NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F031610

Metagenome / Metatranscriptome Family F031610

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031610
Family Type Metagenome / Metatranscriptome
Number of Sequences 182
Average Sequence Length 40 residues
Representative Sequence GYPGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD
Number of Associated Samples 162
Number of Associated Scaffolds 182

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.55 %
% of genes from short scaffolds (< 2000 bps) 0.00 %
Associated GOLD sequencing projects 155
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (99.451 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.385 % of family members)
Environment Ontology (ENVO) Unclassified
(25.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.901 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 56.41%    β-sheet: 0.00%    Coil/Unstructured: 43.59%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 182 Family Scaffolds
PF00206Lyase_1 28.57
PF10415FumaraseC_C 6.59
PF03167UDG 5.49
PF03793PASTA 4.40
PF03576Peptidase_S58 2.20
PF00106adh_short 1.10
PF00903Glyoxalase 1.10
PF00208ELFV_dehydrog 1.10
PF05547Peptidase_M6 0.55
PF02812ELFV_dehydrog_N 0.55
PF14016DUF4232 0.55
PF04055Radical_SAM 0.55
PF08281Sigma70_r4_2 0.55
PF00107ADH_zinc_N 0.55
PF02621VitK2_biosynth 0.55
PF00440TetR_N 0.55
PF01636APH 0.55
PF13620CarboxypepD_reg 0.55
PF13302Acetyltransf_3 0.55
PF00117GATase 0.55
PF028262-Hacid_dh_C 0.55
PF01361Tautomerase 0.55
PF12146Hydrolase_4 0.55
PF01471PG_binding_1 0.55
PF01850PIN 0.55
PF07731Cu-oxidase_2 0.55
PF07687M20_dimer 0.55
PF02113Peptidase_S13 0.55
PF13228DUF4037 0.55
PF02012BNR 0.55
PF07883Cupin_2 0.55
PF00089Trypsin 0.55
PF030614HBT 0.55
PF00459Inositol_P 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 182 Family Scaffolds
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 5.49
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 5.49
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 5.49
COG3191L-aminopeptidase/D-esteraseAmino acid transport and metabolism [E] 4.40
COG0334Glutamate dehydrogenase/leucine dehydrogenaseAmino acid transport and metabolism [E] 1.65
COG2902NAD-specific glutamate dehydrogenaseAmino acid transport and metabolism [E] 1.10
COG1427Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway)Coenzyme transport and metabolism [H] 0.55
COG1942Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.55
COG2027D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.55
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.55
COG4412Bacillopeptidase F, M6 metalloprotease familyPosttranslational modification, protein turnover, chaperones [O] 0.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A99.45 %
All OrganismsrootAll Organisms0.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300014968|Ga0157379_10122509All Organisms → cellular organisms → Bacteria2340Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.24%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.59%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.85%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand3.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.20%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.20%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.20%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.20%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.65%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.65%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.10%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.10%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil1.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.10%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.10%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.55%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.55%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.55%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.55%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.55%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.55%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.55%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.55%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.55%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002564Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012187Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300025864Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026940Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027169Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034143Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNSEnvironmentalOpen in IMG/M
