-sulfatase	0.54
PF01402	RHH_1	0.54
PF13565	HTH_32	0.54
PF13701	DDE_Tnp_1_4	0.54
PF00872	Transposase_mut	0.54
PF01471	PG_binding_1	0.54
PF00355	Rieske	0.54
PF00144	Beta-lactamase	0.54
PF00183	HSP90	0.54
PF13650	Asp_protease_2	0.54
PF13560	HTH_31	0.54
PF13181	TPR_8	0.54
PF00498	FHA	0.54
PF14534	DUF4440	0.54
PF13683	rve_3	0.54
PF12172	DUF35_N	0.54
PF13676	TIR_2	0.54
PF07813	LTXXQ	0.54
PF07508	Recombinase	0.54
PF17200	sCache_2	0.54

COG ID	Name	Functional Category	% Frequency in 186 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	3.23
COG3678	Periplasmic chaperone Spy, Spy/CpxP family	Posttranslational modification, protein turnover, chaperones [O]	2.15
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	1.61
COG1357	Uncharacterized conserved protein YjbI, contains pentapeptide repeats	Function unknown [S]	1.08
COG1423	ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family	Replication, recombination and repair [L]	1.08
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	1.08
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	1.08
COG0326	Molecular chaperone, HSP90 family	Posttranslational modification, protein turnover, chaperones [O]	0.54
COG1262	Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain	Posttranslational modification, protein turnover, chaperones [O]	0.54
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.54
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.54
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.54
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.54
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.54

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
All Organisms	root	All Organisms	46.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
cellular organisms	root	All Organisms → cellular organisms	46.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	46.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	34.41 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	3.76 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	2.15 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	30.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	3.76 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	2.15 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.15 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	17.20 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6.99 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	3.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.15 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	1.61 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.08 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.54 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.54 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	16.13 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3.76 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	3.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.15 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	1.61 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.08 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.54 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.54 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.54 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.54 %
Methylocystaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	0.54 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	16.13 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.76 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	3.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.15 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	1.61 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.08 %
unclassified Beijerinckiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae	0.54 %
Rudaea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea	0.54 %
Hapalosiphonaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae	0.54 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.54 %
Tistrella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Tistrella	0.54 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	16.13 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	3.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.15 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	1.61 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.08 %
Beijerinckiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	0.54 %
Methylocystis bryophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis bryophila	0.54 %
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	0.54 %
Tistrella mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Tistrella → Tistrella mobilis	0.54 %
Fischerella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella	0.54 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.54 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	16.13 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	3.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.15 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	1.61 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.08 %
