Basic Information | |
---|---|
Family ID | F031269 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 183 |
Average Sequence Length | 46 residues |
Representative Sequence | AAELGGRAKSWPARYGFSLLLYFWDLLDDSIDLFFWCDWIC |
Number of Associated Samples | 152 |
Number of Associated Scaffolds | 183 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.27 % |
% of genes from short scaffolds (< 2000 bps) | 91.80 % |
Associated GOLD sequencing projects | 142 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.475 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.869 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.623 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 183 Family Scaffolds |
---|---|---|
PF13469 | Sulfotransfer_3 | 25.14 |
PF00999 | Na_H_Exchanger | 22.95 |
PF00685 | Sulfotransfer_1 | 7.65 |
PF01638 | HxlR | 3.83 |
PF13365 | Trypsin_2 | 1.64 |
PF00248 | Aldo_ket_red | 0.55 |
PF00582 | Usp | 0.55 |
PF03109 | ABC1 | 0.55 |
COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
---|---|---|---|
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 22.95 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 22.95 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 22.95 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 22.95 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 22.95 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 3.83 |
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_17411066 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1380 | Open in IMG/M |
2170459010|GIO7OMY02FTAV9 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 524 | Open in IMG/M |
2189573000|GPBTN7E01DVW7H | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 522 | Open in IMG/M |
2209111022|2221200596 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 929 | Open in IMG/M |
3300000955|JGI1027J12803_107225867 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300002902|JGI24803J43973_1005253 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
3300004114|Ga0062593_100683681 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 997 | Open in IMG/M |
3300004480|Ga0062592_101266555 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 694 | Open in IMG/M |
3300004480|Ga0062592_101557243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis | 637 | Open in IMG/M |
3300004643|Ga0062591_100163493 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
3300005093|Ga0062594_102415902 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 575 | Open in IMG/M |
3300005172|Ga0066683_10422054 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300005175|Ga0066673_10880745 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 510 | Open in IMG/M |
3300005177|Ga0066690_10372388 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 969 | Open in IMG/M |
3300005184|Ga0066671_10980170 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
3300005293|Ga0065715_10007197 | All Organisms → cellular organisms → Bacteria | 3478 | Open in IMG/M |
3300005293|Ga0065715_10607516 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 680 | Open in IMG/M |
3300005332|Ga0066388_100374430 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
3300005332|Ga0066388_105383371 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 649 | Open in IMG/M |
3300005347|Ga0070668_100452784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis | 1104 | Open in IMG/M |
3300005354|Ga0070675_100261729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis | 1516 | Open in IMG/M |
3300005434|Ga0070709_10473039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 947 | Open in IMG/M |
3300005437|Ga0070710_10687768 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 721 | Open in IMG/M |
3300005458|Ga0070681_10797198 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 862 | Open in IMG/M |
3300005459|Ga0068867_101745740 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 584 | Open in IMG/M |
3300005468|Ga0070707_101672423 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
3300005539|Ga0068853_101053102 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 784 | Open in IMG/M |
3300005544|Ga0070686_101301814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 607 | Open in IMG/M |
3300005560|Ga0066670_10213819 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1162 | Open in IMG/M |
3300005574|Ga0066694_10528237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 550 | Open in IMG/M |
3300005576|Ga0066708_10747299 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 616 | Open in IMG/M |
3300005598|Ga0066706_11357153 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 537 | Open in IMG/M |
3300005764|Ga0066903_100823014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1665 | Open in IMG/M |
3300005764|Ga0066903_100848148 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1643 | Open in IMG/M |
3300005764|Ga0066903_100854548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1638 | Open in IMG/M |
3300005764|Ga0066903_104699664 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 727 | Open in IMG/M |