3300034174Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1017435613300000597Forest SoilVAGYPGKITLITIGMGEAAIAANNAIASIRGEKVQPKYSTD*
JGI10213J12805_1015384413300000858SoilKITLITIGMGEAAIAANNAIAAIRGEKVQPKYSTD*
JGI11643J12802_1055978413300000890SoilITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD*
JGI11643J12802_1219501823300000890SoilGYPGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD*
JGI24134J36421_1002794413300002564Arctic Peat SoilGYEGKITLITVALAEAAMAANNAIAEIRHEKAQPEYSSE*
C688J35102_12096831513300002568SoilDVAGFDGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE*
Ga0055472_1000043983300003998Natural And Restored WetlandsDVAGYEGKITLITVGFGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0063454_10169109213300004081SoilGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD*
Ga0063455_10070778513300004153SoilGYDGKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE*
Ga0062590_10150676413300004157SoilGYEGKITLISVGFGEAAIAANNAIAQIRGEKVQPKYSTD*
Ga0062595_10144650323300004479SoilAGFDGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE*
Ga0062591_10005482333300004643SoilGYEGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD*
Ga0066679_1070280913300005176SoilAGYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD*
Ga0066690_1097115213300005177SoilGYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD*
Ga0066688_1049370633300005178SoilVAGYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD*
Ga0070691_1025525313300005341Corn, Switchgrass And Miscanthus RhizosphereGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD*
Ga0070692_1099565213300005345Corn, Switchgrass And Miscanthus RhizosphereDVAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD*
Ga0070709_1057681133300005434Corn, Switchgrass And Miscanthus RhizosphereVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD*
Ga0070709_1059717533300005434Corn, Switchgrass And Miscanthus RhizosphereGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD*
Ga0070700_10054142113300005441Corn, Switchgrass And Miscanthus RhizosphereGDVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD*
Ga0066681_1096721923300005451SoilVAGYPGKITLITIGMGEAAIAANNAVATIRGEKVQPKYSTD*
Ga0070662_10008785613300005457Corn RhizosphereVAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD*
Ga0073909_1017944333300005526Surface SoilITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0073909_1062021323300005526Surface SoilGDVAGYEGKITLITVGFSEAAIAANHCVARIRGEKVQPKYSTE*
Ga0070693_10018688313300005547Corn, Switchgrass And Miscanthus RhizosphereDVAGYEGKITLITVGFSEAAIAANHCVARIRGEKVQPKYSTE*
Ga0066695_1016900923300005553SoilGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD*
Ga0066704_1011393813300005557SoilVAGYDGKITLITVGMGEAAIAANNAIAAIRGEKVQPKYSTD*
Ga0066670_1081552533300005560SoilITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD*
Ga0068854_10227834513300005578Corn RhizosphereDVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD*
Ga0066905_10166296213300005713Tropical Forest SoilAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD*
Ga0068861_10181087913300005719Switchgrass RhizosphereYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD*
Ga0066903_10720058523300005764Tropical Forest SoilVAYYDGKITLITIGLGEAAIAANQCVARVRGVKVQPAYSSE*
Ga0068851_1053248923300005834Corn RhizosphereDGKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE*
Ga0068862_10076333413300005844Switchgrass RhizosphereMAGYDGKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE*
Ga0066794_1008199623300005947SoilDVAGYEGKITLITIALAEAAIAANNAIAEIRHEKAQPEYSSE*
Ga0066651_1017597013300006031SoilAAGDVAGYPGKITLITIGMGEAAIAANNAVATIRGEKVQPKYSTD*
Ga0066651_1025532213300006031SoilAAGDVAGYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD*
Ga0066656_1075424413300006034SoilGYPGKITLITIGMGEAAIAANNAIAQIRGGKVQPKYSTD*
Ga0066652_10007750313300006046SoilPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD*
Ga0066652_10141862713300006046SoilDVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD*
Ga0070716_10108457123300006173Corn, Switchgrass And Miscanthus RhizosphereDVAGYEGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD*
Ga0070712_10179162733300006175Corn, Switchgrass And Miscanthus RhizosphereKITLITIGMGEAAIAANNAVAAIRDEKVQPKYSTD*