unclassified Fischerella	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → unclassified Fischerella	0.54 %
Bradyrhizobium sp. UFLA03-84	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. UFLA03-84	0.54 %
Beijerinckiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	0.54 %
Methylocystis bryophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis bryophila	0.54 %
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	0.54 %
Tistrella mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Tistrella → Tistrella mobilis	0.54 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	16.13 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	3.76 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.15 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	1.61 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.08 %
Fischerella sp. PCC 9605	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → unclassified Fischerella → Fischerella sp. PCC 9605	0.54 %
Bradyrhizobium sp. UFLA03-84	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. UFLA03-84	0.54 %
Beijerinckiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	0.54 %
Methylocystis bryophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis bryophila	0.54 %
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	0.54 %
Tistrella mobilis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Tistrella → Tistrella mobilis	0.54 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.54 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090014\|GPIPI_17176495	Not Available	2032	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100332853	Not Available	904	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1003395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2580	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10001937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5412	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10027166	Not Available	1554	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10029435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1487	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10167776	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → unclassified Fischerella → Fischerella sp. PCC 9605	523	Open in IMG/M
3300000651\|AP72_2010_repI_A10DRAFT_1008584	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1356	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1062903	Not Available	657	Open in IMG/M
3300001867\|JGI12627J18819_10049944	Not Available	1746	Open in IMG/M
3300005332\|Ga0066388_101906015	Not Available	1061	Open in IMG/M
3300005332\|Ga0066388_104760979	Not Available	690	Open in IMG/M
3300005332\|Ga0066388_105588264	Not Available	637	Open in IMG/M
3300005467\|Ga0070706_101672718	Not Available	580	Open in IMG/M
3300005543\|Ga0070672_101788579	Not Available	552	Open in IMG/M
3300005552\|Ga0066701_10063736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2068	Open in IMG/M
3300005553\|Ga0066695_10860632	Not Available	519	Open in IMG/M
3300005556\|Ga0066707_10415245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	875	Open in IMG/M
3300005576\|Ga0066708_10788740	Not Available	597	Open in IMG/M
3300005713\|Ga0066905_100296069	Not Available	1268	Open in IMG/M
3300005713\|Ga0066905_100311340	All Organisms → cellular organisms → Bacteria	1241	Open in IMG/M
3300005713\|Ga0066905_100318506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1229	Open in IMG/M
3300005713\|Ga0066905_100385654	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1131	Open in IMG/M
3300005713\|Ga0066905_100494788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1015	Open in IMG/M
3300005713\|Ga0066905_100600214	Not Available	932	Open in IMG/M
3300005713\|Ga0066905_100783954	Not Available	825	Open in IMG/M
3300005713\|Ga0066905_101017931	Not Available	731	Open in IMG/M
3300005713\|Ga0066905_101276368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	660	Open in IMG/M
3300005713\|Ga0066905_101994198	Not Available	538	Open in IMG/M
3300005764\|Ga0066903_100274871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2633	Open in IMG/M
3300005764\|Ga0066903_100389995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2283	Open in IMG/M
3300005764\|Ga0066903_100449500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2152	Open in IMG/M
3300005764\|Ga0066903_100482646	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2090	Open in IMG/M
3300005764\|Ga0066903_100549831	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1979	Open in IMG/M
3300005764\|Ga0066903_100988412	All Organisms → cellular organisms → Bacteria	1536	Open in IMG/M
3300005764\|Ga0066903_101620736	Not Available	1228	Open in IMG/M
3300005764\|Ga0066903_101634588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	1223	Open in IMG/M
3300005764\|Ga0066903_101821579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1163	Open in IMG/M
3300005764\|Ga0066903_102354648	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	1029	Open in IMG/M
3300005764\|Ga0066903_102576783	Not Available	985	Open in IMG/M
3300005764\|Ga0066903_102632128	Not Available	975	Open in IMG/M
3300005764\|Ga0066903_102745483	All Organisms → cellular organisms → Bacteria → Proteobacteria	955	Open in IMG/M
