Basic Information | |
---|---|
Family ID | F031610 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 182 |
Average Sequence Length | 40 residues |
Representative Sequence | GYPGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD |
Number of Associated Samples | 162 |
Number of Associated Scaffolds | 182 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.55 % |
% of genes from short scaffolds (< 2000 bps) | 0.00 % |
Associated GOLD sequencing projects | 155 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.451 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.385 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.275 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.901 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.41% β-sheet: 0.00% Coil/Unstructured: 43.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 182 Family Scaffolds |
---|---|---|
PF00206 | Lyase_1 | 28.57 |
PF10415 | FumaraseC_C | 6.59 |
PF03167 | UDG | 5.49 |
PF03793 | PASTA | 4.40 |
PF03576 | Peptidase_S58 | 2.20 |
PF00106 | adh_short | 1.10 |
PF00903 | Glyoxalase | 1.10 |
PF00208 | ELFV_dehydrog | 1.10 |
PF05547 | Peptidase_M6 | 0.55 |
PF02812 | ELFV_dehydrog_N | 0.55 |
PF14016 | DUF4232 | 0.55 |
PF04055 | Radical_SAM | 0.55 |
PF08281 | Sigma70_r4_2 | 0.55 |
PF00107 | ADH_zinc_N | 0.55 |
PF02621 | VitK2_biosynth | 0.55 |
PF00440 | TetR_N | 0.55 |
PF01636 | APH | 0.55 |
PF13620 | CarboxypepD_reg | 0.55 |
PF13302 | Acetyltransf_3 | 0.55 |
PF00117 | GATase | 0.55 |
PF02826 | 2-Hacid_dh_C | 0.55 |
PF01361 | Tautomerase | 0.55 |
PF12146 | Hydrolase_4 | 0.55 |
PF01471 | PG_binding_1 | 0.55 |
PF01850 | PIN | 0.55 |
PF07731 | Cu-oxidase_2 | 0.55 |
PF07687 | M20_dimer | 0.55 |
PF02113 | Peptidase_S13 | 0.55 |
PF13228 | DUF4037 | 0.55 |
PF02012 | BNR | 0.55 |
PF07883 | Cupin_2 | 0.55 |
PF00089 | Trypsin | 0.55 |
PF03061 | 4HBT | 0.55 |
PF00459 | Inositol_P | 0.55 |
COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
---|---|---|---|
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 5.49 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 5.49 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 5.49 |
COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 4.40 |
COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 1.65 |
COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 1.10 |
COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.55 |
COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.55 |
COG4412 | Bacillopeptidase F, M6 metalloprotease family | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.45 % |
All Organisms | root | All Organisms | 0.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300014968|Ga0157379_10122509 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.24% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.59% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.85% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.85% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.85% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.20% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.20% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.20% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.20% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.65% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.65% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.65% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.65% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.10% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.10% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.10% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.10% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.10% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.55% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.55% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.55% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.55% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.55% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.55% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.55% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.55% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.55% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300002564 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300026940 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1-12 (SPAdes) | Environmental | Open in IMG/M |
3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_101743561 | 3300000597 | Forest Soil | VAGYPGKITLITIGMGEAAIAANNAIASIRGEKVQPKYSTD* |
JGI10213J12805_101538441 | 3300000858 | Soil | KITLITIGMGEAAIAANNAIAAIRGEKVQPKYSTD* |
JGI11643J12802_105597841 | 3300000890 | Soil | ITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD* |
JGI11643J12802_121950182 | 3300000890 | Soil | GYPGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD* |
JGI24134J36421_100279441 | 3300002564 | Arctic Peat Soil | GYEGKITLITVALAEAAMAANNAIAEIRHEKAQPEYSSE* |
C688J35102_1209683151 | 3300002568 | Soil | DVAGFDGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE* |
Ga0055472_100004398 | 3300003998 | Natural And Restored Wetlands | DVAGYEGKITLITVGFGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0063454_1016910921 | 3300004081 | Soil | GYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD* |
Ga0063455_1007077851 | 3300004153 | Soil | GYDGKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE* |
Ga0062590_1015067641 | 3300004157 | Soil | GYEGKITLISVGFGEAAIAANNAIAQIRGEKVQPKYSTD* |
Ga0062595_1014465032 | 3300004479 | Soil | AGFDGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE* |
Ga0062591_1000548233 | 3300004643 | Soil | GYEGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD* |
Ga0066679_107028091 | 3300005176 | Soil | AGYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD* |
Ga0066690_109711521 | 3300005177 | Soil | GYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD* |
Ga0066688_104937063 | 3300005178 | Soil | VAGYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD* |
Ga0070691_102552531 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | GYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD* |
Ga0070692_109956521 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | DVAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD* |
Ga0070709_105768113 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD* |
Ga0070709_105971753 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD* |
Ga0070700_1005414211 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GDVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD* |
Ga0066681_109672192 | 3300005451 | Soil | VAGYPGKITLITIGMGEAAIAANNAVATIRGEKVQPKYSTD* |
Ga0070662_1000878561 | 3300005457 | Corn Rhizosphere | VAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD* |
Ga0073909_101794433 | 3300005526 | Surface Soil | ITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0073909_106202132 | 3300005526 | Surface Soil | GDVAGYEGKITLITVGFSEAAIAANHCVARIRGEKVQPKYSTE* |
Ga0070693_1001868831 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DVAGYEGKITLITVGFSEAAIAANHCVARIRGEKVQPKYSTE* |
Ga0066695_101690092 | 3300005553 | Soil | GKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD* |
Ga0066704_101139381 | 3300005557 | Soil | VAGYDGKITLITVGMGEAAIAANNAIAAIRGEKVQPKYSTD* |
Ga0066670_108155253 | 3300005560 | Soil | ITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD* |
Ga0068854_1022783451 | 3300005578 | Corn Rhizosphere | DVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD* |
Ga0066905_1016629621 | 3300005713 | Tropical Forest Soil | AGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD* |
Ga0068861_1018108791 | 3300005719 | Switchgrass Rhizosphere | YPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD* |
Ga0066903_1072005852 | 3300005764 | Tropical Forest Soil | VAYYDGKITLITIGLGEAAIAANQCVARVRGVKVQPAYSSE* |
Ga0068851_105324892 | 3300005834 | Corn Rhizosphere | DGKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE* |
Ga0068862_1007633341 | 3300005844 | Switchgrass Rhizosphere | MAGYDGKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE* |
Ga0066794_100819962 | 3300005947 | Soil | DVAGYEGKITLITIALAEAAIAANNAIAEIRHEKAQPEYSSE* |
Ga0066651_101759701 | 3300006031 | Soil | AAGDVAGYPGKITLITIGMGEAAIAANNAVATIRGEKVQPKYSTD* |
Ga0066651_102553221 | 3300006031 | Soil | AAGDVAGYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD* |
Ga0066656_107542441 | 3300006034 | Soil | GYPGKITLITIGMGEAAIAANNAIAQIRGGKVQPKYSTD* |
Ga0066652_1000775031 | 3300006046 | Soil | PGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD* |
Ga0066652_1014186271 | 3300006046 | Soil | DVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD* |
Ga0070716_1010845712 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DVAGYEGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD* |
Ga0070712_1017916273 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KITLITIGMGEAAIAANNAVAAIRDEKVQPKYSTD* |
Ga0068871_1013549143 | 3300006358 | Miscanthus Rhizosphere | DVAGYEGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE* |
Ga0074059_117901743 | 3300006578 | Soil | AGYDGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE* |
Ga0075430_1000229487 | 3300006846 | Populus Rhizosphere | AAGDVAGYPGKITLITIGMGEAAIAANNAIAQFRGEKVQPKYSTD* |
Ga0075429_1011807732 | 3300006880 | Populus Rhizosphere | GKITLISIGFGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0068865_1017188991 | 3300006881 | Miscanthus Rhizosphere | AGDVAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD* |
Ga0079215_108833263 | 3300006894 | Agricultural Soil | VAGYDGKITLISVGFGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0074063_100092763 | 3300006953 | Soil | AAGDVAGYPGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0079219_104920653 | 3300006954 | Agricultural Soil | AGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD* |
Ga0099830_109150322 | 3300009088 | Vadose Zone Soil | DVAGYEGKITLITVGMGEASIAANNAIAEIRGEKVQPKYSTE* |
Ga0105241_124296872 | 3300009174 | Corn Rhizosphere | AGFDGKITLITVGFAEAALAANHAVARIRGEKAQPKYSTE* |
Ga0105242_116632753 | 3300009176 | Miscanthus Rhizosphere | GYDGKITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0105242_129144942 | 3300009176 | Miscanthus Rhizosphere | VAYYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE* |
Ga0105056_10498071 | 3300009801 | Groundwater Sand | KITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0105088_10431252 | 3300009810 | Groundwater Sand | KITLISVGFGEAAIAANNAIAKIRGEKVQPKYSTD* |
Ga0105058_11622901 | 3300009837 | Groundwater Sand | KITLITVGMGEAAIAANNAIAAIRGEKVQPKYSTD* |
Ga0126313_100123445 | 3300009840 | Serpentine Soil | DVAGYPGKITLITVGMGEAAIAANNAIAAMRGEKVQPKYSTD* |
Ga0126313_113827771 | 3300009840 | Serpentine Soil | WDVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD* |
Ga0126305_102145182 | 3300010036 | Serpentine Soil | GSHVAAVAQAVGYEGKITLITIGMAEAAIAANNAVAQIHGEKVQPKYSTD* |
Ga0126305_107315551 | 3300010036 | Serpentine Soil | ITLITVGMGEAAIAANNAIAAIRGEKVQPKYSTD* |
Ga0126308_100643493 | 3300010040 | Serpentine Soil | KITLISVGFGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0126380_116709021 | 3300010043 | Tropical Forest Soil | AAGDVAGYPGKITLITIGMGEAAIAANNAIAAIRGEKVQPKYSTD* |
Ga0126310_112933763 | 3300010044 | Serpentine Soil | GYAGKITLITVGMGEAAIAANNVIAAIRGEKVQPKYSTD* |
Ga0126311_100072188 | 3300010045 | Serpentine Soil | AGDVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD* |
Ga0126382_107904622 | 3300010047 | Tropical Forest Soil | GYEGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0134065_104384203 | 3300010326 | Grasslands Soil | GYPGKITLITIGMGEAAIAANNAVATIRGEKVQPKYSTD* |
Ga0134062_107412591 | 3300010337 | Grasslands Soil | GDVAGYPGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD* |
Ga0126376_117614641 | 3300010359 | Tropical Forest Soil | GDVAGYEGKITLITIGMGEAAIAENNAVASIRGEKVQPKYSTD* |
Ga0134124_104405253 | 3300010397 | Terrestrial Soil | YEGKITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0134124_106439343 | 3300010397 | Terrestrial Soil | AGDVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD* |
Ga0134124_116431212 | 3300010397 | Terrestrial Soil | GKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD* |
Ga0151490_12896071 | 3300011107 | Soil | GDVAGYDGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE* |
Ga0137429_11981362 | 3300011437 | Soil | EGKITLISIGFGEAAIAANQAVAKIRGEKVQPKYSTD* |
Ga0120134_10326591 | 3300012004 | Permafrost | KITLITIGLGEAAIATNQCVARARGVKLQPAYSTE* |
Ga0136622_101505211 | 3300012187 | Polar Desert Sand | PGKITLITIGMGEAAIAANNAVAQIRGEKPQPKYSTD* |
Ga0137364_111507631 | 3300012198 | Vadose Zone Soil | PGVSAAGDVAGYPAKITLITIGMGEPAIPANNALASIRGEKVQPKYSTD* |
Ga0137381_116345031 | 3300012207 | Vadose Zone Soil | AAGDVAGYPGKITLITIGMGEAAVAANNAVAQIRGEKVQPKYSTD* |
Ga0137376_112427723 | 3300012208 | Vadose Zone Soil | DVAGYPGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD* |
Ga0137377_105082441 | 3300012211 | Vadose Zone Soil | YPGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD* |
Ga0137377_114509001 | 3300012211 | Vadose Zone Soil | GDVAGYPGKITLITIGIGEAAIAANNAVAAIRGENVQPKYSTD* |
Ga0137373_101377481 | 3300012532 | Vadose Zone Soil | KITLITIGMGEAAVAANNAIAQIRGEKVQPKYSTD* |
Ga0157300_10083342 | 3300012884 | Soil | DVAGYEGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0164302_106243361 | 3300012961 | Soil | GYPGTITLITIGMGEAAIAATKAVAAIRREKVQPKYSTD* |
Ga0134087_105332992 | 3300012977 | Grasslands Soil | DVAGYPGKITLITIGMGEAAIAANNAVAEIRGEKVQPKYSTD* |
Ga0164309_102359882 | 3300012984 | Soil | YPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD* |
Ga0164307_110694611 | 3300012987 | Soil | GYEGKITLITVGFSEAALAANHAVAHIRGEKAQPKYSTE* |
Ga0164305_105997001 | 3300012989 | Soil | YEGKITLITVGFSEAALAANHAVAHIRGEKAQPKYSTE* |
Ga0157370_103734071 | 3300013104 | Corn Rhizosphere | ITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE* |
Ga0163162_107879393 | 3300013306 | Switchgrass Rhizosphere | EGKITLISIGFGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0120154_10827902 | 3300013501 | Permafrost | ITLITIGMGEAAIAANNVIARIRGEKVQPKYSTD* |
Ga0120179_11530351 | 3300013763 | Permafrost | PGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD* |
Ga0134078_102756873 | 3300014157 | Grasslands Soil | AGDVAGYPGKITLITVGMGEAAIAANNAVAQIRGEKVQPKYSTD* |
Ga0075326_10563813 | 3300014271 | Natural And Restored Wetlands | VAGYEGKITLITIGFGAAAIAANNAIARIRGEKVQPKYSTD* |
Ga0157380_110367232 | 3300014326 | Switchgrass Rhizosphere | VAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD* |
Ga0182001_105239932 | 3300014488 | Soil | KITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD* |
Ga0182027_107815952 | 3300014839 | Fen | VAGYEGKITLITIALAEAAMAANNAVAEIRHEKAQPEYSSE* |
Ga0157379_101225094 | 3300014968 | Switchgrass Rhizosphere | YEGKITLITVGFSEAAIAANHCVARIRGEKVQPKYSTE* |
Ga0132258_114728564 | 3300015371 | Arabidopsis Rhizosphere | AGDVAGYEGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE* |
Ga0132256_1034233801 | 3300015372 | Arabidopsis Rhizosphere | ITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD* |
Ga0132257_1003729064 | 3300015373 | Arabidopsis Rhizosphere | AGDGAGYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD* |
Ga0132255_1019707221 | 3300015374 | Arabidopsis Rhizosphere | GKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD* |
Ga0184608_101892553 | 3300018028 | Groundwater Sediment | GKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD |
Ga0184634_102185381 | 3300018031 | Groundwater Sediment | KITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD |
Ga0184634_102970643 | 3300018031 | Groundwater Sediment | GYEGKITLISIGFGEAAVAANNAIARIRGEKVQPKYSTD |
Ga0184624_102728442 | 3300018073 | Groundwater Sediment | AAGDVAGYEGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD |
Ga0184624_102877741 | 3300018073 | Groundwater Sediment | GKITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD |
Ga0066655_105373601 | 3300018431 | Grasslands Soil | YPGKITLITIGMGEAAIAANNAVATIRGEKVQPKYSTD |
Ga0190275_131892683 | 3300018432 | Soil | GKITLITVGFGEAAIAANNAIAKIRGEKVQPKYSTD |
Ga0066662_121336882 | 3300018468 | Grasslands Soil | GKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD |
Ga0066669_109754391 | 3300018482 | Grasslands Soil | PGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD |
Ga0190264_112089882 | 3300019377 | Soil | KITLISIGFGEAAIAANQAIARIRGEKIQPKYSTD |
Ga0193704_10470351 | 3300019867 | Soil | GYPGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD |
Ga0193705_10525851 | 3300019869 | Soil | GDVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD |
Ga0193755_11723831 | 3300020004 | Soil | AGDVAYYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE |
Ga0193697_10039731 | 3300020005 | Soil | AGYEGKITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD |
Ga0193721_10719071 | 3300020018 | Soil | GKITLITIGMGEAAIAANNALAMIRGEKVQPKYSTD |
Ga0210381_100363731 | 3300021078 | Groundwater Sediment | GDVAGYPGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD |
Ga0182009_106931231 | 3300021445 | Soil | AAGDVAGYPGKITLITVGMGEAAIAANNAIAQIRGEKVQPKYSTD |
Ga0222623_103414341 | 3300022694 | Groundwater Sediment | VAGYPGKITLITIGMGEAAIAANNAIAHIRGEKVQPKYSTD |
Ga0222622_103167143 | 3300022756 | Groundwater Sediment | KITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD |
Ga0222622_109414072 | 3300022756 | Groundwater Sediment | AGDVAGYEGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE |
Ga0247672_10431873 | 3300024187 | Soil | AGDVAGYPGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD |
Ga0209429_101330151 | 3300025864 | Arctic Peat Soil | DVAGYEGKITLITIGLAEAAMAANNAVAEIRHEKAQPEYSSE |
Ga0207685_100441901 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GDVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD |
Ga0207654_112981572 | 3300025911 | Corn Rhizosphere | YEGKITLITVGFSEAAIAANHCVARIRGEKVQPKYSTE |
Ga0207693_102809521 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AGYPGKITLITIGMGEAAIAANNAVAAIRDEKVQPKYSTD |
Ga0207662_108540381 | 3300025918 | Switchgrass Rhizosphere | EGKITLITIGMGEAAIAANNAVASIRGEKVQPKYSTD |
Ga0207687_115449432 | 3300025927 | Miscanthus Rhizosphere | GKITLISIGFGEAAIAANNAIARIRGEKVQPKYSTD |
Ga0207690_104330372 | 3300025932 | Corn Rhizosphere | AAGDVAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD |
Ga0207709_106726212 | 3300025935 | Miscanthus Rhizosphere | YEGKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE |
Ga0207665_108257352 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | YPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD |
Ga0207665_109870342 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VAYYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE |
Ga0207679_102642381 | 3300025945 | Corn Rhizosphere | YPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD |
Ga0207640_109162311 | 3300025981 | Corn Rhizosphere | GYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD |
Ga0207640_112618583 | 3300025981 | Corn Rhizosphere | AAGDVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD |
Ga0207677_104932273 | 3300026023 | Miscanthus Rhizosphere | VAGYEGKITLISIGFGEAAIAANNAIARIRGEKVQPKYSTD |
Ga0207639_107757161 | 3300026041 | Corn Rhizosphere | VAGFYGKITLITVGFSEAALSANHAVARIRGEKAQPKYSTE |
Ga0207641_111078333 | 3300026088 | Switchgrass Rhizosphere | GDVAGYEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD |
Ga0209027_12828452 | 3300026300 | Grasslands Soil | VAGYPGKITLITVGMGEAAIAANNAIAEIRGEKVQPKYSTD |
Ga0256867_100112024 | 3300026535 | Soil | GYEGKITLISIGFGEAAIAANQAVAKIRGEKVQPKYSTD |
Ga0207521_1042513 | 3300026940 | Soil | MLAIGRAAGDVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD |
Ga0209897_10529022 | 3300027169 | Groundwater Sand | EGKITLISVGFGEAAIAANNAIAKIRGEKVQPKYSTD |
Ga0209842_10054473 | 3300027379 | Groundwater Sand | GYEGKITLISVGFGEAAVAANQAVAKIRGEKVQPKYSTD |
Ga0209842_10793063 | 3300027379 | Groundwater Sand | GKITLISVGFGEAAVAANQAVAKIRGEKVQPKYSTD |
Ga0209074_102212691 | 3300027787 | Agricultural Soil | DVAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD |
Ga0209574_103600872 | 3300027809 | Agave | FDGKITLITVGFAEAALAANHAVARIRGEKAQPKYSTE |
Ga0209465_106026522 | 3300027874 | Tropical Forest Soil | DGKITLITVGFSEAAIAANHAVARIRGEKAQPKYSTE |
Ga0207428_100336054 | 3300027907 | Populus Rhizosphere | GYEGKITLISIGFGEAAIAANNAIARIRGEKVQPKYSTD |
Ga0209382_105405921 | 3300027909 | Populus Rhizosphere | GYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD |
Ga0209889_11226862 | 3300027952 | Groundwater Sand | KITLISVGFGEAAIAANNAIAAIRGEKVQPKYSTD |
Ga0268265_106590723 | 3300028380 | Switchgrass Rhizosphere | AAGDMAGYDGKITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE |
Ga0268265_106704281 | 3300028380 | Switchgrass Rhizosphere | GDVAGYEGKITLITVGFSEAAIAANHCVARIRGEKVQPKYSTE |
Ga0265319_12406222 | 3300028563 | Rhizosphere | AHYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE |
Ga0265334_102220951 | 3300028573 | Rhizosphere | VAHYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE |
Ga0247828_105874711 | 3300028587 | Soil | DGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE |
Ga0307291_11263611 | 3300028707 | Soil | KITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD |
Ga0307322_100998862 | 3300028710 | Soil | VAGYPGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD |
Ga0307322_101982761 | 3300028710 | Soil | DGKITLISVGFGEAAIAANNAIARIRGEKVQPKYSTD |
Ga0307307_103079992 | 3300028718 | Soil | PGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD |
Ga0307301_100063184 | 3300028719 | Soil | GYEGKITLITIGFGEAAIAANNAIARIRGEKVQPKYSTD |
Ga0307297_100018416 | 3300028754 | Soil | DVAGYPGKITLITIGMGEAAIAANNAVAEIRGEKVQPKYSTD |
Ga0307306_100020161 | 3300028782 | Soil | GYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD |
Ga0307323_102518251 | 3300028787 | Soil | GYPGKITLITIGMGEAAIAANNAVAEIRGEKVQPKYSTD |
Ga0307323_102663052 | 3300028787 | Soil | VAGYPGKITLITIGMGEAAIAANNAVAAIRGEKVQPKYSTD |
Ga0307284_101091312 | 3300028799 | Soil | YEGKITLITIGMGEAAIAANNAVARIRGEKVQPKYSTD |
Ga0307312_109457222 | 3300028828 | Soil | DVAGYPGKITLITIGMGEAAIASNNAIALIRGEKVQPKYSTD |
Ga0307314_101655951 | 3300028872 | Soil | GDVAGYEGKITLITVGFSEAALAANHAVARIRGEKAQPKYSTE |
Ga0307286_102412672 | 3300028876 | Soil | GKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD |
Ga0307278_104405501 | 3300028878 | Soil | AAGDVAGYPEKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD |
Ga0307308_104223552 | 3300028884 | Soil | AAGDVAGYPGKITLITIGMGEAAIAANNAVAAIQGEKVQPKYSTD |
Ga0311336_112995341 | 3300029990 | Fen | GKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE |
Ga0302299_105828382 | 3300030010 | Fen | EGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE |
Ga0299914_110712141 | 3300031228 | Soil | EGKITLITIGFGEAAIAANNAIAKIRGEKVQPKYSTD |
Ga0307469_116210422 | 3300031720 | Hardwood Forest Soil | DVAGYPGKITLITIGMGEAAIAANNAIAQIRGEKVQPKYSTD |
Ga0311351_114303541 | 3300031722 | Fen | GYEGKITLITIALAEAAMAANNAVAEIRHEKAQPEYSSE |
Ga0307468_1023086892 | 3300031740 | Hardwood Forest Soil | KITLITIGFSEAAIAANHAVARIRGEKAQPKYSTE |
Ga0308175_1004216292 | 3300031938 | Soil | GYEGKITLITIGMGEAAIAANNAIARIRGEKVQPKYSTD |
Ga0308176_113865192 | 3300031996 | Soil | GYPGKITLITIGMGEAAIAANNAVAQIRGEKVQPKYSTD |
Ga0307471_1025371082 | 3300032180 | Hardwood Forest Soil | GDVAYYEGKITLITIGLGEAAIAANQCVARARGVKLQPAYSTE |
Ga0334961_022882_942_1058 | 3300034143 | Sub-Biocrust Soil | YDGKITLITIGLGEAAIAANQCVARVRGVKVQPTYSTE |
Ga0334932_073124_1_126 | 3300034174 | Sub-Biocrust Soil | VAGYEGKITLITIGMGEAAVAANNAIARIRGEKVQPKYSTD |
⦗Top⦘ |