3300005764|Ga0066903_104908303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 710 | Open in IMG/M |
3300005764|Ga0066903_107110718 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 580 | Open in IMG/M |
3300005937|Ga0081455_10078243 | All Organisms → cellular organisms → Bacteria | 2718 | Open in IMG/M |
3300005937|Ga0081455_10204125 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300006032|Ga0066696_10211442 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1241 | Open in IMG/M |
3300006163|Ga0070715_10839430 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 561 | Open in IMG/M |
3300006175|Ga0070712_100835960 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 791 | Open in IMG/M |
3300006844|Ga0075428_100870900 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 956 | Open in IMG/M |
3300006852|Ga0075433_11796830 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 527 | Open in IMG/M |
3300009090|Ga0099827_11785032 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 536 | Open in IMG/M |
3300009094|Ga0111539_11220058 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 873 | Open in IMG/M |
3300009101|Ga0105247_10507988 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 879 | Open in IMG/M |
3300009137|Ga0066709_100600241 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
3300009137|Ga0066709_103580837 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 563 | Open in IMG/M |
3300009176|Ga0105242_10112653 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
3300010041|Ga0126312_10071404 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
3300010046|Ga0126384_10448983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1100 | Open in IMG/M |
3300010046|Ga0126384_10733456 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 878 | Open in IMG/M |
3300010159|Ga0099796_10081237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1189 | Open in IMG/M |
3300010303|Ga0134082_10175553 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 872 | Open in IMG/M |
3300010304|Ga0134088_10480451 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 611 | Open in IMG/M |
3300010359|Ga0126376_10421895 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300010359|Ga0126376_13195010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 507 | Open in IMG/M |
3300010362|Ga0126377_12695044 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 572 | Open in IMG/M |
3300010362|Ga0126377_12816823 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 561 | Open in IMG/M |
3300010373|Ga0134128_12788649 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 538 | Open in IMG/M |
3300010376|Ga0126381_102430351 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 751 | Open in IMG/M |
3300010398|Ga0126383_11439226 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 779 | Open in IMG/M |
3300010398|Ga0126383_12379108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 615 | Open in IMG/M |
3300010401|Ga0134121_11246818 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 746 | Open in IMG/M |
3300012198|Ga0137364_10253322 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1301 | Open in IMG/M |
3300012198|Ga0137364_11302077 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 541 | Open in IMG/M |
3300012203|Ga0137399_10044483 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3180 | Open in IMG/M |
3300012203|Ga0137399_10381140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1174 | Open in IMG/M |
3300012205|Ga0137362_11029263 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 701 | Open in IMG/M |
3300012351|Ga0137386_11264302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
3300012353|Ga0137367_11168624 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 516 | Open in IMG/M |
3300012354|Ga0137366_11251257 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
3300012357|Ga0137384_10342641 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1239 | Open in IMG/M |
3300012357|Ga0137384_11081234 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 643 | Open in IMG/M |
3300012361|Ga0137360_10690684 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 876 | Open in IMG/M |
3300012363|Ga0137390_10392756 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1366 | Open in IMG/M |
3300012507|Ga0157342_1005593 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1161 | Open in IMG/M |
3300012683|Ga0137398_10068672 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2154 | Open in IMG/M |
3300012891|Ga0157305_10137502 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 644 | Open in IMG/M |
3300012898|Ga0157293_10175937 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 626 | Open in IMG/M |
3300012918|Ga0137396_10290663 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1208 | Open in IMG/M |
3300012930|Ga0137407_10749092 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 921 | Open in IMG/M |
3300012961|Ga0164302_10407740 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 930 | Open in IMG/M |