3300005764\|Ga0066903_103103011	Not Available	899	Open in IMG/M
3300005764\|Ga0066903_103703284	Not Available	822	Open in IMG/M
3300005764\|Ga0066903_103837203	Not Available	807	Open in IMG/M
3300005764\|Ga0066903_105272482	Not Available	683	Open in IMG/M
3300005764\|Ga0066903_105643042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	658	Open in IMG/M
3300005764\|Ga0066903_105884497	Not Available	643	Open in IMG/M
3300005764\|Ga0066903_106282860	Not Available	620	Open in IMG/M
3300005764\|Ga0066903_106554165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	606	Open in IMG/M
3300005764\|Ga0066903_106573921	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	605	Open in IMG/M
3300005764\|Ga0066903_106794771	Not Available	594	Open in IMG/M
3300005764\|Ga0066903_106944815	Not Available	587	Open in IMG/M
3300005764\|Ga0066903_107676004	Not Available	555	Open in IMG/M
3300006028\|Ga0070717_10038543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3885	Open in IMG/M
3300006028\|Ga0070717_10040014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3817	Open in IMG/M
3300006028\|Ga0070717_10043302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3674	Open in IMG/M
3300006028\|Ga0070717_10068770	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	2948	Open in IMG/M
3300006028\|Ga0070717_10118714	All Organisms → cellular organisms → Bacteria	2263	Open in IMG/M
3300006028\|Ga0070717_11681700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	574	Open in IMG/M
3300006032\|Ga0066696_10557134	Not Available	748	Open in IMG/M
3300006046\|Ga0066652_100265090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1510	Open in IMG/M
3300006163\|Ga0070715_10897935	Not Available	545	Open in IMG/M
3300006173\|Ga0070716_100178935	Not Available	1390	Open in IMG/M
3300006175\|Ga0070712_100109807	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2056	Open in IMG/M
3300006175\|Ga0070712_100232234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1465	Open in IMG/M
3300006175\|Ga0070712_100334712	All Organisms → cellular organisms → Bacteria	1234	Open in IMG/M
3300006175\|Ga0070712_100489606	All Organisms → cellular organisms → Bacteria	1029	Open in IMG/M
3300006175\|Ga0070712_100503528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1015	Open in IMG/M
3300006794\|Ga0066658_10043164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1902	Open in IMG/M
3300006796\|Ga0066665_10242101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1423	Open in IMG/M
3300006797\|Ga0066659_10082133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2142	Open in IMG/M
3300006797\|Ga0066659_11003937	Not Available	697	Open in IMG/M
3300006800\|Ga0066660_11481093	Not Available	534	Open in IMG/M
3300006845\|Ga0075421_102758127	Not Available	507	Open in IMG/M
3300006854\|Ga0075425_101244597	Not Available	845	Open in IMG/M
3300006904\|Ga0075424_100138545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2576	Open in IMG/M
3300006904\|Ga0075424_101181454	Not Available	815	Open in IMG/M
3300006904\|Ga0075424_101429067	All Organisms → cellular organisms → Bacteria	735	Open in IMG/M
3300006954\|Ga0079219_11022770	Not Available	689	Open in IMG/M
3300007076\|Ga0075435_100196891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1706	Open in IMG/M
3300007076\|Ga0075435_100695689	Not Available	883	Open in IMG/M
3300009137\|Ga0066709_100194369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2657	Open in IMG/M
3300009147\|Ga0114129_12954120	Not Available	560	Open in IMG/M
3300009792\|Ga0126374_10581025	Not Available	823	Open in IMG/M
3300010043\|Ga0126380_11461345	Not Available	603	Open in IMG/M
3300010043\|Ga0126380_12025899	Not Available	527	Open in IMG/M
3300010046\|Ga0126384_10225752	Not Available	1499	Open in IMG/M
3300010048\|Ga0126373_10311376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1574	Open in IMG/M
3300010048\|Ga0126373_10848006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	977	Open in IMG/M
3300010048\|Ga0126373_11719369	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	691	Open in IMG/M
3300010048\|Ga0126373_12127706	Not Available	623	Open in IMG/M
3300010336\|Ga0134071_10212857	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Tistrella → Tistrella mobilis	955	Open in IMG/M
3300010358\|Ga0126370_10110585	Not Available	1924	Open in IMG/M
3300010358\|Ga0126370_10450709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1073	Open in IMG/M
3300010358\|Ga0126370_10745596	Not Available	866	Open in IMG/M
3300010358\|Ga0126370_10966100	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	775	Open in IMG/M
3300010361\|Ga0126378_10313284	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1674	Open in IMG/M
3300010361\|Ga0126378_10695842	Not Available	1128	Open in IMG/M
3300010361\|Ga0126378_11117190	Not Available	889	Open in IMG/M
3300010361\|Ga0126378_11347905	Not Available	807	Open in IMG/M
3300010362\|Ga0126377_12381994	Not Available	605	Open in IMG/M
3300010366\|Ga0126379_10033028	All Organisms → cellular organisms → Bacteria → Proteobacteria	4071	Open in IMG/M
3300010366\|Ga0126379_10875342	Not Available	1000	Open in IMG/M
3300010366\|Ga0126379_11088263	Not Available	905	Open in IMG/M