Ga0068871_10135491433300006358Miscanthus RhizosphereDVAGYEGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE*
Ga0074059_1179017433300006578SoilAGYDGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE*
Ga0075430_10002294873300006846Populus RhizosphereAAGDVAGYPGKITLITIGMGEAAIAANNAIAQFRGEKVQPKYSTD*
Ga0075429_10118077323300006880Populus RhizosphereGKITLISIGFGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0068865_10171889913300006881Miscanthus RhizosphereAGDVAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD*
Ga0079215_1088332633300006894Agricultural SoilVAGYDGKITLISVGFGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0074063_1000927633300006953SoilAAGDVAGYPGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0079219_1049206533300006954Agricultural SoilAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD*
Ga0099830_1091503223300009088Vadose Zone SoilDVAGYEGKITLITVGMGEASIAANNAIAEIRGEKVQPKYSTE*
Ga0105241_1242968723300009174Corn RhizosphereAGFDGKITLITVGFAEAALAANHAVARIRGEKAQPKYSTE*
Ga0105242_1166327533300009176Miscanthus RhizosphereGYDGKITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0105242_1291449423300009176Miscanthus RhizosphereVAYYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE*
Ga0105056_104980713300009801Groundwater SandKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0105088_104312523300009810Groundwater SandKITLISVGFGEAAIAANNAIAKIRGEKVQPKYSTD*
Ga0105058_116229013300009837Groundwater SandKITLITVGMGEAAIAANNAIAAIRGEKVQPKYSTD*
Ga0126313_1001234453300009840Serpentine SoilDVAGYPGKITLITVGMGEAAIAANNAIAAMRGEKVQPKYSTD*
Ga0126313_1138277713300009840Serpentine SoilWDVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD*
Ga0126305_1021451823300010036Serpentine SoilGSHVAAVAQAVGYEGKITLITIGMAEAAIAANNAVAQIHGEKVQPKYSTD*
Ga0126305_1073155513300010036Serpentine SoilITLITVGMGEAAIAANNAIAAIRGEKVQPKYSTD*
Ga0126308_1006434933300010040Serpentine SoilKITLISVGFGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0126380_1167090213300010043Tropical Forest SoilAAGDVAGYPGKITLITIGMGEAAIAANNAIAAIRGEKVQPKYSTD*
Ga0126310_1129337633300010044Serpentine SoilGYAGKITLITVGMGEAAIAANNVIAAIRGEKVQPKYSTD*
Ga0126311_1000721883300010045Serpentine SoilAGDVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD*
Ga0126382_1079046223300010047Tropical Forest SoilGYEGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0134065_1043842033300010326Grasslands SoilGYPGKITLITIGMGEAAIAANNAVATIRGEKVQPKYSTD*
Ga0134062_1074125913300010337Grasslands SoilGDVAGYPGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD*
Ga0126376_1176146413300010359Tropical Forest SoilGDVAGYEGKITLITIGMGEAAIAENNAVASIRGEKVQPKYSTD*
Ga0134124_1044052533300010397Terrestrial SoilYEGKITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0134124_1064393433300010397Terrestrial SoilAGDVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD*
Ga0134124_1164312123300010397Terrestrial SoilGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD*
Ga0151490_128960713300011107SoilGDVAGYDGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE*
Ga0137429_119813623300011437SoilEGKITLISIGFGEAAIAANQAVAKIRGEKVQPKYSTD*
Ga0120134_103265913300012004PermafrostKITLITIGLGEAAIATNQCVARARGVKLQPAYSTE*
Ga0136622_1015052113300012187Polar Desert SandPGKITLITIGMGEAAIAANNAVAQIRGEKPQPKYSTD*
Ga0137364_1115076313300012198Vadose Zone SoilPGVSAAGDVAGYPAKITLITIGMGEPAIPANNALASIRGEKVQPKYSTD*
Ga0137381_1163450313300012207Vadose Zone SoilAAGDVAGYPGKITLITIGMGEAAVAANNAVAQIRGEKVQPKYSTD*
Ga0137376_1124277233300012208Vadose Zone SoilDVAGYPGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD*
Ga0137377_1050824413300012211Vadose Zone SoilYPGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD*
Ga0137377_1145090013300012211Vadose Zone SoilGDVAGYPGKITLITIGIGEAAIAANNAVAAIRGENVQPKYSTD*
Ga0137373_1013774813300012532Vadose Zone SoilKITLITIGMGEAAVAANNAIAQIRGEKVQPKYSTD*
Ga0157300_100833423300012884SoilDVAGYEGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0164302_1062433613300012961SoilGYPGTITLITIGMGEAAIAATKAVAAIRREKVQPKYSTD*
Ga0134087_1053329923300012977Grasslands SoilDVAGYPGKITLITIGMGEAAIAANNAVAEIRGEKVQPKYSTD*
Ga0164309_1023598823300012984SoilYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD*
Ga0164307_1106946113300012987SoilGYEGKITLITVGFSEAALAANHAVAHIRGEKAQPKYSTE*
Ga0164305_1059970013300012989SoilYEGKITLITVGFSEAALAANHAVAHIRGEKAQPKYSTE*
Ga0157370_1037340713300013104Corn RhizosphereITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE*