3300012977|Ga0134087_10169918 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 960 | Open in IMG/M |
3300012977|Ga0134087_10687238 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 541 | Open in IMG/M |
3300012985|Ga0164308_10381755 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1147 | Open in IMG/M |
3300012985|Ga0164308_12077153 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 530 | Open in IMG/M |
3300012987|Ga0164307_10397604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1014 | Open in IMG/M |
3300012987|Ga0164307_10752073 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 770 | Open in IMG/M |
3300013297|Ga0157378_10804944 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 966 | Open in IMG/M |
3300014157|Ga0134078_10438031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 594 | Open in IMG/M |
3300014166|Ga0134079_10047530 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1500 | Open in IMG/M |
3300014325|Ga0163163_11536338 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 727 | Open in IMG/M |
3300014325|Ga0163163_11536546 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 727 | Open in IMG/M |
3300014968|Ga0157379_10447931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1191 | Open in IMG/M |
3300014968|Ga0157379_10498159 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1129 | Open in IMG/M |
3300014969|Ga0157376_10124625 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2289 | Open in IMG/M |
3300015371|Ga0132258_10726002 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2502 | Open in IMG/M |
3300015372|Ga0132256_101505081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 784 | Open in IMG/M |
3300015372|Ga0132256_102987200 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
3300015372|Ga0132256_103084298 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 560 | Open in IMG/M |
3300015374|Ga0132255_100549943 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1701 | Open in IMG/M |
3300015374|Ga0132255_101079481 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1206 | Open in IMG/M |
3300015374|Ga0132255_101120000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1184 | Open in IMG/M |
3300016270|Ga0182036_10347756 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1142 | Open in IMG/M |
3300016270|Ga0182036_10443395 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1019 | Open in IMG/M |
3300016294|Ga0182041_11848350 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 560 | Open in IMG/M |
3300016387|Ga0182040_10018988 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3769 | Open in IMG/M |
3300017997|Ga0184610_1218664 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 636 | Open in IMG/M |
3300018051|Ga0184620_10077717 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 989 | Open in IMG/M |
3300018056|Ga0184623_10217203 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 877 | Open in IMG/M |
3300018071|Ga0184618_10372084 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 607 | Open in IMG/M |
3300018072|Ga0184635_10191430 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 816 | Open in IMG/M |
3300018072|Ga0184635_10254586 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300018081|Ga0184625_10620098 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 528 | Open in IMG/M |
3300018433|Ga0066667_10135397 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1711 | Open in IMG/M |
3300019362|Ga0173479_10320900 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 715 | Open in IMG/M |
3300019885|Ga0193747_1056957 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 969 | Open in IMG/M |
3300020016|Ga0193696_1137020 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 612 | Open in IMG/M |
3300020062|Ga0193724_1102666 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 578 | Open in IMG/M |
3300021344|Ga0193719_10038919 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2059 | Open in IMG/M |
3300021411|Ga0193709_1063191 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 846 | Open in IMG/M |
3300022694|Ga0222623_10215109 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 745 | Open in IMG/M |
3300023072|Ga0247799_1083005 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 563 | Open in IMG/M |
3300025898|Ga0207692_10243781 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1074 | Open in IMG/M |
3300025898|Ga0207692_10468903 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 795 | Open in IMG/M |
3300025900|Ga0207710_10433800 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 677 | Open in IMG/M |
3300025905|Ga0207685_10746267 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
3300025911|Ga0207654_10171173 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1410 | Open in IMG/M |
3300025917|Ga0207660_10948741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 702 | Open in IMG/M |
3300025919|Ga0207657_11048231 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 624 | Open in IMG/M |
3300025925|Ga0207650_11521489 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 568 | Open in IMG/M |
3300025926|Ga0207659_10057697 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
3300025932|Ga0207690_10174833 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1612 | Open in IMG/M |
3300025934|Ga0207686_10201509 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
3300025941|Ga0207711_11059614 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 751 | Open in IMG/M |
3300026023|Ga0207677_11853077 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 560 | Open in IMG/M |
3300026088|Ga0207641_11243962 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 744 | Open in IMG/M |
3300026095|Ga0207676_10562058 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1091 | Open in IMG/M |
3300026121|Ga0207683_11626691 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 595 | Open in IMG/M |
3300026317|Ga0209154_1060758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1663 | Open in IMG/M |
3300026318|Ga0209471_1056973 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1789 | Open in IMG/M |
3300026323|Ga0209472_1103892 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1130 | Open in IMG/M |
3300026325|Ga0209152_10041158 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1603 | Open in IMG/M |
3300026528|Ga0209378_1250584 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
3300026960|Ga0207582_1011585 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 791 | Open in IMG/M |
3300027682|Ga0209971_1109673 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 677 | Open in IMG/M |
3300027876|Ga0209974_10359583 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 566 | Open in IMG/M |
3300028717|Ga0307298_10104097 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 808 | Open in IMG/M |
3300028768|Ga0307280_10148788 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 807 | Open in IMG/M |
3300028784|Ga0307282_10585163 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 542 | Open in IMG/M |
3300028828|Ga0307312_10504479 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 799 | Open in IMG/M |
3300028876|Ga0307286_10011623 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
3300030841|Ga0075384_11275538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 512 | Open in IMG/M |
3300030945|Ga0075373_11647953 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
3300031122|Ga0170822_12096296 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 662 | Open in IMG/M |
3300031128|Ga0170823_10691951 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 724 | Open in IMG/M |
3300031231|Ga0170824_117192002 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 585 | Open in IMG/M |
3300031446|Ga0170820_15830465 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1016 | Open in IMG/M |
3300031469|Ga0170819_12325234 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
3300031474|Ga0170818_112747917 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 579 | Open in IMG/M |
3300031547|Ga0310887_10248965 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 991 | Open in IMG/M |
3300031682|Ga0318560_10587759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 603 | Open in IMG/M |
3300031716|Ga0310813_10605701 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 969 | Open in IMG/M |
3300031720|Ga0307469_10184261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1610 | Open in IMG/M |
3300031736|Ga0318501_10852055 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 506 | Open in IMG/M |
3300031820|Ga0307473_10412535 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 888 | Open in IMG/M |
3300031847|Ga0310907_10246468 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 877 | Open in IMG/M |
3300031912|Ga0306921_10101135 | All Organisms → cellular organisms → Bacteria | 3341 | Open in IMG/M |
3300031912|Ga0306921_11443655 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 754 | Open in IMG/M |
3300031942|Ga0310916_10438095 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300031944|Ga0310884_11042244 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
3300031996|Ga0308176_11854609 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 644 | Open in IMG/M |
3300032001|Ga0306922_10741377 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1031 | Open in IMG/M |
3300032076|Ga0306924_11825390 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 633 | Open in IMG/M |
3300032205|Ga0307472_101146182 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 739 | Open in IMG/M |
3300032261|Ga0306920_102171834 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 773 | Open in IMG/M |
3300033289|Ga0310914_10767357 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 862 | Open in IMG/M |
3300033412|Ga0310810_10154505 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
3300033412|Ga0310810_11212135 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 610 | Open in IMG/M |
3300034150|Ga0364933_221103 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 501 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.20% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.37% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.37% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.92% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.28% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.19% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.19% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.64% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.64% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.64% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.64% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.09% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.09% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.09% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.09% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.09% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.09% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.55% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.55% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002902 | Soil microbial communities from Manhattan, Kansas, USA - Sample 400um Nextera | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026960 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes) | Environmental | Open in IMG/M |
3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_03606940 | 2088090014 | Soil | RAKSWPTRYGFSMLLFFWDLLDDSIDLLFWCDWIC |
F62_03767040 | 2170459010 | Grass Soil | MAQFFEHELKACASELGGHAKTWPTRYGFSLLLFFWDLLDDSIDLLFFCDWIC |
N55_07603430 | 2189573000 | Grass Soil | MAQFFEHELKACAVELGGRAKSWPTRYGFSLLLYFWDLLDDSIDLLFWCDWIC |
2222027308 | 2209111022 | Grass Soil | MAQFFEHELKACASELGGHAKSWPARYGFSLLLYFWDLLDDSIDLLFWCDWIC |
JGI1027J12803_1072258671 | 3300000955 | Soil | LGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
JGI24803J43973_10052531 | 3300002902 | Soil | CAARLGGPARDWPARYGFSLLVFFWDLLDDIDLLFWCDWI* |
Ga0062593_1006836812 | 3300004114 | Soil | ACAVELGGRAKSWPGRYGFSLLVSFWDLLDDSFDLLFWCDWIC* |
Ga0062592_1012665551 | 3300004480 | Soil | EHELKACAAELGGRARSWPTRYGFSMLLFFWDLLDDSIDLLFWCDWIC* |
Ga0062592_1015572432 | 3300004480 | Soil | AKVRDRMAQFFEHELKACAVELGGRAKSWPGRYGFSLLVSFWDLLDDSFDLLFWCDWIC* |
Ga0062591_1001634933 | 3300004643 | Soil | FEQELKACATQLGGAAKSWPARYGFSLVLYFWDLLDDSIDLLFWCDWIC* |
Ga0062594_1024159021 | 3300005093 | Soil | KACAVELGGRAKSWPARYGFSLLLYFWDLLDDSIDLFFWCDWIS* |
Ga0066683_104220541 | 3300005172 | Soil | ARLGGPARDWPARYGFSVLFFLWELADDIDLFAWCDWIA* |
Ga0066673_108807451 | 3300005175 | Soil | ELKACATKLGGRAKSWPARYGFSLVLYFWDLLDDSIDLLFWCDWIC* |
Ga0066690_103723882 | 3300005177 | Soil | AQFFKKELKACAEELGGPAREWPARYGFSLLWFVIDILDDVDLFAWCDWLAAKTVLLV* |
Ga0066671_109801702 | 3300005184 | Soil | ARLGGAARDWPARYGFSLLLFLWDLLDDSIDLFFWCDWIS* |
Ga0065715_100071974 | 3300005293 | Miscanthus Rhizosphere | RDRMARFFEHELKACAAKLGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIS* |
Ga0065715_106075161 | 3300005293 | Miscanthus Rhizosphere | ARLGGAARDWPARYGFSLLLFVWDLLDDSIDLFFWCDWIG* |
Ga0066388_1003744303 | 3300005332 | Tropical Forest Soil | DRMARFFEHELKACALELGGRAKSWPTRYGFSMLLFLWDLVDDSIDLLFWCDWIC* |
Ga0066388_1053833712 | 3300005332 | Tropical Forest Soil | HNNDAGQAKLRLTAKVRDRMAQFFKHELKVCAAELGGRAKSWPTRYGFSLVLYVWDLLDDSIDLFFWCDWIC* |
Ga0070668_1004527841 | 3300005347 | Switchgrass Rhizosphere | KVRDRMAQFFEHELKACAAELGGRAKSWPTRYGFSLMLYFWDLLDDSIDLFCWCDWIC* |
Ga0070675_1002617292 | 3300005354 | Miscanthus Rhizosphere | MARFFEHELKACAAELGGRARSWPTRYGFSMLLFFWDLLDDSIDLLFWCDWIC* |
Ga0070709_104730392 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ASELGGRAKSWPTRYGFSFLLFFWDLLDDSIDLLFWCDWIS* |
Ga0070710_106877682 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ELGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWVC* |
Ga0070681_107971982 | 3300005458 | Corn Rhizosphere | EHELKACAVELGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWVC* |
Ga0068867_1017457401 | 3300005459 | Miscanthus Rhizosphere | QFFEHELKACAVELGGRAKSWPARYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0070707_1016724231 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | KKELKTCAARLGGSARNWPARYGFSLLLFFWDLLDDIDLLFWCDWIA* |
Ga0068853_1010531021 | 3300005539 | Corn Rhizosphere | AAELGGRAKSWPTRYGFSLMLYFWDLLDDSIDLFCWCDWIC* |
Ga0070686_1013018142 | 3300005544 | Switchgrass Rhizosphere | ELGGRAKSWPTRYGFSLMLYFWDLLDDSIDLFFWCDWIC* |
Ga0066670_102138191 | 3300005560 | Soil | AARDWPARYGFSLLLFLWDLLDDSIDLFFWCDWIS* |
Ga0066694_105282371 | 3300005574 | Soil | ELGARAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0066708_107472992 | 3300005576 | Soil | CAARLGGAARDWPARYGFSLLLFVWDLLDDSIDLFFWCDWIS* |
Ga0066706_113571531 | 3300005598 | Soil | KVRDRMAQFFEHELKACASELGARAKSWPTRYGFSMVLFFWDLLDDSIDLLFWCDWIC* |
Ga0066903_1008230143 | 3300005764 | Tropical Forest Soil | CALELGGRAKSWPTRYGFSMLLFLWDLVDDSIDLLFWCDWIC* |
Ga0066903_1008481482 | 3300005764 | Tropical Forest Soil | ARDWPARYGFSLLLLVWDLLDDSFDLFFWLAWVS* |
Ga0066903_1008545483 | 3300005764 | Tropical Forest Soil | DRMARFFEHELKACALELGGRAKSWPTRYGFSMLLFLWDLLDDSIDLLFWCDWIC* |
Ga0066903_1046996642 | 3300005764 | Tropical Forest Soil | FKKELKTCAARLGGAARDWPTRYGFSLLMFFWDLMDDSIDLFCWCGWLA* |
Ga0066903_1049083032 | 3300005764 | Tropical Forest Soil | ELKACAAELGGRAKNWPARYGFSFLLFFWDLLDDSIDLLFWCDSIC* |
Ga0066903_1071107182 | 3300005764 | Tropical Forest Soil | FKHELKVCAAELGGRAKSWPTRYGFSLVLYVWDLLDDSIDLFFWCDWIC* |
Ga0081455_100782433 | 3300005937 | Tabebuia Heterophylla Rhizosphere | DCMAQFFEHELKACAVELGGRAKSWPARYGFSLLLYFWDLLDDSIDLLFWCDWIC* |
Ga0081455_102041251 | 3300005937 | Tabebuia Heterophylla Rhizosphere | ELGGPAKDWPARYGFSLVLYFWDLLDDSIDLFFWCDWIC* |
Ga0066696_102114421 | 3300006032 | Soil | QFFEHELKACAAELGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0070715_108394302 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ARDWPARYGFSLLLFVWDLLDDSIDLFFWCDWIS* |
Ga0070712_1008359602 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ELGGRAKSWPTRYGFSFLLFFWDLLDDSIDLLFWCDWIC* |
Ga0075428_1008709002 | 3300006844 | Populus Rhizosphere | RRLGGAARDWPARYGFSLLLFVWDLMDDSIDLFFWLDWIS* |
Ga0075433_117968301 | 3300006852 | Populus Rhizosphere | ELGGRAKSWPARYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0099827_117850321 | 3300009090 | Vadose Zone Soil | SELGARAKSWPTRYGFSMVLFFWDLLDDSIDLFFWCDWIC* |
Ga0111539_112200582 | 3300009094 | Populus Rhizosphere | AKVRDRMARFFEHELKACAAELGGRARSWPTRYGFSMLLFFWDLMDDSIDLLFWCDWIC* |
Ga0105247_105079881 | 3300009101 | Switchgrass Rhizosphere | RPYGSIFEHELKACAAKLGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0066709_1006002411 | 3300009137 | Grasslands Soil | RMAQFFEHELKACASELGARAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0066709_1035808371 | 3300009137 | Grasslands Soil | RDRMAQFFEHELKACASELGARAKSWPTRYGFSMVLFFWDLLDDSIDLFFWCDWIC* |
Ga0105242_101126533 | 3300009176 | Miscanthus Rhizosphere | AAELGGHAKSWPTRYGFSLMLYFWDLLDDSIDLFFWCDWIC* |
Ga0126312_100714041 | 3300010041 | Serpentine Soil | ELKTCAALLGGPARDWPARYGFSLLIFFWDLLDDSIDLFFWCDWVA* |
Ga0126384_104489831 | 3300010046 | Tropical Forest Soil | KTCAARLGGPARDWPARYGFSLLVFFWDLLDDIDLLFWCEWIS* |
Ga0126384_107334561 | 3300010046 | Tropical Forest Soil | TCAARLGGAARDWPSRYGFSLLLFVWDMLDDSIDLFFWLDWIS* |
Ga0099796_100812371 | 3300010159 | Vadose Zone Soil | KTCASRLGGAGRDRPARYGFSLLVFFWDLIDEIDLFSFCDWIS* |
Ga0134082_101755531 | 3300010303 | Grasslands Soil | KTCAARLGGAARHWPARYGFSLLLLFWDLLDDRIDLFF* |
Ga0134088_104804511 | 3300010304 | Grasslands Soil | KVRDRMAQFFEHELKACASELGSRAKSWPTRYGFSTLLFFWDLLDDSIDLFFCCDWIC* |
Ga0126376_104218951 | 3300010359 | Tropical Forest Soil | AQFFEDELKACASELGGRAKSWPARYGFSLLLFFWDSLDDSIDLLFWCDWIS* |
Ga0126376_131950101 | 3300010359 | Tropical Forest Soil | ELKTCAARLGGSARNWPARYGFSLLLFFWDLLDDIDLLFWLDWVT* |
Ga0126377_126950441 | 3300010362 | Tropical Forest Soil | KACATELGGRAKSWPSRYGFSLLLLFWDMLDDTIDLFFWCDWIC* |
Ga0126377_128168232 | 3300010362 | Tropical Forest Soil | KKELKTCAARLGGAARDWPARYGFSLLLFVWDWLDDSIDLFFWWNWIA* |
Ga0134128_127886491 | 3300010373 | Terrestrial Soil | AAELGGRAKSWPARYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0126381_1024303512 | 3300010376 | Tropical Forest Soil | ARDWPARYGFSLLLLVWDLLDDSFDLFFWWDWIS* |
Ga0126383_114392261 | 3300010398 | Tropical Forest Soil | CALELGERAKTWPARYGFSLLLFLLDMLDDSIDLFFWCDWIS* |
Ga0126383_123791082 | 3300010398 | Tropical Forest Soil | ELGGPAKEWPARYGFSLLLYFWDLLVDSIDLFFWCDWLC* |
Ga0134121_112468181 | 3300010401 | Terrestrial Soil | GGPAKEWPARYGFSLLLYFWDLLDDGIDLLFWCDWIY* |
Ga0137364_102533223 | 3300012198 | Vadose Zone Soil | ELGGRAKSWPTRYGFSLLLYFWDLLDDSIDLLFWCDWIC* |
Ga0137364_113020771 | 3300012198 | Vadose Zone Soil | AAKLGGRAKSWPARYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0137399_100444834 | 3300012203 | Vadose Zone Soil | AKVRDRMAQFFEHELKASAAELGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0137399_103811401 | 3300012203 | Vadose Zone Soil | VRDRMAQFFEHELKACAAELGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0137362_110292631 | 3300012205 | Vadose Zone Soil | RAKSWPTRYGFSMVLFFWDLVDDSIDLLFWCDWIC* |
Ga0137386_112643021 | 3300012351 | Vadose Zone Soil | AKSWPGRYGFSLLLFLWDMLDDSIDRFFWCDWIS* |
Ga0137367_111686242 | 3300012353 | Vadose Zone Soil | FQKELKTCAARLGGAARDWPARYGFSLLLFVWDLLDDSIDLFFWCDWLS* |
Ga0137366_112512572 | 3300012354 | Vadose Zone Soil | AARLGGAARDWPARYGFSLLLFVWDLLDDSIDLFFWCDWIS* |
Ga0137384_103426411 | 3300012357 | Vadose Zone Soil | CAAQLGGAARDWPARYGFSLLLLFWDLLDDSIDLFFWCDWIS* |
Ga0137384_110812341 | 3300012357 | Vadose Zone Soil | ELKACASELGSRAKSWPTRYGFSTLLFFWDLLDDSIDLLFWCDWIC* |
Ga0137360_106906842 | 3300012361 | Vadose Zone Soil | TAKVRDRMAQFFEHELKACASELGARAKSWPTRYGFSMVLFFWDLVDDSIDLLFWCDWIC |
Ga0137390_103927563 | 3300012363 | Vadose Zone Soil | AQFFEHELTACASELGGRAKSWPTRYGFSMLLYFWDLLDDSIDLFFWCDWIC* |
Ga0157342_10055931 | 3300012507 | Arabidopsis Rhizosphere | HELKACAVELGGRAKSWPTRYGFSLMLYFWDLLDDSIDLFFWCDWIC* |
Ga0137398_100686723 | 3300012683 | Vadose Zone Soil | AQFFEHELKASAAELGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIC* |
Ga0157305_101375022 | 3300012891 | Soil | MAQFFEHELKACAVELGGRAKSWPARYGFSLLVSFWDLLDDSFDLLFWCDWIC* |
Ga0157293_101759371 | 3300012898 | Soil | CAAKLGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIS* |
Ga0137396_102906631 | 3300012918 | Vadose Zone Soil | RLGGAARDWPARYGFSLLVFFWDLIDDIDLLSFCDWIS* |
Ga0137407_107490921 | 3300012930 | Vadose Zone Soil | ARAKSWPTRYGFSMVLFFWDLLDDSIDLFFWCDWIC* |
Ga0164302_104077402 | 3300012961 | Soil | VELGGRAKSWPTRYGFSLMLYFWDLLDDSIDLFFWCDWIC* |
Ga0134087_101699181 | 3300012977 | Grasslands Soil | ELKTCAARLGGAARDWPARYGFSMVLFFWDLLDDSIDLFFWCDWIS* |
Ga0134087_106872381 | 3300012977 | Grasslands Soil | KPHENGDAGSKRRLTAKVRDRMAEFFEQELGPCAGELGGRAKTWPTRYGFSLLLFFWDLLDDSIDLLFWCDWIC* |
Ga0164308_103817552 | 3300012985 | Soil | KKELKTCAARLGGAARDWPARYGFSLLLLFWNLLDDSIDLFFWRDWIS* |
Ga0164308_120771532 | 3300012985 | Soil | DRMAQFFEHELKACAVELGGRAKSWPTRYGFSFLLFFWDLLDDSIDLLFWCDWMC* |
Ga0164307_103976041 | 3300012987 | Soil | ARLGGAARDWPARYGFSLLLFVWDLLDDSIDLFFWCDWIS* |
Ga0164307_107520731 | 3300012987 | Soil | RMARFFEHELKACAAKLGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIS* |
Ga0157378_108049442 | 3300013297 | Miscanthus Rhizosphere | AQFFEHELKACATELGGRAKSWPSRYGFSLLLLFWDVLDDSIDLFFWCDWIC* |
Ga0134078_104380312 | 3300014157 | Grasslands Soil | LKTCAAQLGGAARNWPARYGFSLLLLFWDLLDDSIDLFF* |
Ga0134079_100475301 | 3300014166 | Grasslands Soil | LELGEHAKTWPARYGFSLLLFLWDVLDDSIDLFFWCDWIS* |
Ga0163163_115363381 | 3300014325 | Switchgrass Rhizosphere | DRMAHFFKHELKVCAAELGGRATSWPARYGFSLLLYVWDLLDDSIDLFFWCDWIC* |
Ga0163163_115365462 | 3300014325 | Switchgrass Rhizosphere | AARLGGAAREWPARYGFSLLLFVWDLLDDSIDLLFWCDWIS* |
Ga0157379_104479312 | 3300014968 | Switchgrass Rhizosphere | CAARLGGAARDWPARYGLSLLLFIWDFLDDSIDLFCLGDWIS* |
Ga0157379_104981592 | 3300014968 | Switchgrass Rhizosphere | QKELKTCAARLGGAAREWPARYGFSLLLFVWDLLDDSIDLFFWCDWIS* |
Ga0157376_101246253 | 3300014969 | Miscanthus Rhizosphere | ELKACAVELGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWVC* |
Ga0132258_107260021 | 3300015371 | Arabidopsis Rhizosphere | LKACAVELGGRAKSWPARYGVSMLLFFWDLLDDSIDLLVWSDWIC* |
Ga0132256_1015050812 | 3300015372 | Arabidopsis Rhizosphere | AKSWPTRYGFSMLLYFWDLLDDSIDLFFWCDWIC* |
Ga0132256_1029872001 | 3300015372 | Arabidopsis Rhizosphere | DRIARFFEHELKACALELGGRAKSWPTRYGFSMLLFFWDLLADSIDFLFCCDLIC* |
Ga0132256_1030842982 | 3300015372 | Arabidopsis Rhizosphere | RFFEHELKVCAAELGGRAKSWPARYGFSLVLYVWDLLDDRIDLFFWCDWIW* |
Ga0132255_1005499431 | 3300015374 | Arabidopsis Rhizosphere | RLGGAARDWPARYGFTLLLFLWDFLDDSIDLFFWCDWIT* |
Ga0132255_1010794812 | 3300015374 | Arabidopsis Rhizosphere | LGGAARDWPARYGFSLLVFLWDLLDDSTDLFFWCDWIS* |
Ga0132255_1011200002 | 3300015374 | Arabidopsis Rhizosphere | FQKELKTCAARLGGAAREWPARYGFSLLLFVWDLLDDSIDLLFWCDWIS* |
Ga0182036_103477561 | 3300016270 | Soil | RDRVARFFEHELKACASELGGRAKSWPTRYGFSMLLFFWDLLDDSIDLLFWCDWIC |
Ga0182036_104433951 | 3300016270 | Soil | TCARRLGGAARDWPGRYGFSLLLLFWDLLGDSIDLFFWCDWIS |
Ga0182041_118483502 | 3300016294 | Soil | FEHELKACAAELGGHARSWAARYGFSMLVFVWDLLDDSIDLLFWCDWTC |
Ga0182040_100189881 | 3300016387 | Soil | VRDRVARFFEHELKACASELGGRAKSWPTRYGFSMLLFFWDLLDDSIDLLFWCDWIC |
Ga0184610_12186641 | 3300017997 | Groundwater Sediment | FFEQELKACAAELGGRAKSWPARYGFSLLLYFWDLLDDSIDLLFCCDWIC |
Ga0184620_100777171 | 3300018051 | Groundwater Sediment | RLGGPARHWPARYGFSLLLFVWDLLDDIDLLFWCDWIS |
Ga0184623_102172032 | 3300018056 | Groundwater Sediment | FEHELKACASELGGRAKSWPTRYGFSMILFFWDLLDDSIDLLFFCDWIC |
Ga0184618_103720841 | 3300018071 | Groundwater Sediment | KELKTCAARLGGAARDWPARYGFSLLLFVWDLLDDFDLLSWCDWIS |
Ga0184635_101914301 | 3300018072 | Groundwater Sediment | ELKACAAELGGRAKSWPARYGFSLVLYFWDLLDDSIDVLFWCDWIC |
Ga0184635_102545862 | 3300018072 | Groundwater Sediment | ELSGAAREWPARYGFSLLWFFMELADDLDLFFWCDGLV |
Ga0184625_106200981 | 3300018081 | Groundwater Sediment | AELGGRAKSWPTRYGFSLMLYFWDLLDDSIDLFFWCDWVC |
Ga0066667_101353973 | 3300018433 | Grasslands Soil | FKKELKTCAVRLGGPAGRWPARYGFSLLGIIGQLLDDRDLLFWCDRVV |
Ga0173479_103209002 | 3300019362 | Soil | GGRAKSWPARYGFSLLLYFWDLLDDSIDLFFWCDWIS |
Ga0193747_10569571 | 3300019885 | Soil | KVRDRMARFFEHELKACASELGGRAKTWPTRYGFSMLLFFWDLLDDSIDLLFWCDWIA |
Ga0193696_11370201 | 3300020016 | Soil | TCASRLGGAARDWPARYGFSLLVFFWDLIDDIDLLSFCDWIS |
Ga0193724_11026661 | 3300020062 | Soil | GAARDWPARYGFSLLLFLWDLLDDSIDLFFWCDWIS |
Ga0193719_100389193 | 3300021344 | Soil | ASRLGGAARDWPARYGFSLLVFFWDLIDDIDLLSFCDWIS |
Ga0193709_10631911 | 3300021411 | Soil | RAKNWPTRYGFSMLLYFWDLLDDSIDLFFWCDWIC |
Ga0222623_102151092 | 3300022694 | Groundwater Sediment | ELKTCAARLGGPARDWPARYGFSLLVFLWDLVDDFDLLFWCDWIS |
Ga0247799_10830051 | 3300023072 | Soil | FEHELKACAVELGGRAKSWPTRYGFSLMLYFWDLLDDSIDLFFWCDWIC |
Ga0207692_102437812 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TCAARLGGAARDWPARYGFSLLLFVWDLLDDSIDLFFWCDWIS |
Ga0207692_104689032 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SELGGRAKSWPTRYGFSFLLFFWDLLDDSIDLLFWCDWIC |
Ga0207710_104338001 | 3300025900 | Switchgrass Rhizosphere | ELGGHAKSWPARYGFSLLLYFWDLLDDSIDLFFWCDWIC |
Ga0207685_107462671 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GGAARDWPARYGFSLLLFVWDLLDDSIDLFFWCDWIS |
Ga0207654_101711732 | 3300025911 | Corn Rhizosphere | GGAARDWPSRYGFSLLVFLWDLLDDSIDLFFWCDWIS |
Ga0207660_109487412 | 3300025917 | Corn Rhizosphere | QFFEHELKACAAKLGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIC |
Ga0207657_110482312 | 3300025919 | Corn Rhizosphere | EHELKACAAKLGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIS |
Ga0207650_115214891 | 3300025925 | Switchgrass Rhizosphere | RFFQKELKTCAARLGGAARDWPGRYGLSLLLFVWDMLDDSIDLFFWCDWLS |
Ga0207659_100576974 | 3300025926 | Miscanthus Rhizosphere | ARLGGAARDWPARYGLSLLLFIWDFLDDSIDLFCLGDWIS |
Ga0207690_101748331 | 3300025932 | Corn Rhizosphere | TCAARLGGAARDWPARYGFSLLLLSWDLLDDSIDLFFWCDWIT |
Ga0207686_102015091 | 3300025934 | Miscanthus Rhizosphere | ELGGHAKSWPTRYGFSLMLYFWDLLDDSIDLFFWCDWIC |
Ga0207711_110596141 | 3300025941 | Switchgrass Rhizosphere | ELKTCAARLGGAARDWPARYGFSLLLLFWNLLDDSIDLFFWRDWIS |
Ga0207677_118530772 | 3300026023 | Miscanthus Rhizosphere | AAKLGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIS |
Ga0207641_112439622 | 3300026088 | Switchgrass Rhizosphere | AHFFEHELKACAEELGGHAKSWPARYGFSLLLYFWDLLDDSIDLFFWCDWIC |
Ga0207676_105620581 | 3300026095 | Switchgrass Rhizosphere | CAAKLGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIS |
Ga0207683_116266911 | 3300026121 | Miscanthus Rhizosphere | AELGGAAKEWPSRYGFSVLLYFWDLLDDGIDLFFWCDWI |
Ga0209154_10607582 | 3300026317 | Soil | RAKTWPARYGFSLLLFLWDMVDDSIDLFFWCDWIS |
Ga0209471_10569731 | 3300026318 | Soil | VRDRMARFFEQELKACALELGERAKTWPARYGFSLLLFLWDMVDDSIDLFFWCDWIS |
Ga0209472_11038922 | 3300026323 | Soil | FFEHELKACAAELGGRAKSWPTRYNFSLLLYFWDLLDDSIDLFFWCDWIC |
Ga0209152_100411581 | 3300026325 | Soil | ELKVCALELGERAKTWPARYGFSLLLFLWDMLDDSIDLFFWCDWIS |
Ga0209378_12505841 | 3300026528 | Soil | FEQELKVCALELGERAKTWPARYGFSLLLFLWDMLDDSIDLFFWCDWIS |
Ga0207582_10115851 | 3300026960 | Soil | FFEHELKACAVELGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWVC |
Ga0209971_11096732 | 3300027682 | Arabidopsis Thaliana Rhizosphere | CVAQFFEHELKACAVELGGRAKSWPARYGFSLVLYFWDLLDDSIDLFFWCDWIC |
Ga0209974_103595832 | 3300027876 | Arabidopsis Thaliana Rhizosphere | TCAARLGGAARDWPARYGFSLFLFLWDLLDDSIDLFVWCDWIG |
Ga0307298_101040972 | 3300028717 | Soil | CAARLGGAARDWPARYGFSLLLFVWELLDDSIDLFFWCDWIC |
Ga0307280_101487881 | 3300028768 | Soil | CAAQLGGAARDWPGRYGFSLLLFVWDLLDDSIDLFFWCDWIC |
Ga0307282_105851632 | 3300028784 | Soil | GRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWIC |
Ga0307312_105044792 | 3300028828 | Soil | RDRVAQFFEHELKACAAELGGRAKSWPTRYGFSLMLYFWDLLDDSIDLFFWCDWIC |
Ga0307286_100116231 | 3300028876 | Soil | GGAARDWPARYGFSLLLFLWDLLDDSIDLFFWCDWIS |
Ga0075384_112755382 | 3300030841 | Soil | IGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWVC |
Ga0075373_116479532 | 3300030945 | Soil | RLGGAARDWPARYGFSLLLFLWDFFDDSIDLFFWCDWIS |
Ga0170822_120962962 | 3300031122 | Forest Soil | AKVRDRVAQFFEHELKACAAEIGGRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWVC |
Ga0170823_106919512 | 3300031128 | Forest Soil | GRAKSWPTRYGFSLLLYFWDLLDDSIDLFFWCDWVC |
Ga0170824_1171920021 | 3300031231 | Forest Soil | AELGGPAKEWPARYGFSLLLYFWDLLDDSIDLLFWCDWICGLY |
Ga0170820_158304651 | 3300031446 | Forest Soil | WLGGAARDWPARYGFSLLLLFWDLLDDSIDLFFWCDWIP |
Ga0170819_123252342 | 3300031469 | Forest Soil | FFKKELKICAARLGGAARRWPGRYGFSLLLFFWDLLDDSIDLLFRCDWIC |
Ga0170818_1127479171 | 3300031474 | Forest Soil | KACAAELGGPAKEWPARYGFSLLLYFWDLLDDSIDLLFWCDWIC |
Ga0310887_102489652 | 3300031547 | Soil | KELKACAARLGGPARDWPARYGFSLLLFVWDLLDDSIDLFFWCDWIA |
Ga0318560_105877591 | 3300031682 | Soil | ARRLGGAARDWPGRYGFSLLLLFWDLLDDSIDLFFWCDWIS |
Ga0310813_106057012 | 3300031716 | Soil | FQKELKTCAARLGGAARDWPGRYGLSLLLFVWDMLDDSIDLFFWCDWLS |
Ga0307469_101842612 | 3300031720 | Hardwood Forest Soil | ALELAGRAKSWPSRYGFSLLLFFWDLLDDSIDLLFWCDWIA |
Ga0318501_108520552 | 3300031736 | Soil | AKVRDRVARFFEHELKACASELGGRAKSWPTRYGFSMLLFFWDLLDDSIDLLFWCDWIC |
Ga0307473_104125352 | 3300031820 | Hardwood Forest Soil | LKACALELAGRAKSWPSRYGFSLLLFFWDLLDDSIDLLFWCDWIA |
Ga0310907_102464681 | 3300031847 | Soil | KACAARLGGPARDWPARYGFSLLLFVWDLLDDSIDLFFWCDWIA |
Ga0306921_101011356 | 3300031912 | Soil | CATRLGGAARNWPARYGFSLLLLFWDLLDDSIDLFFWCDWIS |
Ga0306921_114436551 | 3300031912 | Soil | GGRAKGWPARYGFSVLLYFWDLLDDSIDLFFWCDWIC |
Ga0310916_104380953 | 3300031942 | Soil | LKTCATRLGGAARNWPARYGFSLLLLFWDLLDDSIDLFFWCDWIS |
Ga0310884_110422441 | 3300031944 | Soil | GAARDWPARYGFSLLVFLWDLLDDSIDLFFWCDWIS |
Ga0308176_118546092 | 3300031996 | Soil | FKKELKMCAARLGGAARDWPARYGFSLLLLFWDLLDDSIDLFFWCDWIS |
Ga0306922_107413771 | 3300032001 | Soil | LGGAARDWPARYGLPLLLFVWDLLDDSIDLFFWSDWIS |
Ga0306924_118253901 | 3300032076 | Soil | MARFFEHELKACALKLGGRAKSWPTRYGFSMVLFFWDLLDDSIDLLFWCDWIC |
Ga0307472_1011461821 | 3300032205 | Hardwood Forest Soil | EHELKACASELGGHAKSWPARYGFSLLLYFWDLLDDSIDLLFWCDWIC |
Ga0306920_1021718341 | 3300032261 | Soil | AARLGGAARDWPARYGFSLVLFVWDLLDDSIDLFFWCDWIS |
Ga0310914_107673572 | 3300033289 | Soil | KELKTCAARLGGAARDWPARYGFSLLLPVWDLLDDSFDLFFWLDWIS |
Ga0310810_101545051 | 3300033412 | Soil | RLGGAARDWPGRYGLSLLLFVWDMLDDSIDLFFWCDWLS |
Ga0310810_112121351 | 3300033412 | Soil | GRARSWPTRYGFSMLLFFWDLMDDSIDLLFWCDWVA |
Ga0364933_221103_1_180 | 3300034150 | Sediment | AKVRDRMAQFFEHELKACASELGSRAKSWPTRYGFSTLLFFWNLLDDSIDLLFWCDWIC |
⦗Top⦘ |