3300010366\|Ga0126379_11756852	Not Available	725	Open in IMG/M
3300010366\|Ga0126379_13210714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	547	Open in IMG/M
3300010366\|Ga0126379_13315894	Not Available	539	Open in IMG/M
3300010366\|Ga0126379_13690998	Not Available	513	Open in IMG/M
3300010376\|Ga0126381_103047113	Not Available	665	Open in IMG/M
3300010376\|Ga0126381_103166418	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	651	Open in IMG/M
3300010376\|Ga0126381_103383688	Not Available	628	Open in IMG/M
3300010398\|Ga0126383_10428339	Not Available	1367	Open in IMG/M
3300010398\|Ga0126383_10681814	Not Available	1105	Open in IMG/M
3300010398\|Ga0126383_11024060	Not Available	914	Open in IMG/M
3300010398\|Ga0126383_11122852	Not Available	876	Open in IMG/M
3300010398\|Ga0126383_11749003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	710	Open in IMG/M
3300010398\|Ga0126383_13143028	Not Available	539	Open in IMG/M
3300010399\|Ga0134127_13580401	Not Available	509	Open in IMG/M
3300010863\|Ga0124850_1005918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3839	Open in IMG/M
3300010863\|Ga0124850_1008607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	3231	Open in IMG/M
3300012198\|Ga0137364_11069608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	608	Open in IMG/M
3300012199\|Ga0137383_10794108	Not Available	691	Open in IMG/M
3300012201\|Ga0137365_10092134	All Organisms → cellular organisms → Bacteria	2282	Open in IMG/M
3300012205\|Ga0137362_10455838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1107	Open in IMG/M
3300012205\|Ga0137362_11662089	Not Available	525	Open in IMG/M
3300012206\|Ga0137380_10879418	Not Available	770	Open in IMG/M
3300012210\|Ga0137378_10694003	Not Available	929	Open in IMG/M
3300012353\|Ga0137367_10198274	Not Available	1455	Open in IMG/M
3300012356\|Ga0137371_10235924	All Organisms → cellular organisms → Bacteria	1429	Open in IMG/M
3300012362\|Ga0137361_11775201	Not Available	535	Open in IMG/M
3300012582\|Ga0137358_10024668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3898	Open in IMG/M
3300012582\|Ga0137358_10254921	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1194	Open in IMG/M
3300012917\|Ga0137395_11038447	Not Available	585	Open in IMG/M
3300012948\|Ga0126375_10007785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. UFLA03-84	4296	Open in IMG/M
3300012948\|Ga0126375_10074112	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis bryophila	1922	Open in IMG/M
3300012948\|Ga0126375_10616070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	831	Open in IMG/M
3300012948\|Ga0126375_11623144	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	558	Open in IMG/M
3300012957\|Ga0164303_10813940	Not Available	644	Open in IMG/M
3300012958\|Ga0164299_11034916	Not Available	608	Open in IMG/M
3300012958\|Ga0164299_11315121	Not Available	554	Open in IMG/M
3300012971\|Ga0126369_10297164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1614	Open in IMG/M
3300012971\|Ga0126369_10503472	Not Available	1269	Open in IMG/M
3300012971\|Ga0126369_12106538	Not Available	652	Open in IMG/M
3300012971\|Ga0126369_12594499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	591	Open in IMG/M
3300012971\|Ga0126369_12967073	Not Available	555	Open in IMG/M
3300012971\|Ga0126369_13687932	Not Available	502	Open in IMG/M
3300012984\|Ga0164309_11861857	Not Available	516	Open in IMG/M
3300012986\|Ga0164304_10301751	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1098	Open in IMG/M
3300015373\|Ga0132257_102032931	Not Available	741	Open in IMG/M
3300015373\|Ga0132257_104054323	Not Available	533	Open in IMG/M
3300016371\|Ga0182034_10205024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1527	Open in IMG/M
3300016371\|Ga0182034_10484190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1029	Open in IMG/M
3300016387\|Ga0182040_10307971	Not Available	1214	Open in IMG/M
3300016422\|Ga0182039_10584154	Not Available	975	Open in IMG/M
3300016445\|Ga0182038_10210852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1536	Open in IMG/M
3300016445\|Ga0182038_10476837	Not Available	1060	Open in IMG/M
3300016445\|Ga0182038_11611683	Not Available	584	Open in IMG/M
3300021432\|Ga0210384_10187922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1857	Open in IMG/M
3300021475\|Ga0210392_11050321	Not Available	610	Open in IMG/M
3300021560\|Ga0126371_11192252	Not Available	898	Open in IMG/M
3300025898\|Ga0207692_10645062	Not Available	684	Open in IMG/M
3300025910\|Ga0207684_10035577	All Organisms → cellular organisms → Bacteria	4228	Open in IMG/M
3300026304\|Ga0209240_1251690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	540	Open in IMG/M
3300026547\|Ga0209156_10200675	Not Available	950	Open in IMG/M
3300027527\|Ga0209684_1009679	Not Available	1548	Open in IMG/M
3300031771\|Ga0318546_11162797	Not Available	542	Open in IMG/M
3300031792\|Ga0318529_10362015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	675	Open in IMG/M
3300031880\|Ga0318544_10164730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	852	Open in IMG/M
3300031890\|Ga0306925_10097371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3128	Open in IMG/M