Ga0163162_1078793933300013306Switchgrass RhizosphereEGKITLISIGFGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0120154_108279023300013501PermafrostITLITIGMGEAAIAANNVIARIRGEKVQPKYSTD*
Ga0120179_115303513300013763PermafrostPGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD*
Ga0134078_1027568733300014157Grasslands SoilAGDVAGYPGKITLITVGMGEAAIAANNAVAQIRGEKVQPKYSTD*
Ga0075326_105638133300014271Natural And Restored WetlandsVAGYEGKITLITIGFGAAAIAANNAIARIRGEKVQPKYSTD*
Ga0157380_1103672323300014326Switchgrass RhizosphereVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD*
Ga0182001_1052399323300014488SoilKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD*
Ga0182027_1078159523300014839FenVAGYEGKITLITIALAEAAMAANNAVAEIRHEKAQPEYSSE*
Ga0157379_1012250943300014968Switchgrass RhizosphereYEGKITLITVGFSEAAIAANHCVARIRGEKVQPKYSTE*
Ga0132258_1147285643300015371Arabidopsis RhizosphereAGDVAGYEGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE*
Ga0132256_10342338013300015372Arabidopsis RhizosphereITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD*
Ga0132257_10037290643300015373Arabidopsis RhizosphereAGDGAGYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD*
Ga0132255_10197072213300015374Arabidopsis RhizosphereGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD*
Ga0184608_1018925533300018028Groundwater SedimentGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD
Ga0184634_1021853813300018031Groundwater SedimentKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD
Ga0184634_1029706433300018031Groundwater SedimentGYEGKITLISIGFGEAAVAANNAIARIRGEKVQPKYSTD
Ga0184624_1027284423300018073Groundwater SedimentAAGDVAGYEGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD
Ga0184624_1028777413300018073Groundwater SedimentGKITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD
Ga0066655_1053736013300018431Grasslands SoilYPGKITLITIGMGEAAIAANNAVATIRGEKVQPKYSTD
Ga0190275_1318926833300018432SoilGKITLITVGFGEAAIAANNAIAKIRGEKVQPKYSTD
Ga0066662_1213368823300018468Grasslands SoilGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD
Ga0066669_1097543913300018482Grasslands SoilPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD
Ga0190264_1120898823300019377SoilKITLISIGFGEAAIAANQAIARIRGEKIQPKYSTD
Ga0193704_104703513300019867SoilGYPGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD
Ga0193705_105258513300019869SoilGDVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD
Ga0193755_117238313300020004SoilAGDVAYYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE
Ga0193697_100397313300020005SoilAGYEGKITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD
Ga0193721_107190713300020018SoilGKITLITIGMGEAAIAANNALAMIRGEKVQPKYSTD
Ga0210381_1003637313300021078Groundwater SedimentGDVAGYPGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD
Ga0182009_1069312313300021445SoilAAGDVAGYPGKITLITVGMGEAAIAANNAIAQIRGEKVQPKYSTD
Ga0222623_1034143413300022694Groundwater SedimentVAGYPGKITLITIGMGEAAIAANNAIAHIRGEKVQPKYSTD
Ga0222622_1031671433300022756Groundwater SedimentKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD
Ga0222622_1094140723300022756Groundwater SedimentAGDVAGYEGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE
Ga0247672_104318733300024187SoilAGDVAGYPGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD
Ga0209429_1013301513300025864Arctic Peat SoilDVAGYEGKITLITIGLAEAAMAANNAVAEIRHEKAQPEYSSE
Ga0207685_1004419013300025905Corn, Switchgrass And Miscanthus RhizosphereGDVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD
Ga0207654_1129815723300025911Corn RhizosphereYEGKITLITVGFSEAAIAANHCVARIRGEKVQPKYSTE
Ga0207693_1028095213300025915Corn, Switchgrass And Miscanthus RhizosphereAGYPGKITLITIGMGEAAIAANNAVAAIRDEKVQPKYSTD
Ga0207662_1085403813300025918Switchgrass RhizosphereEGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD
Ga0207687_1154494323300025927Miscanthus RhizosphereGKITLISIGFGEAAIAANNAIARIRGEKVQPKYSTD
Ga0207690_1043303723300025932Corn RhizosphereAAGDVAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD
Ga0207709_1067262123300025935Miscanthus RhizosphereYEGKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE
Ga0207665_1082573523300025939Corn, Switchgrass And Miscanthus RhizosphereYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD
Ga0207665_1098703423300025939Corn, Switchgrass And Miscanthus RhizosphereVAYYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE
Ga0207679_1026423813300025945Corn RhizosphereYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD
Ga0207640_1091623113300025981Corn RhizosphereGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD
Ga0207640_1126185833300025981Corn RhizosphereAAGDVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD
Ga0207677_1049322733300026023Miscanthus RhizosphereVAGYEGKITLISIGFGEAAIAANNAIARIRGEKVQPKYSTD
Ga0207639_1077571613300026041Corn RhizosphereVAGFYGKITLITVGFSEAALSANHAVARIRGEKAQPKYSTE
Ga0207641_1110783333300026088Switchgrass RhizosphereGDVAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD
Ga0209027_128284523300026300Grasslands SoilVAGYPGKITLITVGMGEAAIAANNAIAEIRGEKVQPKYSTD
Ga0256867_1001120243300026535SoilGYEGKITLISIGFGEAAIAANQAVAKIRGEKVQPKYSTD
Ga0207521_10425133300026940SoilMLAIGRAAGDVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD
Ga0209897_105290223300027169Groundwater SandEGKITLISVGFGEAAIAANNAIAKIRGEKVQPKYSTD
Ga0209842_100544733300027379Groundwater SandGYEGKITLISVGFGEAAVAANQAVAKIRGEKVQPKYSTD
Ga0209842_107930633300027379Groundwater SandGKITLISVGFGEAAVAANQAVAKIRGEKVQPKYSTD
Ga0209074_1022126913300027787Agricultural SoilDVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD
Ga0209574_1036008723300027809AgaveFDGKITLITVGFAEAALAANHAVARIRGEKAQPKYSTE
Ga0209465_1060265223300027874Tropical Forest SoilDGKITLITVGFSEAAIAANHAVARIRGEKAQPKYSTE
Ga0207428_1003360543300027907Populus RhizosphereGYEGKITLISIGFGEAAIAANNAIARIRGEKVQPKYSTD
Ga0209382_1054059213300027909Populus RhizosphereGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD
Ga0209889_112268623300027952Groundwater SandKITLISVGFGEAAIAANNAIAAIRGEKVQPKYSTD
Ga0268265_1065907233300028380Switchgrass RhizosphereAAGDMAGYDGKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE
Ga0268265_1067042813300028380Switchgrass RhizosphereGDVAGYEGKITLITVGFSEAAIAANHCVARIRGEKVQPKYSTE
Ga0265319_124062223300028563RhizosphereAHYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE
Ga0265334_1022209513300028573RhizosphereVAHYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE
Ga0247828_1058747113300028587SoilDGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE
Ga0307291_112636113300028707SoilKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD
Ga0307322_1009988623300028710SoilVAGYPGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD
Ga0307322_1019827613300028710SoilDGKITLISVGFGEAAIAANNAIARIRGEKVQPKYSTD
Ga0307307_1030799923300028718SoilPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD
Ga0307301_1000631843300028719SoilGYEGKITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD
Ga0307297_1000184163300028754SoilDVAGYPGKITLITIGMGEAAIAANNAVAEIRGEKVQPKYSTD
Ga0307306_1000201613300028782SoilGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD
Ga0307323_1025182513300028787SoilGYPGKITLITIGMGEAAIAANNAVAEIRGEKVQPKYSTD
Ga0307323_1026630523300028787SoilVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD
Ga0307284_1010913123300028799SoilYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD
Ga0307312_1094572223300028828SoilDVAGYPGKITLITIGMGEAAIASNNAIALIRGEKVQPKYSTD
Ga0307314_1016559513300028872SoilGDVAGYEGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE
Ga0307286_1024126723300028876SoilGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD
Ga0307278_1044055013300028878SoilAAGDVAGYPEKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD
Ga0307308_1042235523300028884SoilAAGDVAGYPGKITLITIGMGEAAIAANNAVAAIQGEKVQPKYSTD
Ga0311336_1129953413300029990FenGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE
Ga0302299_1058283823300030010FenEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE
Ga0299914_1107121413300031228SoilEGKITLITIGFGEAAIAANNAIAKIRGEKVQPKYSTD
Ga0307469_1162104223300031720Hardwood Forest SoilDVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD
Ga0311351_1143035413300031722FenGYEGKITLITIALAEAAMAANNAVAEIRHEKAQPEYSSE
Ga0307468_10230868923300031740Hardwood Forest SoilKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE
Ga0308175_10042162923300031938SoilGYEGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD
Ga0308176_1138651923300031996SoilGYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD
Ga0307471_10253710823300032180Hardwood Forest SoilGDVAYYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE
Ga0334961_022882_942_10583300034143Sub-Biocrust SoilYDGKITLITIGLGEAAIAANQCVARVRGVKVQPTYSTE
Ga0334932_073124_1_1263300034174Sub-Biocrust SoilVAGYEGKITLITIGMGEAAVAANNAIARIRGEKVQPKYSTD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.