3300031890\|Ga0306925_10659309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1099	Open in IMG/M
3300031894\|Ga0318522_10243886	Not Available	681	Open in IMG/M
3300031897\|Ga0318520_11107498	Not Available	502	Open in IMG/M
3300031910\|Ga0306923_10169514	All Organisms → cellular organisms → Bacteria	2493	Open in IMG/M
3300031910\|Ga0306923_10212223	Not Available	2214	Open in IMG/M
3300031910\|Ga0306923_10614809	Not Available	1218	Open in IMG/M
3300031912\|Ga0306921_10180785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2472	Open in IMG/M
3300031946\|Ga0310910_10619861	Not Available	857	Open in IMG/M
3300031947\|Ga0310909_10062789	All Organisms → cellular organisms → Bacteria → Proteobacteria	2893	Open in IMG/M
3300032025\|Ga0318507_10275324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	731	Open in IMG/M
3300032063\|Ga0318504_10473167	Not Available	599	Open in IMG/M
3300032205\|Ga0307472_100817864	Not Available	853	Open in IMG/M
3300032205\|Ga0307472_101322304	Not Available	695	Open in IMG/M
3300032261\|Ga0306920_102429393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	723	Open in IMG/M
3300033290\|Ga0318519_10099956	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1559	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	94.09%
Host-Associated	Host-Associated	5.91%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	94.09%
Plants	Host-Associated → Plants	5.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	94.09%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.84%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.08%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	62.90%
Loam	Environmental → Terrestrial → Soil → Loam	31.18%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.30%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.08%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.54%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.41%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	22.58%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	19.35%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.60%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.30%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.08%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.54%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	23.66%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	22.04%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	8.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.06%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.53%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.99%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.45%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.30%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	3.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.69%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.08%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.08%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.08%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.54%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.54%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.54%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.54%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000580	Forest soil microbial communities from Amazon forest - 2010 replicate II A01	Environmental	Open in IMG/M
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental	Open in IMG/M
3300000651	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10	Environmental	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010863	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300026547	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)	Environmental	Open in IMG/M
3300027527	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)	Environmental	Open in IMG/M
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental	Open in IMG/M
3300031792	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23	Environmental	Open in IMG/M
3300031880	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031894	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032025	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20	Environmental	Open in IMG/M
3300032063	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_00653950	2088090014	Soil	GEVIEFLAQMPTDTKIFLTMAVLGLAAMLIALRWLI
INPhiseqgaiiFebDRAFT_1003328533	3300000364	Soil	MLREMFEFLATMPTETKIFLTMAVLGLAVTLIVLRSLL*
AF_2010_repII_A01DRAFT_10033951	3300000580	Forest Soil	MIEFLAHMPTDTMIFLTMAVLGLATMLIVLRRRI*
AF_2010_repII_A1DRAFT_100019378	3300000597	Forest Soil	MIDFVAQMPTDTKIFLAMAVLGLAATLIALRWLI*
AF_2010_repII_A1DRAFT_100271662	3300000597	Forest Soil	MIEFLAQIPTDTMIFLIMAVLGLAATLIMLRRQT*
AF_2010_repII_A1DRAFT_100294352	3300000597	Forest Soil	MMEFLAQIPTDTMIFLIMAVLGLAATLIVLRRQT*
AF_2010_repII_A1DRAFT_101677761	3300000597	Forest Soil	EMIEFLAQMPTDTMVLTMAFLSLAAMLIVLRRLI*
AP72_2010_repI_A10DRAFT_10085841	3300000651	Forest Soil	MIESLAQMPTDTMIFLTMAVLGLAVMLIVLSRLI*
AF_2010_repII_A100DRAFT_10629031	3300000655	Forest Soil	MEEREMIEFLAQNPTYTVMFLTMAVLSLAGILVVVLRQ*
JGI12627J18819_100499442	3300001867	Forest Soil	MLREMIQFLAQMPTDTKIFLTMAVLGLAATLLAVRWLM*
Ga0066388_1019060152	3300005332	Tropical Forest Soil	MTKLREMIEFVTQMPTDTKIFLTMTVLSLATVLIVLRWLI*
Ga0066388_1047609792	3300005332	Tropical Forest Soil	MTKLREMIEFVAQMPTDTKIFLAMAALGLAAVLIVLRWLI*
Ga0066388_1055882642	3300005332	Tropical Forest Soil	MLWETVQFLAQMPTETKIFLVMAVLCLAGTLIVLMYSRM*
Ga0070706_1016727182	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MTKLREMIEFLAQMPTDAKIFLTMAVLSLAIVLITLRWLI*
Ga0070672_1017885791	3300005543	Miscanthus Rhizosphere	MLREMIQFLAQMPVESKIFLTMAVLGLAATLLAVRWLI*
Ga0066701_100637361	3300005552	Soil	MIEFLAQMPTDTMIFLTTAVLGLAVMLIVLRRLI*
Ga0066695_108606321	3300005553	Soil	MIEFLAQMPTDTMIFITTVFLGLAATLIGLKWLI*
Ga0066707_104152451	3300005556	Soil	MTEFLTHMPTNTVIFITMAVLALAATLIVLRRLI*
Ga0066708_107887402	3300005576	Soil	MIEFLTEMPTATKIFLIVAVLGLAATLIVLKWVK*
Ga0066905_1002960692	3300005713	Tropical Forest Soil	MIQFLAQMLTDTKIFLTMAVLGLAAMLIVLRRLI*
Ga0066905_1003113401	3300005713	Tropical Forest Soil	MLREMIQFLAQMPTDTKIFLTVAVLGLAATLIALKWLI*
Ga0066905_1003185062	3300005713	Tropical Forest Soil	MIEFLVQMPTDTKIFLAMAVLGLAAVLIVLRWVI*
Ga0066905_1003856542	3300005713	Tropical Forest Soil	MIQFLAQMPTDTKIFLAMAVLGLAAVLIVLRWVI*
Ga0066905_1004947882	3300005713	Tropical Forest Soil	MIEFLSQMPTDEKIFLTMVVLGLAAMLIALRRVI*
Ga0066905_1006002142	3300005713	Tropical Forest Soil	MIEMIEFLAQMPTDTMIFLTVAVLSLAATLIVLTRLI*
Ga0066905_1007839542	3300005713	Tropical Forest Soil	MTKLREMIEFLAQMPTDAKIFLSMAVLSLATVLIALRWLI*
Ga0066905_1010179312	3300005713	Tropical Forest Soil	MIEFLSQMPTDAKIFLTIAVLGLATMVIVLRRLI*
Ga0066905_1012763682	3300005713	Tropical Forest Soil	MIEFLAQMPTDTMIFLAMAVLGLAALLIVLRRVI*
Ga0066905_1019941982	3300005713	Tropical Forest Soil	MIEFLAQMPTDTMIFLTMAVLGLAAMLIVLRRQT*
Ga0066903_1002748715	3300005764	Tropical Forest Soil	MIEFLSQMPTDQKVFLTMVVLGVVATLIVLRRQI*
Ga0066903_1003899951	3300005764	Tropical Forest Soil	VIDFLAQMPTDEKIFLAMAVLGLATMLIVLRGLI*
Ga0066903_1004495004	3300005764	Tropical Forest Soil	MIEFLAQMPTDTKIFLTMAVLALAAMVIALSRLI*
Ga0066903_1004826465	3300005764	Tropical Forest Soil	MIEFLSQMPTDEKIFLAIAVLGLAATLIVLRWLI*
Ga0066903_1005498316	3300005764	Tropical Forest Soil	MIEFLAQMPSDTMIFITTVFLGLAATLIGLKWLI*
Ga0066903_1009884124	3300005764	Tropical Forest Soil	MIEFLAQMPTDTMILLTMAVLGLATMLIVLRRQI*
Ga0066903_1016207361	3300005764	Tropical Forest Soil	MIEFLTQIPTATMIFLTMAVLSLAASLIVLTRLN*
Ga0066903_1016345882	3300005764	Tropical Forest Soil	MIEFLAQMPIDTKIFLTMAVLGLAAVPIVLRWVI*
Ga0066903_1018215793	3300005764	Tropical Forest Soil	MIEFLAQMPTDTMIFLIMAVLGLAATLIVLGRQT*
Ga0066903_1023546482	3300005764	Tropical Forest Soil	RMIQFLAQMPTDTKIFLAMAVLGLAAVLIVLRWVI*
Ga0066903_1025767832	3300005764	Tropical Forest Soil	MIEFLAQIPTDTMIFLIMAVLGLAATLIVLRRQT*
Ga0066903_1026321282	3300005764	Tropical Forest Soil	MIEFLAQMPTDTKIFLTMAVLSLTAILIVLTRQI*
Ga0066903_1027454832	3300005764	Tropical Forest Soil	MIEFLAQMPSDTMIFITTAVLALAATLIGLKWLI*
Ga0066903_1031030112	3300005764	Tropical Forest Soil	MVEFLAHMPTDTMIFLTMAVLGLATMLIVLRRLI*
Ga0066903_1037032842	3300005764	Tropical Forest Soil	MLQEMTDFLTNMPAKTVIFITMAVLGLAAMLIVLRGLI*
Ga0066903_1038372032	3300005764	Tropical Forest Soil	MIEFLAQMPTDTMIFLTMAVLSLAATLMVLTRLI*
Ga0066903_1052724822	3300005764	Tropical Forest Soil	MASMGLNVMIEFLAQMPTDTMIFLAMAVLSLAATLIVLTRLI*
Ga0066903_1056430422	3300005764	Tropical Forest Soil	LREMIEFLAQMPTDAKIFLSMAVLSLVATLIALRWLI*
Ga0066903_1058844971	3300005764	Tropical Forest Soil	MIEFLAQMPTDTKIFLAIAVFGLAATLIALRRLI*
Ga0066903_1062828601	3300005764	Tropical Forest Soil	MIEFLAKMPTHTMIFLTMAVLSLAATLIVLTRLN*
Ga0066903_1065541652	3300005764	Tropical Forest Soil	MIEFLTNMPASTVIFLTMAVLGLAAMLIVLKWLI*
Ga0066903_1065739211	3300005764	Tropical Forest Soil	MIEFLAQMPTDTKIFLAIAVLGLAATLIVLRWLI*
Ga0066903_1067947711	3300005764	Tropical Forest Soil	MIDFLATMPTNTKIFLTMAVLGLMASLIVLRGLI*
Ga0066903_1069448151	3300005764	Tropical Forest Soil	MTKLREMIEFLAQMPTDAKIFLSMAVLSLVATLIA
Ga0066903_1076760042	3300005764	Tropical Forest Soil	MIEFLAQMPTGTMIFLTMAVLSLAATLIVLTRLN*
Ga0070717_100385439	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MLREMIQFLAQMPTDTQMFLAMAALGLAATLMVLKWLI*
Ga0070717_100400146	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MLREMIQFLAQMPGDTKIFLTLAVLGLAATLLAVRWLI*
Ga0070717_100433023	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIEFLTHMPADTVIFITMAVLGLAGMLIMLRRLI*
Ga0070717_100687703	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIEFLTHMPTDTKIFITMAVLGLAGTLRVLTDIAK*
Ga0070717_101187142	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIEFLAQMPTDTKIFLTMAVLGLAAMLIALRRLI*
Ga0070717_116817002	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MLREMIQFLAQMPVESKIFLTMAVLGLAATLLAVR*
Ga0066696_105571342	3300006032	Soil	MIEFLTEMPTATKIFFIVAVLGLAATLIVLKWVK*
Ga0066652_1002650903	3300006046	Soil	MKSIIEFVAQMPTDTKIFLAMAVLGLAATLLVLRSLI*
Ga0070715_108979351	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MRSIIEFVAQMPTDTKIFLAMAVLGLAATLLVLRWLI*
Ga0070716_1001789353	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MIEFLTEMPTNTKIFLIVAVLGLAATLIVLKWLK*
Ga0070712_1001098071	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MTEFLTHMPANTVIFITMAVLGLVGMLIVLRRLI*
Ga0070712_1002322342	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MIDFLTHMPANTVIFITMAVLGMVGVLIMLRRLI*
Ga0070712_1003347121	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	REMIQFLAQMPTDTKIFLTMAVLGLAATLLAVRWLM*
Ga0070712_1004896062	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MIEFLAQMPSETMIFITTALLGLGATLIGLKWLI*
Ga0070712_1005035281	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MLREMIQFLAEMPADTKIFLTMAVLGLAATLILLKWLI*
Ga0066658_100431644	3300006794	Soil	MTEFLTNMPTDTKIFITMAVLALAATLIVLRRLI*
Ga0066665_102421012	3300006796	Soil	MTEFLAQMPTDTMIFITTVFLGLAATLIGLKWLI*
Ga0066659_100821334	3300006797	Soil	MIEFLAQMPTDTMIFITMVFLGLAATLIGLKWLI*
Ga0066659_110039372	3300006797	Soil	MTKLREMIEFVAQMPTDAKIFLTMAVLSLATVLIALRWLV*
Ga0066660_114810932	3300006800	Soil	MLREIIEFLAQMPTGTKIILTMAVLGLAATLLVLKRLI*
Ga0075421_1027581271	3300006845	Populus Rhizosphere	PRRGEMIEFLAQMPSETMIFITTALLGLGATLLGVKWLI*
Ga0075425_1012445971	3300006854	Populus Rhizosphere	MLREMIKFLAQMPGDTKIFLTLAVLGLAATLLAVRWLI*
Ga0075424_1001385453	3300006904	Populus Rhizosphere	MTEFLTYMPTDTKLFLTMAVLGLAAMLIVLRRLI*
Ga0075424_1011814542	3300006904	Populus Rhizosphere	MIEFLAQMPSDTMIFITTAVLGLAATLIGLKWLI*
Ga0075424_1014290672	3300006904	Populus Rhizosphere	EMIDFLTHMPANTVIFITMAVLGLVGMLILLRRLI*
Ga0079219_110227702	3300006954	Agricultural Soil	MIEFLTMMPTATKIFLIVAFLGLAATLIVLKWLK*
Ga0075435_1001968915	3300007076	Populus Rhizosphere	MIEFLAQMPSETMIFITTALLGLGATLLGVKWLI*
Ga0075435_1006956892	3300007076	Populus Rhizosphere	MIEFLAQMPTDTKIFLTMAVLGLAAMLIALDALIGPH*
Ga0066709_1001943696	3300009137	Grasslands Soil	MFREMIQFLSQMPTETKIFITTAVLGLAATLIGLKWLI*
Ga0114129_129541201	3300009147	Populus Rhizosphere	MIEFLTEMPTATKIFLIVAVLGLAATLIVLRRLI*
Ga0126374_105810251	3300009792	Tropical Forest Soil	HCRRWSEMVDFLAQMATDTKIFITMAVLGLAGTLIVLRRLI*
Ga0126380_114613452	3300010043	Tropical Forest Soil	MIEFLAQMPTDTKIFLTMAILGLATTLIVLRWLI*
Ga0126380_120258991	3300010043	Tropical Forest Soil	MIDFVAQMPTNTKILLAIAVLSLAATLIALKWLI*
Ga0126384_102257521	3300010046	Tropical Forest Soil	MIEFLTQMPTDTMISLTMPVLGLATVLIVLPKTF*
Ga0126373_103113763	3300010048	Tropical Forest Soil	TRMIEFLAQMPTDTKIFLAMAVLGLAAVLMVLRWVI*
Ga0126373_108480062	3300010048	Tropical Forest Soil	MIEFLAQMPTDTMIFLAMAVLGLAAMLIVLSTRYTA*
Ga0126373_117193692	3300010048	Tropical Forest Soil	MLAMIEFLSQMPTDTKIFLAMAVLGLAALLIVLRRVI*
Ga0126373_121277061	3300010048	Tropical Forest Soil	MIDFVAQMPTDTKIFLAMAVLGLAAVLIVLRWVI*
Ga0134071_102128573	3300010336	Grasslands Soil	MIEFLAQMPTDTMIFITTVFLGLAATLIVLRRLI*
Ga0126370_101105852	3300010358	Tropical Forest Soil	MIEFLAQMPTDTMVFLAMVVLGLAALLIVLRRLI*
Ga0126370_104507091	3300010358	Tropical Forest Soil	MIEFLSQMPTDTMLLLATAVLGFAALLIVLKWMV*
Ga0126370_107455962	3300010358	Tropical Forest Soil	MIEFLSQMPTDTKIFLAMAVLALAATLIALKWPI*
Ga0126370_109661002	3300010358	Tropical Forest Soil	MIQFLAQMPTDTKIFLAMAGLGLAAVLIVLRWVI*
Ga0126378_103132842	3300010361	Tropical Forest Soil	MIEFLAQMPTDEKIFLAVAVLGLAAILIVLRWLT*
Ga0126378_106958422	3300010361	Tropical Forest Soil	NGITRMIQFLAQMLTDTKIFLTMAVLGLAAMLIVLRRLI*
Ga0126378_111171902	3300010361	Tropical Forest Soil	MVEFLAHMPTDTMIFLTMAVLGLATMLIVLRGLI*
Ga0126378_113479053	3300010361	Tropical Forest Soil	MTRMIEFLAQMPTDTKIFLAIAVLGLAATLIVLRWLI*
Ga0126377_123819941	3300010362	Tropical Forest Soil	MTKLWEMIEFLAQMPTDAKIFLSMAVLSLVATLIALRWLI*
Ga0126379_100330285	3300010366	Tropical Forest Soil	MIEFLAQMPTDAKIFLTMAVLSLAIVLITLRWLI*
Ga0126379_108753423	3300010366	Tropical Forest Soil	MIEFLATMPTNTKIFLTAAVLGLMASLIVLRGLI*
Ga0126379_110882632	3300010366	Tropical Forest Soil	MLQEMTDFLTNMPANTVIFITMAVLGLAAMLIVLRGLI*
Ga0126379_117568521	3300010366	Tropical Forest Soil	MLQEMIQFLAQMPTDTKIFLTMAVLGLAGTLIVVKWLM*
Ga0126379_132107142	3300010366	Tropical Forest Soil	MIEFLVQMPTDTKIFLAMAVQGLAAVLIVLRWVI*
Ga0126379_133158941	3300010366	Tropical Forest Soil	MIEFLAQMPTDAMIFFTMAVLGLATMLIVLRRQI*
Ga0126379_136909981	3300010366	Tropical Forest Soil	MVEFLAQMPSDTKIVLATAVLALAAMLIVLRRLI*
Ga0126381_1030471132	3300010376	Tropical Forest Soil	MLQEMTDFLTNMPANTVIFITMAVLGLAVMLIVLRGLI*
Ga0126381_1031664181	3300010376	Tropical Forest Soil	TRMIQFLAQMPTDTKIFLAMAVLGLAAVLIVLRWVI*
Ga0126381_1033836881	3300010376	Tropical Forest Soil	MRNIIEFVAEMPTDTKLFLTMAVLGLAATLTVLKWLM*
Ga0126383_104283394	3300010398	Tropical Forest Soil	MIQFLTQMPTDTKIFLTTAVLALAAMLVVLRRLS*
Ga0126383_106818142	3300010398	Tropical Forest Soil	MIDFVAQMPTDTKIFLAMAVLALAATLIALKWPI*
Ga0126383_110240602	3300010398	Tropical Forest Soil	MIEFLATMPTDTKIFLAMAVLGLAATLIVLRCLI*
Ga0126383_111228521	3300010398	Tropical Forest Soil	MIEFLAQMPTDAKIFLSMAVLSLATVLIALRWLI*
Ga0126383_117490032	3300010398	Tropical Forest Soil	MIEFLAQMPTDTMLLLATAVLGFAALLMVLKWMV*
Ga0126383_131430281	3300010398	Tropical Forest Soil	MIEFLSQMLTDTKIFLAMAVLGLAALLIVLRRVI*
Ga0134127_135804011	3300010399	Terrestrial Soil	EGEMIEFLAQMPSETMIFITMALLGLGVTLLGVKWLI*
Ga0124850_10059183	3300010863	Tropical Forest Soil	MIEFLAQMTTHTMIFLTMAVLSLAATLIVLTRLN*
Ga0124850_10086072	3300010863	Tropical Forest Soil	MIDFVAQMPTDTMIFLTMAVLGLAAMLIVLRRQT*
Ga0137364_110696082	3300012198	Vadose Zone Soil	MIEFLATMPTNTKISLTTAVLGLLASLIVLRGLI*
Ga0137383_107941083	3300012199	Vadose Zone Soil	EGEMTEFLAQMPTDTMVFLTMAVMGFAAMLIVLRWLI*
Ga0137365_100921343	3300012201	Vadose Zone Soil	MVEFLAHMPTDTMIFLTLAVLGLATMVIVLRRLI*
Ga0137362_104558381	3300012205	Vadose Zone Soil	MIEFVAQMPTDAKIFLTMAVLSLATVLIALRWLV*
Ga0137362_116620891	3300012205	Vadose Zone Soil	ASGEKEMTEFLTNMPTDTKIFITMAVLGLAGTLIVLRRLI*
Ga0137380_108794183	3300012206	Vadose Zone Soil	MTEFLTHMPTDTKIFITMAVLGLATMLIVLRRLI*
Ga0137378_106940031	3300012210	Vadose Zone Soil	MIEFLAHMPTDAMLFLTMAVLSLAVTLIVLRRLS*
Ga0137367_101982741	3300012353	Vadose Zone Soil	MIEFLAHMPTDAMLFLTMAVLSLAVTLIVLRRLI*
Ga0137371_102359242	3300012356	Vadose Zone Soil	MVEFLAQMPTDTKIFLTMAVLGLATMLIVLRRLI*
Ga0137361_117752011	3300012362	Vadose Zone Soil	RRGEMIEFLAQMPTDTMLFLTMAVLGLAATLIVLRRLI*
Ga0137358_100246682	3300012582	Vadose Zone Soil	MIEFLAQMPTEAKIFLIMAVLGLAATLMALRRLI*
Ga0137358_102549211	3300012582	Vadose Zone Soil	ETCGWVVEFLAQMPTDTKIFLTMAILGLATMLIVLRRLI*
Ga0137395_110384471	3300012917	Vadose Zone Soil	MIEFLAQMPTDTMIFLTMAVLGLAVMLIVLRRLI*
Ga0126375_100077856	3300012948	Tropical Forest Soil	VIEFLAQMPTDTMIFLTMAVLGLAAVLMIVLKQI*
Ga0126375_100741122	3300012948	Tropical Forest Soil	MIEFLAHMPTDTIIFLTMAVLGLATMLIVLRRLI*
Ga0126375_106160703	3300012948	Tropical Forest Soil	MIEFLALMPTDTKIFLTMAVLSLAAMLIGLTRLI*
Ga0126375_116231441	3300012948	Tropical Forest Soil	MIEFLTQMPTDTVIFLAMAVLGLAVMLIVLRRLI*
Ga0164303_108139401	3300012957	Soil	MIEFLAEMPTDTMIFLTMAVLSLPAMLIVLRRLV*
Ga0164299_110349162	3300012958	Soil	GRLQRRKEMIEFLTHMPADTVIFITMAVLGLAGMLIMLRRLI*
Ga0164299_113151212	3300012958	Soil	MLREMIQFLAQMPTDTKIFLTMAVLGLAATVLAVRWLM*
Ga0126369_102971644	3300012971	Tropical Forest Soil	MIEFLAQMPTDTKVFLAMAVLGLAAVLIVLRRLV*
Ga0126369_105034723	3300012971	Tropical Forest Soil	MLREMVQFLAQMPIETKIFLTMAVLGLAGTLIVPKWLM*
Ga0126369_121065381	3300012971	Tropical Forest Soil	MLQEMIQFLAQMPTDTKIFLTMAVLGLAATLLAVRWLI*
Ga0126369_125944991	3300012971	Tropical Forest Soil	MIEFLTQMPSDTMIFITTAVLGLAATLIGLKWLI*
Ga0126369_129670732	3300012971	Tropical Forest Soil	MLQEMTDFLTNMPAKTVIFITMAVLGLAAMLIVLR
Ga0126369_136879321	3300012971	Tropical Forest Soil	MIEFLAQMPTDTMIFLIMAVLGLAATLIVLRRQT*
Ga0164309_118618571	3300012984	Soil	RLQRRKEMTEFLTHMPADTVIFITMAVLGLVGTLILLRRLI*
Ga0164304_103017512	3300012986	Soil	MIEFLAQMPTDTKIFVSMAVLGLVGMLIALKRLI*
Ga0132257_1020329311	3300015373	Arabidopsis Rhizosphere	MIEFLTEMPTATKIFLIVAALGLAATLIVLRRLI*
Ga0132257_1040543231	3300015373	Arabidopsis Rhizosphere	VIQEGEMIEFLAQMPSDTMIFITTTVLGLAATLIGLRWLI*
Ga0182034_102050243	3300016371	Soil	GEMIEFLAQMPTDTMTFLTMAVLGLAATLLGTRLI
Ga0182034_104841902	3300016371	Soil	MSGEAVFIMIEFLAQMPTDTMIFLTMAVLGLAAMLIVLTR
Ga0182040_103079712	3300016387	Soil	GEMIEFLAQMPTDTMIFITTVFLGLAATLIGLKWLI
Ga0182039_105841543	3300016422	Soil	EMIDFLALMPTDTKIFLTMAVLALAAMLVVLRRLT
Ga0182038_102108521	3300016445	Soil	MTEFLTNMPTDTKIFITMAVLGLAGTLTVLTDIAK
Ga0182038_104768373	3300016445	Soil	EMIEFLAQMPTDTMIFLTMAVLSLAATLIVLTRLI
Ga0182038_116116832	3300016445	Soil	WRMIEFLAQMPTDTMLFLAMAVLGLAGLLIVLRRLI
Ga0210384_101879221	3300021432	Soil	MIEFLAQMPTETKIFLTMAVLGLVRAVSVRGRQSFG
Ga0210392_110503212	3300021475	Soil	MLREMIQFLAQMPTDTKIFLTMAVLGLAGTLLVLKWLI
Ga0126371_111922521	3300021560	Tropical Forest Soil	MTRMIEFLAQMPTDTKIFLAIAVLGLAATLIVLRWLI
Ga0207692_106450621	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MLREMIQFLAEMPADTKIFLTMAVLGLAATLILLKWLI
Ga0207684_100355774	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MIEFLTHMPTDTKIFITMAVLGLAGTLRVLTDIAK
Ga0209240_12516902	3300026304	Grasslands Soil	GGLEVDHHMPTDTKIFLTMAILGLATMLIVLRRLI
Ga0209156_102006751	3300026547	Soil	MLREIIEFLAQMPTGTKIILTMAVLGLAATLLVLKRLI
Ga0209684_10096792	3300027527	Tropical Forest Soil	KSPRKGRMIEFLAQMPTDEKIFLAVAVLGLAATLIVLRWLI
Ga0318546_111627971	3300031771	Soil	PRRGEMIEFLAQMPTDTMIFLAMAALGLAATLIALR
Ga0318529_103620153	3300031792	Soil	ITRMIEFLAQMPTDTKIFITMAVLGLATMVIVLRRLI
Ga0318544_101647302	3300031880	Soil	MIEFLAQMPTDTMIFLTMAVLSLAATLIVLTAPLI
Ga0306925_100973714	3300031890	Soil	MIEFLAQMPTDTMIFLTMAVLSLAATLIVMLTRLI
Ga0306925_106593092	3300031890	Soil	MSGEAVFIMIEFLAQMPTDTMIFLTMAVLGLAAMLIVLTRLI
Ga0318522_102438862	3300031894	Soil	GEMIEFLAQMPTDTKIFLRAVLGLAAILIVLRRLI
Ga0318520_111074982	3300031897	Soil	PQVTRRGEMIAFLAQMPTDTMIFLTMAVLGLAAMLIVLRRLI
Ga0306923_101695144	3300031910	Soil	IESCWRMIDFVAQMPTDTKIFLAMAVLGLAAVLIVLRWVI
Ga0306923_102122234	3300031910	Soil	MTQLREMIEFVAQMPTNTKIVLAIVVLGLAAMLIVLRRLV
Ga0306923_106148091	3300031910	Soil	EMIEFLAQMPTDTMIFITTVFLGLAATLIGLKWLI
Ga0306923_109627184	3300031910	Soil	RQYRSTQRWRAMIEFLAQMPTDTKIFLTIAVLGLAAMLIAWRWLI
Ga0306921_101807857	3300031912	Soil	MIEFLAQMPTDTMIFLTMAVLSLAATLIVLLTRLI
Ga0310910_106198611	3300031946	Soil	SWWRMIEFLAQMPTDTMLFLAMAVLGLAATLIVLRRLI
Ga0310909_100627891	3300031947	Soil	EEMTEFLTNMPTDTKIFITMAVLGLAGTLIVLRRLI
Ga0318507_102753241	3300032025	Soil	REAVFIMIEFLAQMPTGTMIFLTMAVLGLAAVLIVLTRLT
Ga0318504_104731671	3300032063	Soil	TAQEGKMIDFVAQMPTDTMIFITMAVLGLAATLIVLRWLI
Ga0307472_1008178642	3300032205	Hardwood Forest Soil	TSMIREMIQFLAQMPTDTKIFLTMAVLGLAATLLAVRWLM
Ga0307472_1013223043	3300032205	Hardwood Forest Soil	KEMIEFLTHMPADTVIFITMAVLGLAGMLIMLRRLI
Ga0306920_1024293932	3300032261	Soil	PQATQEGEMIESLAQMPTDTMIFLTMAVLGLAVMLIVLSRLI
Ga0318519_100999561	3300033290	Soil	MIEFLSQMPTDEKIFLAMTVLGLATMVIVLRRLIQAGVLI

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F030258

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences