NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F031847

Metagenome / Metatranscriptome Family F031847

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031847
Family Type Metagenome / Metatranscriptome
Number of Sequences 181
Average Sequence Length 99 residues
Representative Sequence MFLGQYVSKLMQETISYLKLSYEGLAHEMSIPEMVLRDAVEGKMGLTRGQWVKFGRLLALPTTYELRPAERDGTPCWEICFPPVSLVANKT
Number of Associated Samples 137
Number of Associated Scaffolds 181

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 37.08 %
% of genes near scaffold ends (potentially truncated) 37.57 %
% of genes from short scaffolds (< 2000 bps) 60.77 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.033 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(25.967 % of family members)
Environment Ontology (ENVO) Unclassified
(60.221 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.304 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.45%    β-sheet: 11.76%    Coil/Unstructured: 53.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 181 Family Scaffolds
PF07238PilZ 23.20
PF00563EAL 6.63
PF02586SRAP 2.21
PF00196GerE 1.66
PF01564Spermine_synth 1.66
PF04664OGFr_N 1.66
PF13460NAD_binding_10 1.66
PF13426PAS_9 1.10
PF05598DUF772 1.10
PF00027cNMP_binding 1.10
PF00990GGDEF 1.10
PF00834Ribul_P_3_epim 1.10
PF00724Oxidored_FMN 1.10
PF00989PAS 0.55
PF01804Penicil_amidase 0.55
PF14690zf-ISL3 0.55
PF13432TPR_16 0.55
PF12680SnoaL_2 0.55
PF00903Glyoxalase 0.55
PF07681DoxX 0.55
PF01402RHH_1 0.55
PF09335SNARE_assoc 0.55
PF02129Peptidase_S15 0.55
PF02265S1-P1_nuclease 0.55
PF00158Sigma54_activat 0.55
PF01175Urocanase 0.55
PF03713DUF305 0.55
PF13181TPR_8 0.55
PF00210Ferritin 0.55
PF13520AA_permease_2 0.55
PF05345He_PIG 0.55
PF02610Arabinose_Isome 0.55
PF09250Prim-Pol 0.55
PF07593UnbV_ASPIC 0.55
PF13188PAS_8 0.55
PF02148zf-UBP 0.55
PF08447PAS_3 0.55
PF01797Y1_Tnp 0.55
PF13185GAF_2 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 181 Family Scaffolds
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 6.63
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 6.63
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 6.63
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 6.63
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 2.21
COG0036Pentose-5-phosphate-3-epimeraseCarbohydrate transport and metabolism [G] 1.10
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 1.10
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 1.10
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.55
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.55
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.55
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.55
COG2160L-arabinose isomeraseCarbohydrate transport and metabolism [G] 0.55
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.55
COG2366Acyl-homoserine lactone (AHL) acylase PvdQSecondary metabolites biosynthesis, transport and catabolism [Q] 0.55
COG2987Urocanate hydrataseAmino acid transport and metabolism [E] 0.55
COG3544Uncharacterized conserved protein, DUF305 familyFunction unknown [S] 0.55
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.55
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.59 %
UnclassifiedrootN/A25.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10069373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1759Open in IMG/M
3300001170|JGI12704J13340_1004305All Organisms → cellular organisms → Bacteria1435Open in IMG/M
3300005538|Ga0070731_10429162Not Available879Open in IMG/M
3300005591|Ga0070761_10006353All Organisms → cellular organisms → Bacteria6814Open in IMG/M
3300005610|Ga0070763_10332682Not Available841Open in IMG/M
3300005921|Ga0070766_10003114All Organisms → cellular organisms → Bacteria → Acidobacteria8344Open in IMG/M
3300005921|Ga0070766_10105947All Organisms → cellular organisms → Bacteria → Acidobacteria1672Open in IMG/M
3300005994|Ga0066789_10019301All Organisms → cellular organisms → Bacteria3018Open in IMG/M
3300006642|Ga0075521_10122542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1206Open in IMG/M
3300009518|Ga0116128_1013847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2830Open in IMG/M
3300009518|Ga0116128_1021758All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2176Open in IMG/M
3300009518|Ga0116128_1153993All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300009519|Ga0116108_1039377All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1531Open in IMG/M
3300009522|Ga0116218_1082312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1466Open in IMG/M
3300009523|Ga0116221_1562319All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300009549|Ga0116137_1003651All Organisms → cellular organisms → Bacteria → Acidobacteria8210Open in IMG/M
3300009549|Ga0116137_1017594All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2730Open in IMG/M
3300009617|Ga0116123_1013778All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2760Open in IMG/M
3300009621|Ga0116116_1018790All Organisms → cellular organisms → Bacteria2566Open in IMG/M
3300009630|Ga0116114_1070046All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium962Open in IMG/M
3300009632|Ga0116102_1153557All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300009641|Ga0116120_1038349All Organisms → cellular organisms → Bacteria1680Open in IMG/M
3300009698|Ga0116216_10320008Not Available944Open in IMG/M
3300009760|Ga0116131_1076412Not Available1032Open in IMG/M
3300009762|Ga0116130_1187383All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300009764|Ga0116134_1005815All Organisms → cellular organisms → Bacteria5614Open in IMG/M
3300009764|Ga0116134_1045581All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300009839|Ga0116223_10187048All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1271Open in IMG/M
3300010343|Ga0074044_10032240Not Available3681Open in IMG/M
3300010343|Ga0074044_11055503Not Available533Open in IMG/M
3300010379|Ga0136449_100168523All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4245Open in IMG/M
3300010379|Ga0136449_101189992Not Available1202Open in IMG/M
3300014151|Ga0181539_1003626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium13936Open in IMG/M
3300014151|Ga0181539_1151946Not Available923Open in IMG/M
3300014151|Ga0181539_1388295Not Available500Open in IMG/M
3300014152|Ga0181533_1214612All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300014155|Ga0181524_10120759All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300014159|Ga0181530_10049425All Organisms → cellular organisms → Bacteria2768Open in IMG/M
3300014164|Ga0181532_10734769Not Available531Open in IMG/M
3300014165|Ga0181523_10373662Not Available797Open in IMG/M
3300014200|Ga0181526_10108211All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1777Open in IMG/M
3300014489|Ga0182018_10005697All Organisms → cellular organisms → Bacteria9930Open in IMG/M
3300014489|Ga0182018_10055406All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2411Open in IMG/M
3300014490|Ga0182010_10001489All Organisms → cellular organisms → Bacteria12315Open in IMG/M
3300014491|Ga0182014_10000756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae43886Open in IMG/M
3300014491|Ga0182014_10076475All Organisms → cellular organisms → Bacteria2124Open in IMG/M
3300014494|Ga0182017_10078272All Organisms → cellular organisms → Bacteria → Acidobacteria2177Open in IMG/M
3300014495|Ga0182015_10018445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium5799Open in IMG/M
3300014495|Ga0182015_10825183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300014496|Ga0182011_10469913Not Available812Open in IMG/M
3300014498|Ga0182019_10654860All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300014501|Ga0182024_10026293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis10233Open in IMG/M
3300014501|Ga0182024_10144479All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3356Open in IMG/M
3300014501|Ga0182024_10782704All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1165Open in IMG/M
3300014501|Ga0182024_11554223Not Available752Open in IMG/M
3300014502|Ga0182021_10034138All Organisms → cellular organisms → Bacteria5979Open in IMG/M
3300014502|Ga0182021_11105524Not Available955Open in IMG/M
3300014502|Ga0182021_11443879All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300014839|Ga0182027_11665474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300016750|Ga0181505_10394815All Organisms → cellular organisms → Bacteria2067Open in IMG/M
3300017925|Ga0187856_1005613All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium8034Open in IMG/M
3300017925|Ga0187856_1021087All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3323Open in IMG/M
3300017925|Ga0187856_1033490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2412Open in IMG/M
3300017925|Ga0187856_1238377All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300017925|Ga0187856_1324374Not Available526Open in IMG/M
3300017929|Ga0187849_1019035All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3942Open in IMG/M
3300017936|Ga0187821_10232514All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300017938|Ga0187854_10066273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1758Open in IMG/M
3300017938|Ga0187854_10107242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1304Open in IMG/M
3300017938|Ga0187854_10336639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300017940|Ga0187853_10299950Not Available727Open in IMG/M
3300017946|Ga0187879_10016940All Organisms → cellular organisms → Bacteria4540Open in IMG/M
3300017946|Ga0187879_10138007All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1384Open in IMG/M
3300017946|Ga0187879_10426586Not Available735Open in IMG/M
3300017948|Ga0187847_10000065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae114430Open in IMG/M
3300017970|Ga0187783_10288586All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300017995|Ga0187816_10315750All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300017996|Ga0187891_1026143All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2686Open in IMG/M
3300017996|Ga0187891_1069717Not Available1405Open in IMG/M
3300017998|Ga0187870_1087334All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1230Open in IMG/M
3300018008|Ga0187888_1286347Not Available636Open in IMG/M
3300018009|Ga0187884_10044783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2099Open in IMG/M
3300018009|Ga0187884_10198983All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium827Open in IMG/M
3300018013|Ga0187873_1040432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2099Open in IMG/M
3300018013|Ga0187873_1058033All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1642Open in IMG/M
3300018014|Ga0187860_1141790All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1038Open in IMG/M
3300018016|Ga0187880_1110127All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1343Open in IMG/M
3300018017|Ga0187872_10003980All Organisms → cellular organisms → Bacteria11419Open in IMG/M
3300018017|Ga0187872_10440880Not Available546Open in IMG/M
3300018018|Ga0187886_1290822Not Available611Open in IMG/M
3300018019|Ga0187874_10463462Not Available510Open in IMG/M
3300018020|Ga0187861_10053300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2099Open in IMG/M
3300018022|Ga0187864_10122345All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1322Open in IMG/M
3300018022|Ga0187864_10462562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300018023|Ga0187889_10016024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4691Open in IMG/M
3300018033|Ga0187867_10224039Not Available1064Open in IMG/M
3300018033|Ga0187867_10353354Not Available818Open in IMG/M
3300018034|Ga0187863_10018382All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4309Open in IMG/M
3300018035|Ga0187875_10010753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium5790Open in IMG/M
3300018035|Ga0187875_10143768All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1336Open in IMG/M
3300018038|Ga0187855_10076256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2046Open in IMG/M
3300018038|Ga0187855_10557735Not Available667Open in IMG/M
3300018042|Ga0187871_10022237All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4078Open in IMG/M
3300018042|Ga0187871_10090025Not Available1779Open in IMG/M
3300018043|Ga0187887_10019278All Organisms → cellular organisms → Bacteria4426Open in IMG/M
3300018044|Ga0187890_10251169Not Available996Open in IMG/M
3300018047|Ga0187859_10034288All Organisms → cellular organisms → Bacteria2735Open in IMG/M
3300018057|Ga0187858_10243145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1158Open in IMG/M
3300018057|Ga0187858_10326785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium966Open in IMG/M
3300020021|Ga0193726_1002471All Organisms → cellular organisms → Bacteria → Acidobacteria12505Open in IMG/M
3300020581|Ga0210399_10156068Not Available1888Open in IMG/M
3300020582|Ga0210395_10044452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3251Open in IMG/M
3300021171|Ga0210405_10134528All Organisms → cellular organisms → Bacteria → Acidobacteria1956Open in IMG/M
3300021171|Ga0210405_10348378All Organisms → cellular organisms → Bacteria → Acidobacteria1169Open in IMG/M
3300021178|Ga0210408_11078955Not Available618Open in IMG/M
3300021180|Ga0210396_10297627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1429Open in IMG/M
3300021401|Ga0210393_10331626All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1238Open in IMG/M
3300021402|Ga0210385_11543807Not Available507Open in IMG/M
3300021432|Ga0210384_11421362All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300021474|Ga0210390_10218513All Organisms → cellular organisms → Bacteria → Acidobacteria1613Open in IMG/M
3300021477|Ga0210398_10060489All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3096Open in IMG/M
3300021478|Ga0210402_10671696Not Available958Open in IMG/M
3300021479|Ga0210410_11057490Not Available701Open in IMG/M
3300022521|Ga0224541_1011002All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium976Open in IMG/M
3300022524|Ga0224534_1002294All Organisms → cellular organisms → Bacteria → Acidobacteria9092Open in IMG/M
3300022840|Ga0224549_1032114All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300022881|Ga0224545_1000991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5945Open in IMG/M
3300022881|Ga0224545_1001345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium5006Open in IMG/M
3300022881|Ga0224545_1027736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium808Open in IMG/M
3300024295|Ga0224556_1034568All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1264Open in IMG/M
3300025419|Ga0208036_1001298All Organisms → cellular organisms → Bacteria → Acidobacteria10970Open in IMG/M
3300025439|Ga0208323_1001210All Organisms → cellular organisms → Bacteria → Acidobacteria9831Open in IMG/M
3300025469|Ga0208687_1011823All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2662Open in IMG/M
3300025494|Ga0207928_1001691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3850Open in IMG/M
3300025494|Ga0207928_1008005All Organisms → cellular organisms → Bacteria2027Open in IMG/M
3300025506|Ga0208937_1007964All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2834Open in IMG/M
3300025506|Ga0208937_1009972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2499Open in IMG/M
3300025509|Ga0208848_1044029All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300026291|Ga0209890_10037899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1818Open in IMG/M
3300026474|Ga0247846_1002484All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3017Open in IMG/M
3300027591|Ga0209733_1018007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1900Open in IMG/M
3300027604|Ga0208324_1049851All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1221Open in IMG/M
3300027745|Ga0209908_10248662Not Available501Open in IMG/M
3300027824|Ga0209040_10430770Not Available605Open in IMG/M
3300027853|Ga0209274_10254205All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium899Open in IMG/M
3300027855|Ga0209693_10399542Not Available664Open in IMG/M
3300027869|Ga0209579_10510587Not Available652Open in IMG/M
3300027895|Ga0209624_10185177All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300027905|Ga0209415_10154146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2300Open in IMG/M
3300028639|Ga0302168_1017732All Organisms → cellular organisms → Bacteria → Acidobacteria1195Open in IMG/M
3300028678|Ga0302165_10031120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1432Open in IMG/M
3300028736|Ga0302214_1009073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1985Open in IMG/M
3300028770|Ga0302258_1104440All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300028795|Ga0302227_10219572All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300028800|Ga0265338_10172669All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300029923|Ga0311347_10002528All Organisms → cellular organisms → Bacteria13506Open in IMG/M
3300029980|Ga0302298_10289718Not Available544Open in IMG/M
3300029990|Ga0311336_10602242Not Available937Open in IMG/M
3300030002|Ga0311350_10035152All Organisms → cellular organisms → Bacteria4370Open in IMG/M
3300030509|Ga0302183_10416581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300030520|Ga0311372_11129393All Organisms → Viruses → Predicted Viral1014Open in IMG/M
3300030659|Ga0316363_10022439All Organisms → cellular organisms → Bacteria → Acidobacteria3389Open in IMG/M
3300030862|Ga0265753_1050615Not Available737Open in IMG/M
3300031090|Ga0265760_10048631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1274Open in IMG/M
3300031344|Ga0265316_10020368All Organisms → cellular organisms → Bacteria → Acidobacteria5647Open in IMG/M
3300031711|Ga0265314_10436210Not Available701Open in IMG/M
3300031726|Ga0302321_102532005Not Available599Open in IMG/M
3300031788|Ga0302319_10847607All Organisms → cellular organisms → Bacteria → Acidobacteria897Open in IMG/M
3300031788|Ga0302319_11408789Not Available627Open in IMG/M
3300032160|Ga0311301_10003011All Organisms → cellular organisms → Bacteria63033Open in IMG/M
3300032160|Ga0311301_10357851All Organisms → cellular organisms → Bacteria → Acidobacteria2276Open in IMG/M
3300032770|Ga0335085_10000313All Organisms → cellular organisms → Bacteria144944Open in IMG/M
3300033887|Ga0334790_007848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6053Open in IMG/M
3300033888|Ga0334792_017558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2621Open in IMG/M
3300033888|Ga0334792_023363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2168Open in IMG/M
3300033891|Ga0334811_119510All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300034070|Ga0334822_088803Not Available652Open in IMG/M
3300034163|Ga0370515_0059687All Organisms → cellular organisms → Bacteria1670Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland25.97%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland11.05%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil7.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.18%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.63%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.97%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.97%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen4.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.31%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.76%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.21%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa2.21%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost2.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.66%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.66%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.66%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.10%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.10%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.10%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.10%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.10%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.10%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.55%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.55%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.55%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001170Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025494Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026474Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028639Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_2EnvironmentalOpen in IMG/M
3300028678Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2EnvironmentalOpen in IMG/M
3300028736Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3EnvironmentalOpen in IMG/M
3300028770Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029980Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034070Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-MEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1006937323300000567Peatlands SoilMKRSSSLPPSDSPLTMMFLGQYVSSLMQETITYRKLPYGGLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGVPTTYELRPGERDGRPCWEICFPPVSLTANRT*
JGI12704J13340_100430513300001170Forest SoilQETVTYCKISYERLAQEMSLSETILREAVQGKLARTRGQWVRLGQLLGLPTNFELRPDERDGAPCWEVCYPPVSVEMDKA*
Ga0070731_1042916223300005538Surface SoilMESTTYSSETLPQSKVGVSRSFSLPPSDSPLTAVFAGQYVSSLMLETIRYLNLSYSDLALRMFLPEVVLRDAVEGKMGLTRGQWIRFGQELGLPTTYVLRPGERDRMPCWEVCFPPVTLGANKQ*
Ga0070761_1000635313300005591SoilMFLGQYVSSLMQETITYLKLSYDDLALRMFLPEMVLRDAVDGKMGLTRGQWVRFGQELGLPTTYVLRPGERDDVPCWEVCFPPVSLGANKT*
Ga0070763_1033268213300005610SoilMFLGQYVSRLMQETITYRKLPYDTLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGMPTTYELRPGERDGRPCWEICFPPVSLIANKT*
Ga0070766_10003114123300005921SoilMESNTHSSEALPQSQVGMSRSASLPPSDSPLTKMFLGQYVSSLMQETITYLKLSYGDLALRMFLPEMVLRDAVDGKMGLTRGQWVRFGQALELPTTYVLRPGERDGAPYWELCFPPVSLVANKT*
Ga0070766_1010594713300005921SoilHYVSCLMQETITYLKLSYSDLALKMFVPEMVLRDAVEAKMPLTRGQWSRLAKLLELPTTFELRPVEQDGGPYWEVCYAPVAFIAATT*
Ga0066789_1001930133300005994SoilMEGQTLTHPSTPPPSDSPLTLMFLGQYVSALMHETIAYLKLPYDKLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLALPTTYILRPGEREGVPCWEICFPPVSLMANKS*
Ga0075521_1012254223300006642Arctic Peat SoilMHSSSLPPSDSPLTTMFLGQYVSALMHETIDYLKLPYDGLAHEMSIPELVLRDGVEGKMGLTRGQWVKFGRLLGLPTTYVLRPGERDGVPCWEICFPPLSLAANKT*
Ga0116128_101384743300009518PeatlandMFVGQYVSKLMQETISYLKLSYEGLAHEMSIPETVLCEAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLVANKT*
Ga0116128_102175833300009518PeatlandMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIAHKA*
Ga0116128_115399323300009518PeatlandMFLGQYLSCLIQKTITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTAYELRAAERDGLACWEVCPQWSPQNRPSL
Ga0116108_103937723300009519PeatlandMFVGQYVSKLMQETISYLKLSYEGLAHEMSISEMVLRDAVEGKMGLTRGQWVKFGRLLALPTTYELRPAERDGTPCWEICFPPVSLVANKT*
Ga0116218_108231213300009522Peatlands SoilLTHSSSLPPSDSPLTLMFLGQYVSKLMQETISYLKLPYDKLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYILRPGERDGTPCWEICFPPVALT
Ga0116221_156231913300009523Peatlands SoilLTHSSSLPPSDSPLTLMFLGQYVSKLMQETISYLKLPYDKLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYILRPGERDGTPC
Ga0116137_100365193300009549PeatlandMFLGQYVSKLMQETIAYLKLSYGGLAHEMSIPELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVDRDPSLVGTH*
Ga0116137_101759423300009549PeatlandMFLGQYVSKLMQETISYLKLSYEGLAHEMSIPETVLCEAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLVANKT*
Ga0116123_101377833300009617PeatlandMFVGQYVSKLMQETISYLKLSYEGLAHEMSIPEMVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLVANKT*
Ga0116116_101879013300009621PeatlandLKKSSSLPPSDSPLTTMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIAHKA*
Ga0116114_107004623300009630PeatlandMFVGQYVSKLMQETISYLKLSYEGLAHEMSIPETVLCEAVEGKMGLTRGQWVKFGRLLALPTTYELRPAERDGTPCWEICFPPVSLVANKT*
Ga0116102_115355723300009632PeatlandMQETITYLKLSYVGLAHEMSIPELVLRDAVEGKMGLTRGQWIRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAA
Ga0116120_103834913300009641PeatlandYVSKLMQETISYLKLSYEGLAHEMSIPETVLCEAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLVANKT*
Ga0116216_1032000813300009698Peatlands SoilTQEQFAEALDVSVDFLTITYLKLSYDTLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYQLRPGERDGTSCWEICFPPVALTANKA*
Ga0116131_107641223300009760PeatlandMFLGQYVSKLMQETIAYLKLSYGGLAHEMSITELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCW
Ga0116130_118738313300009762PeatlandLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRPAERDGVACWEVCYPPVSFIADKAGDRPLAD*
Ga0116134_100581573300009764PeatlandMEQIMESTLHSSEALPQSQVASRSSSLPPSDSPLTTVYLGQYVSSLMQETIAYLKLSYSDLALRMFIHEMVLRDAVEGKMGLTRGQWVRLGQELGLPTTYQLRPAERDGTPCWEICFPPVSLVANQT*
Ga0116134_104558123300009764PeatlandMSMLTQETISYLKLSYKGLAHKMSIPEMVLRDAVECNMGLTSRTVGQVWSSARSATTYERRPDERDGTPCWEICFRPSTSPWTNSSGGQ*
Ga0116223_1018704813300009839Peatlands SoilLTHSSSLPPSDSPLTLMFLGQYVSKLMQETISYLKLPYDKLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYILRPGERDGTPCWEICFPPVALTAKKT*
Ga0074044_1003224013300010343Bog Forest SoilMTHSSSLPPSDSPLTLMFLGQYVSKLMQETIAYLKLPYDKLAHEMSVPEMVLRDAVAGKMGLSRGQWVKFGRLLDLPTTYQLRPGERYGIPCWEICFPPVALR
Ga0074044_1105550313300010343Bog Forest SoilDSPLTAMFLGQYVSKLMQETIAYLKLSYGGLAHEMSIPELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVDRDPSLVGTH*
Ga0136449_10016852343300010379Peatlands SoilMFLGQYVSKLIQETIAYLELPYDKLAHQMSIPEMVLRDAVEGKMGLTRGQWIRLGKMLGLPTSYQLRPGERDGIPCWEICFPPVSLMANKT*
Ga0136449_10118999223300010379Peatlands SoilMTQEQFAEALDVSVDFLTITYLKLSYDTLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYQLRPGERDGTSCWEICFPPVALTANKA*
Ga0181539_1003626163300014151BogVSKLMQETISYLKLSYEGLAQEMSIPGMVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGIPCWEVCFPPVSLGASKT*
Ga0181539_115194623300014151BogMFLGQYVSKLMQETISYLKLSYEGLADEMSIPEMVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLAANKT*
Ga0181539_138829513300014151BogMFLGQYVSKLMQETISYLKLSYEGLAHEMSIPEMVLRDAVEGKMGLTRGQWVKFGRLLALPTTYELRPAERDGTPCWEICFPPVSL
Ga0181533_121461223300014152BogMFLGQYVSKLMQETISYLKLSYEGLAHEMSIPEMVLRDAVEGKMGLTRGQWVKFGRLLALPTTYELRPAERDGTPCWEICFPPVSLVANKT*
Ga0181524_1012075913300014155BogKLMQETIAYLKLSYGGLAHEMSIPELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVDRDPSLVGTH*
Ga0181530_1004942533300014159BogMFLGQYVSKLMQETISYLKLSYEGLAQEMSIPGMVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLVANKT*
Ga0181532_1073476913300014164BogMFLGQYVGCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRPAERDGLACWEVCYPPVSFIADKAEDRPLAD*
Ga0181523_1037366213300014165BogMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRPAERDGLACWEVCYPPVSFIADKAEDRPLAD*
Ga0181526_1010821133300014200BogMFLGQYLSCLIQKTITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRPAERDGLACWEVCYPPVSFIADKAEDRPLAD*
Ga0182018_1000569743300014489PalsaMFLGQYVSALMQETIAYLKLPYDKLALDMSIPEMVLRDAVEGKMGLTRGQWVKCGRLLALPTTYVLRPAERDGTPCWEVCFPPVSLWTNKT*
Ga0182018_1005540623300014489PalsaMFLGQYVGCLIQETITYLKLSFSDLAATIFIPEMVLRDAVERKIALTRGQWIKLGHLLDLPTTYELRAAERDGVACWEVCYPPVSFIADKAGDRPLAD*
Ga0182010_1000148923300014490FenMESTSHSSEALPQSQIGASRSSSLPPSDSPLTKVFLGQYVSSLIQETITYLKLSYSDLALLMFIPEMVLRDAVEGKMGLTRGQWVRLGQELELPTTYQLRPAERDGTPCWEICFPPVSLMANKT*
Ga0182014_1000075623300014491BogMESTSHSSEALPQSQIGASRSSSLPPSDSPLTKVFLGQYVSSLTQETITYLRLSYSDLALLMFIPEMVLRDAVEGKMGLTRGQWVRLGQELELPTTYQLRPAERDGTPCWEICFPPVSLMANKT*
Ga0182014_1007647513300014491BogMESTLHFSEALPQSQVGTSRSSSLPPSDSPLTTMFLGEYVSKLMLETISYLKLSYDGLAHEMSIPEMVLRDAIEGKMGLTRGQWVRLGKVLGLPTTYKLRPAERDGTPCWEICFPPVSLVENKT*
Ga0182017_1007827223300014494FenMKSTSHSSEALPQSQVGTSRSSSLPPSDSPLTTMFLGEYVSKLMLETISYLKLSYDGLAHEMSIPEMVLRDAIEGKMGLTRGRWVRLGKVLGLPTTYKLRPAERDGTPCWEICFPPVSVVENKT*
Ga0182015_1001844533300014495PalsaMNRNTLKKSSSLPPSDSPLTTMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIADKA*
Ga0182015_1082518313300014495PalsaMMRYSSLPPPDLPLTKMFLGQYVSCLIQETITYLKLSYSDLAVTMFIPEMVLRDAVERKMALTRGQWIKLGHFLDLPTTYELRAAERDGVACWEVCYPPV
Ga0182011_1046991313300014496FenMFLGEYVSKLMLETISYLKLSYDGLAHEMSIPEMVLRDAIEGKMGLTRGRWVRLGKVLGLPTTYKLRPAERDGTPCWEICFPPVSVVENKT*
Ga0182019_1065486023300014498FenTLMFLGQYVSSLMQETIAYLKLPYDKLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGKMLGLPTTYQLRPGERNGIPSWEICFPPVSFVADKAVDRDPSLVGTH*
Ga0182024_1002629343300014501PermafrostMFLGQYVSKLMQETIRYLKLPYDTLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTIYQLRPGERDGTPCWEICFPPVALTANKT*
Ga0182024_1014447933300014501PermafrostMTHSSSLPPSDSPLTLMFLGQYVSKLMQETITYLKLPYDTLAHEMSVPEMVLHDAVEGKMGLTRRQWVRLGRMPGLPTTYILRRGERDGQVYLLISVILQ*
Ga0182024_1078270423300014501PermafrostMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIADKA*
Ga0182024_1155422323300014501PermafrostMTHSSSLPLSDSPLTTMFLGQYVSKLMQETIDYLKLSYDGLAHEMSIPEFVLRDAVGGKMGLTRGQWVKFGRLLGLPTTYVLRPGERDGRPCWEICFPPLSLV
Ga0182021_1003413823300014502FenMTHSSLPPLDSPLTTVFLGQYVSSLMLETIRYLKLAYGGLAHDMSIPEMVLRDAVERKMGLTRGQWVNLGQLLGLPTTYELRPGEQDGTPCWEVCYPPVHVSMDKT*
Ga0182021_1110552413300014502FenMESTSHSSEALPQSQIGASRSSSLPPSDSPLTKVFLGQYVSSLIQETITYLKLSYSDLALLMFIPEMVLRDAVEGKMGLTRGQWVRLGQELE
Ga0182021_1144387913300014502FenLSYSDLALLMFIPEMVLRDAVEGKMGLTRGQWVRLGQELELPTTYQLRPAERDGTPCWEICFPPVSLMANKT*
Ga0182027_1166547413300014839FenLMLETISYLKLSYDGLAHEMSIPEMVLRDAIEGKMGLTRGRWVRLGKVLGLPTTYKLRPAERDGTPCWEICFPPVSVVENKT*
Ga0181505_1039481533300016750PeatlandMLRSSSLPPPDSPLTKMFLGQYLSCLIQETITYLKLSFSDLAATIFIPEMVLRDAVERKIALTRGQWIKLGHLLDLPTTYELRAAERDGVACWEVCYPPVSFIADKAGDHPLSQIED
Ga0187856_100561393300017925PeatlandMQETISYLKLSYEGLAQEMSIPGMVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGIPCWEVCFPPVSLGASKT
Ga0187856_102108743300017925PeatlandMFLGQYVSKLMQETIAYLKLSYGGLAHEMSIPELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAV
Ga0187856_103349033300017925PeatlandMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIAHKA
Ga0187856_123837723300017925PeatlandMQETITYLKLSYVGLAHEMSIPELVLRDAVEGKMGLTRGQWIRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAV
Ga0187856_132437413300017925PeatlandVGQYVSKLMQETISYLKLSYEGLAHEMSIPETVLCEAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLVANKT
Ga0187849_101903543300017929PeatlandMFLGQYVSKLMQETIAYLKLSYGGLAHEMSIPELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVDRDPSLVGTH
Ga0187821_1023251423300017936Freshwater SedimentLTHSSSLPPSDSPLSTVFLGEYVSKLMQETIVYFKLSYEGLAHEMSIPEMVLRDAVDGKMGLTRGQWIKFGRLLGLPTTYILRPGERDGTPCWEICFPPVSLVANKT
Ga0187854_1006627333300017938PeatlandMQETISYLKLSYEGLAHEMSIPETVLCEAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLVANKT
Ga0187854_1010724213300017938PeatlandMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLA
Ga0187854_1033663913300017938PeatlandMFLGQYLSCLIQKTITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCY
Ga0187853_1029995013300017940PeatlandGQYVSKQMQKTITYLKLPYDKLAHQMSIPEMVLRDAVEGKMGLTRGQWLRFGRLLSRPGERDGIPYWRKSAFRLFPSPRTKR
Ga0187879_1001694033300017946PeatlandMQETITYLKLPYETLAHQMSIPELVLCDAVEGKMGLTHGQWVRFGKILGLPTTYQLRPGERDGTPCWEICFPPISLVTNKT
Ga0187879_1013800723300017946PeatlandMMRSSSLPPPDSPLTKMFLGQYVGCLIQETITYLKLSFSDLAATIFIPEMVLRDAVERKIALTRGQWIKLGHLLDLPTTYELRAAERDGVACWEVCYPPVSFIADKAGDHPLSQIED
Ga0187879_1042658623300017946PeatlandMTHLSSLPPSDSPLTLMLLGQYVSKLMQETIAYLKLSYGGLAHEMSIPEMVLRDAVDGKMGLTRGQWVKFGRLLSLPTTYQLRPGERDGLPCWEICFPPVSFAVHEAVD
Ga0187847_10000065263300017948PeatlandMLETIRYLNLSYSDLALQMFLPEMVLRDAVEGKMGLTRGQWVRLGKRLELPTTYELRPGERDGAPCWEVCFPPVHVRTDERM
Ga0187783_1028858613300017970Tropical PeatlandPSSALPPPDSPLTKVFLGEYLGLLLNETISHSKMSYNALAQEMSIPEVVLRDAIQGKMGLTRGQWVKLGQLLRLPTTFELRPGERDGTPCWEVCYPPVPFRIDKG
Ga0187816_1031575013300017995Freshwater SedimentLKLPYHSLAHEMSIPELVLRDAVEGKMGLTRGQWVRFGCLLGLPTTYILRPGERDGMPCWEICFPPVSVRINKK
Ga0187891_102614323300017996PeatlandMQETITYLKLSYVGLAHEMSIPELVLRDAVEGKMGLTRGQWIRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVDRDPSLVGTH
Ga0187891_106971733300017996PeatlandMFLGQYVSKLMQETIAYLKLSYGGLAHEMSIPELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGEQDGTPCWEICFPPVSFAAHE
Ga0187870_108733423300017998PeatlandVGQYVSKLMQETISYLKLSYEGLAHEMSIPEMVLRDAVEGKMGLTRGQWVKFGRLLALPTTYELRPAERDGTPCWEICFPPVSLVANKT
Ga0187888_128634713300018008PeatlandMFLGQYVSKLMQETISYLKLSYEGLADEMSIPEMVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLAANKT
Ga0187884_1004478333300018009PeatlandMMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIAHKA
Ga0187884_1019898323300018009PeatlandGTSRSSSLPPSDSPLTTMFLGEYVSKLMLETISYLKLSYDGLAHEMSIPEMVLRDAIEGKMGLTRGQWVRLGKVLGLPTTYKLRPAERDGTPCWEICFPPVSLVENKT
Ga0187873_104043233300018013PeatlandMFLGQYLSCLIQETITYLKLSNSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIAHKA
Ga0187873_105803333300018013PeatlandVGQYVSKLMQETISYLKLSYEGLAHEMSIPETVLCEAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGIPCWEVCFPPVSLGASKT
Ga0187860_114179033300018014PeatlandDSPLTTMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIAHKA
Ga0187880_111012733300018016PeatlandMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIA
Ga0187872_10003980113300018017PeatlandLTHSSSLPPSDSPLTTVFLGQYVGRLMQEPIAYLKLPYHSLAHEMSIPALVLRDAVEGKMGLTRGQWVRFGRLLGLPTTYILRPGERDGMPCCEICFPPVSVRINKK
Ga0187872_1044088023300018017PeatlandMFLGQYVSKLMQETISYLKLSYEGLAHEMSIPEMVLRDAVEGKMGLTRGQWVKFGRLLALPTTYELRPAERDGTPCWEICFPPVSLVANKT
Ga0187886_129082223300018018PeatlandMQETISYLKLSYEGLAQEMSIPGMVLRDAVEGKMGLTRGQWVKFGRLLALPTTYELRPAERDGTPCWEICFPPVSLVANKT
Ga0187874_1046346223300018019PeatlandMTRSSSLPPSDSPLTKVFLGQYVSSLIQETITYLQLPYGRLAQDMSIPEMVLRDAVEGKLGLTRGQWVRLGQMLDLPTTYELRPGERNDAACWELCFPPVHV
Ga0187861_1005330033300018020PeatlandMFLGQYHSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIAHKA
Ga0187864_1012234533300018022PeatlandMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCY
Ga0187864_1046256213300018022PeatlandMMRSSSLPPSDSPLTKMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCY
Ga0187889_1001602443300018023PeatlandMFLGQYVSKLMQETIAYLKLSYGGLAHEMSIPGLVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVDRDPSLVGTH
Ga0187867_1022403913300018033PeatlandMTHSSSLPPSDSPLTAMFLGQYVSKLMQETIAYLKLSYGGLAHEMSIPELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVDRDPSLVGTH
Ga0187867_1035335423300018033PeatlandETITYLKLSYSDLAVTTFIPEMVLRDAVERKIALTRGQWIKLGHLLDLPTTYELRAAERDGLACWEVCYPPVSFIADKA
Ga0187863_1001838233300018034PeatlandMTRSSHLPPADSPLTTVFLGQYVSSLMQETIKYLQLSYTDLAPKMFIPEVLLRDGVEGKMALTRGQWIRLGHLLDLPTTYELRPGERDGVPCWEVCFPPVRVRMDEVQTAMRAREQKTGF
Ga0187875_10010753103300018035PeatlandMLRSSSLPPPDSPLTKMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRPAERDGLACWEVCYPPVSFIADKAEDRPLAD
Ga0187875_1014376823300018035PeatlandMTRSSSLPPSDSPLTKVFLGQYVSSLIQETITYLQLPYGRLAQDMSIPEMVLRDAVEGKLGLTRGQWVRLGQMLDLPTTYELRPGERNDAACWELCFPPVHVTIDKAKPPASRR
Ga0187855_1007625623300018038PeatlandMLRSSSLPPPDSPLTKMFLGQYLSCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRPAERDGVACWEVCYPPVSFIADKAEDRPLAD
Ga0187855_1055773523300018038PeatlandMMRSSSLPPPDSPLTKMFLGQYVGCLIQETITYLKLSFSDLAATIFIPEMVLRDAVERKIALTRGQWIKLGHLLDLPTTYELRAAERDGVACWEVCYPPVSFIADKAGDRPLAD
Ga0187871_1002223753300018042PeatlandMLRSSSLPPPDSPLTKMFLGQYVSYLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRPAERDGLACWEVCYPPVSFIADKAEDRPLAD
Ga0187871_1009002533300018042PeatlandMESTSDSSEALPGSHTGMSRSASLPPRDSPLTTIFAGQYVSSLMLETIRYLNLSYSDLALQMFLPEMVLCDAVEGKMGLTRGQWDRLGKRLELPTTYELRPGERDGAPCWEVCFPPVHVRTDERM
Ga0187887_1001927833300018043PeatlandMFLGQYVSKLMQETITYLKLPYETLAHQMSIPELVLCDAVEGKMGLTHGQWVRFGKILGLPTTYQLRPGERDGTPCWEICFPPISLVTNKT
Ga0187890_1025116913300018044PeatlandDSPLTTIFAGQYVSSLMLETIRYLNLSYSDLALQMFLPEMVLRDAVEGKMGLTRGQWVKFGRLLALPTTYELRPAERDGTPCWEICFPPVSLAANKT
Ga0187859_1003428833300018047PeatlandMESTSDSSEALPGSHTGMSRSASLPPRDSPLTTIFAGQYVSSLMLETIRYLNLSYSDLALQMFLPEMVLRDAVEGKMGLTRGQWVRLGKRLELPTTYELRPGERDGAPCWEVCFPPVHVRTDERM
Ga0187858_1024314523300018057PeatlandVGQYVSKLMQETISYLKLSYEGLAHEMSIPETVLCEAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLAANKT
Ga0187858_1032678513300018057PeatlandDSPLTKMFLGQYVGCLIQETITYLKLSFSDLAATIFIPEMVLRDAVERKIALTRGQWIKLGHLLDLPTTYELRAAERDGVACWEVCYPPVSFIADKAGDHPLSQIED
Ga0193726_100247183300020021SoilMTQSASLPPSDSPLTKVFLGQYVSSLTQETIVYLKLSYSGLAQQMSIPEMVLRDATEGKMGLTRGQWVKLGQILGLATTYDLRPGERNGAPCWEICFLPVRVSVDET
Ga0210399_1015606813300020581SoilMQETITYRKLSYEKLAQEMSIPELVLRDAVEGKMGLPRGQWVRFGKMLRLPTTYILRPGERDGRPCWEICFPPVALTANKT
Ga0210395_1004445263300020582SoilMESNTHSSEALPQSQVGMSRSASLPPSDSPLTKMFLGQYVSSLMQETITYLKLSYGDLALRMFLPEMVLRDAVDGKMGLTRGQWVRFGQALELPTTYVLRPGERDGAPYWELCFPPVSLVANKT
Ga0210405_1013452823300021171SoilETITYLKLPYDKSAREMSIPELVLRDAVAGKLGLIRGQWVKLGGLLGLPTTYELRPGERDGSPRWEICFPPVPFIADKE
Ga0210405_1034837823300021171SoilVFLGQYVSSLIQETIRYLKLSYAGLAQQMSIPEMVLRDAVEGKMGLTRGQWVRLGHRLSLPTTYELRPGERDGMPCWEVCFPPVHVPMDKE
Ga0210408_1107895523300021178SoilMEPRKNMTRSSLPPSDSPLTKVFLGQYVSSLIEETVRYLKMPHSRLAEEMSIPEMVLRDAVEGKLGLTRGQWVKLGQVLGLPTSYDLRPSERNGAPCWEVCFPPVPVKMDKA
Ga0210396_1029762733300021180SoilMQETITYLKLSYSDLALKMFVPEMVLRDAVEAKMPLTRGQWSRLAKLLELPTTFELRPVEQDGGPYWEVCYAPVAFIAATT
Ga0210393_1033162623300021401SoilMTHSSSLPPSDSPLTTMFLGQYVSRLMQETITYRKLPYDTLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGMPTTYELRPGERDGRPCWEICFPPVSLIANKT
Ga0210385_1154380713300021402SoilMESNTHSSEALPQSQVGMSRSASLPPSDSPLTKMFLGQYVSSLLQETITYLKLSYGDLALRMFLPEMVLRDAVDGKMGLTRGQWVRFGQALELPTTYVLRPGERDGAPYWELCFPPVSLVANKT
Ga0210384_1142136213300021432SoilETIRYLKLSYAGLAQQMSIPEMVLRDAVEGKMGLTRGQWVRLGKALGLPTAYELRPGEQDGVLCWEVCFPPVSLVANKT
Ga0210390_1021851343300021474SoilLKLSYSDLALKMFVPEMVLRDAVEAKMPLTRGQWSRLAKLLELPTTFELRPVEQDGGPYWEVCYAPVAFIAATT
Ga0210398_1006048983300021477SoilGMSRSASLPPSDSPLTKMFLGQYVSSLMQETITYLKLSYGDLALRMFLPEMVLRDAVDGKMGLTRGQWVRFGQALELPTTYVLRPGERDGAPYWELCFPPVSLVANKT
Ga0210402_1067169613300021478SoilMTRSSLPPSDSPLTKVFLGQYVSSLIEETVRYLKMPYSKLAQEMSIPEMVLRDATEGKLGLTRGQWVKLGQVLGLPTSYDLRPSERNGSPCWEVCFLPIPVKMDKA
Ga0210410_1105749013300021479SoilMFLGQYVSRLMQETITYRKLPYDTLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGMPTTYELRPGERDGRPCWEICFPPVSLIANKT
Ga0224541_101100223300022521SoilLKKSHSLPPSDSPLTLMFLGQYVSALMQETIAYLKLPYDKLALDMSIPEMVLRDAVEGKMGLTRGQWVKCGRLLALPTTYVLRPAERDGTPCWEVCFPPVSLWTNKT
Ga0224534_100229443300022524SoilMFVGQYVSKLMQETISYLKLSYEGLAHEMSIPETVLCEAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLVANKT
Ga0224549_103211423300022840SoilMFLGQYVSALMQETIAYLKLPYDKLALDMSIPEMVLRDAVEGKMGLTRGQWVKCGRLLALPTTYVLRPAERDGTPCWEVCFPPVSLWTNKT
Ga0224545_100099113300022881SoilMMRSSSLPPPDSPLTKMFLGQYVGCLIQETITYLKLSFSDLAATIFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRAAERDGVACWEVCYPPVSFIADKAGDRPSAGC
Ga0224545_100134553300022881SoilMMRSCSLPPPDSPLTKMFLGQYASCLIQETITYLKLSYSDLAVTTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRPAERDGMACWEVCYPPVSFIADRAGDRPLAD
Ga0224545_102773623300022881SoilVGCLIQETITYLKLSFSDLAATIFIPEMVLRDAVERKIALTRGQWIKLGHLLDLPTTYELRAAERDGVACWEVCYPPVSFIADKAGDRPLAD
Ga0224557_102586353300023101SoilMGYWSSPRSIDYGWAIDYAWLRGDDRSDMESTSHSSEALPQSQIGASRSSSLPPSDSPLTKVFLGQYVSSLTQETITYLRLSYSDLALLMFIPEMVLRDAVEGKMGLTRGQWVRLGQELELPTTYQLRPAERDGTPCWEICFPPVSLMANKT
Ga0224556_103456813300024295SoilSPLTTMFLGQYVSALMHETIDYLKLPYDVLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYVLRPGERDGVPCWEICFPPLSLMASKA
Ga0208036_100129833300025419PeatlandMQETIAYLKLSYGGLAHEMSIPELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVDRDPSLVGTH
Ga0208323_100121043300025439PeatlandMTHSSSLPPSDSPLTTMFLGQYVSKLMQETIAYLKLSYGGLAHEMSIPELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVDRDPSLVGTH
Ga0208687_101182333300025469PeatlandVGQYVSKLMQETISYLKLSYEGLADEMSIPEMVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYELRPAERDGTPCWEICFPPVSLAANKT
Ga0207928_100169133300025494Arctic Peat SoilMFLGQYVSALVHETIDYLKLPYDGLAPEMSIPELVLRDAVEGKMGLTRGQWVKFGLLLGPPTTYVLRPGERDGRPCWEICFPPLSLAANMT
Ga0207928_100800513300025494Arctic Peat SoilEGQTLTHPSTPPPSDSPLTLMFLGQYVSALMHETIAYLKLPYDKLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYILRPGEREGVPCWELCFPPVSLMLNKS
Ga0208937_100796433300025506PeatlandMFLGQYVSKLMQETIAYLKLSYGGLAHEMSIPELVLRDAVEGKMGLTHGQWVRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVD
Ga0208937_100997223300025506PeatlandMQETITYLKLSYVGLAHEMSIPELVLRDAVEGKMGLTRGQWIRLGKMLGLPTTYQLRPGERDGTPCWEICFPPVSFAAHEAVD
Ga0208848_104402923300025509Arctic Peat SoilMFLGQYVSALMHETIAYLKLPYDKLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYILRPGEREGVPCWELCFPPVSLMANKS
Ga0209890_1003789913300026291SoilMEGQTLTHPSTPPPSDSPLTLMFLGQYVSALMHETIAYLKLPYDKLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLALPTTYILRPGEREGVPCWEICFPPVSLMANKS
Ga0247846_100248463300026474SoilMESTSHSSEALPQSQIGASRSSSLPPSDSPLTKVFLGQYVSSLIQETITYLRLSYSDLALLMFIPEMVLRDAVEGKMGLTRGQWVRLGQELELPTTYQLRPAERDGTPCWEICFPPVSLMANKT
Ga0209733_101800713300027591Forest SoilMFLGQYVSALMQETIAYLKLPYDTLAHEMSIPEMVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYELRPGERDGMPCWEICFPPVSLVAGHR
Ga0208324_104985123300027604Peatlands SoilMQETISYLKLPYDKLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYILRPGERDGTPCWEICFPPVALT
Ga0209908_1024866213300027745Thawing PermafrostKMFLGQYVSYLIQETITYLKLSYSDLAATTFIPEMVLRDAVERKMALTRGQWIKLGHLLDLPTTYELRPAERDGVACWEVCYPPVSFIADKAEDRPLAD
Ga0209040_1043077013300027824Bog Forest SoilVSALMQETIAYLKLPYDKLAHEMSIPELVLRDAVGGKLGLTHGRWVRLGKILGLPTSYQLRPGERDGRPCWEVCFPPISLMANS
Ga0209274_1025420513300027853SoilMESNTHSFEALPQSHVGTSRSASLPPRDSPLTKMFLGQYVSSLMQETITYLKLSYDDLALRMFLPEMVLRDAVDGKMGLTRGQWVRFGQELGLPTTYVLRPGERDDVPCWEVCFPPVSLGANKT
Ga0209693_1039954213300027855SoilMFLGQYVSRLMQETITYRKLPYDTLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGMPTTYELRPGERDGRPCW
Ga0209579_1051058723300027869Surface SoilMESTTYSSETLPQSKVGVSRSFSLPPSDSPLTAVFAGQYVSSLMLETIRYLNLSYSDLALRMFLPEVVLRDAVEGKMGLTRGQWIRFGQELGLPTTYVLRPGERDRMPCWEVCFPPVTLGANKQ
Ga0209624_1018517723300027895Forest SoilMTHSSSLPPSDSPLTLMFLGQYVSKLMQETITYLKLPYNTLAHQMSIPELVLRDAVEAKMGLTRGQWVKLGQVLGLPTTYILRPGERDGMPCWEICFPPISLVANKT
Ga0209415_1015414623300027905Peatlands SoilLTHSSSLPPSDSPLTLMFLGQYVSKLMQETISYLKLPYDKLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYILRPGERDGTPCWEICFPPVALTAKKT
Ga0302168_101773223300028639FenMTHSSLPPLDSPLTTVFLGQYVSSLMLETIRYLKLAYGGLAHDMSIPEMVLRDAVERKMGLTRGQWVNLGQLLGLPTTYELRPGEQDGTPCWEVCYPPVHVSMDKT
Ga0302165_1003112033300028678FenMTHSSLPPLDSPLTTVFLGQYVSSLMLETIRYLKLAYGGLAHDMSIPEMVLRDAVERKMGLTRGQWVKLGQLLGLPTTYELRPGEQDGTPCWEVCYPPVHVSMDKT
Ga0302214_100907313300028736FenMTHSSLPPLDSPLTTVFLGQYVSSLMLETIRYLKLAFGGLAHDMSIPEMVLRDAVERKMGLTRGQWVKLGQLLGLPTTYELRPGEQDGTPCWEVCYPPVHVSMDKT
Ga0302258_110444013300028770FenLGQYVSALMLETIRYLKLAYGGLAHDMSIPEMVLRDAVERKMGLTRGQWVNLGQLLGLPTTYELRPGEQDGTPCWEVCYPPVHVSMDKT
Ga0302227_1021957223300028795PalsaLKLPYDKLALDMSIPEMVLRDAVEGKMGLTRGQWVKCGRLLALPTTYVLRPAERDGTPCWEVCFPPVSLWTNKT
Ga0265338_1017266923300028800RhizosphereMFLGQYVSSLMQETIMYLELSFDKLAHQMSIPELVLRDAVEGRMGLTRGQWVKFGKMLGLPTTYQLRPGERDGRPCWEICFPPVSFVAHKAVDSDPAVVGTH
Ga0311347_10002528123300029923FenLMLETIRYLKLAYGGLAHDMSIPEMVLRDAVERKMGLTRGQWVNLGQLLGLPTTYELRPGEQDGTPCWEVCYPPVHVSMDKT
Ga0302298_1028971813300029980FenGVLHSMTHSSLPPLDSPLTTVFLGQYVSSLMLETIRYLKLAFGGLAHDMSIPEMVLRDAVERKMGLTRGQWVNLGQLLGLPTTYELRPGEQDGTPCWEVCYPPVHVSMDKT
Ga0311336_1060224213300029990FenMFLGQYVSKLMQETITYCKQPYDKLAHEMSIPELVLRDAVEGRMGLTRGQWVKFGRLLGMPTAYELRPGEREGRPYWEICFPPVSFVAHKTVESGATPLDSLSPGRHS
Ga0311350_1003515223300030002FenMTHSSLPPLDSPLTTVFLGQYVSSLMLETIRYLKLAFGGLAHDMSIPEMVLRDAVERKMGLTRGQWVNLGQLLGLPTTYELRPGEQDGTPCWEVCYPPVHVSMDKT
Ga0302183_1041658113300030509PalsaMFLGQYVSALMQETIAYLKLPYDKLALDMSIPEMVLRDAVEGKMGLTRGQWVKCGRLLALPTTYVLRPAERDGTPCWEV
Ga0311372_1112939313300030520PalsaFLGQYVSALMQETIAYLKLPYDKLALDMSIPEMVLRDAVEGKMGLTRGQWVKCGRLLALPTTYVLRPAERDGTPCWEVCFPPVSLWTNKT
Ga0316363_1002243943300030659Peatlands SoilMFLGQYVSSLMQETITYRKLPYGGLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGVPTTYELRPGERDGRPCWEICFPPVSLTANRT
Ga0265753_105061513300030862SoilMQETIIHLKLSYSDLALTMFIPEMVLRDAVGAKMALTRGQWGRLGKLRGLPTTFELRPVERGGTPCGEVCYPPVSFVAYKPEGYR
Ga0265760_1004863123300031090SoilMTRSTHLPPADSPLTTVFLGQYVSSLMQETIKYLELSYADLAPKMFIPEVLLRDAVEGKMALTRGQWIRLGHLLDLPTTYELRPGERDGVPCWEICFPPIRVRVDEVETPKRARGQKTGFRMILRAWKNSTSKQSPL
Ga0265339_1053944413300031249RhizosphereMGYWSSPRSIDYGWAIDYAWLRGDDRSDMESTSHSSEALPQSQIGASRSSSLPPSDSPLTKVFLGQYVSSLTQETITYLRLSYSDLALLMFIPEMVLRDAVEGKMGLTRGQWVRLGQELELPTTYQLRPAERD
Ga0265316_1002036813300031344RhizosphereLPPSDSPLTKVFLGQYVSSLTQETITYLRLSYSDLALLMFIPEMVLRDAVEGKMGLTRGQWVRLGQELELPTTYQLRPAERDGAPCWEICFPPVSLMANKT
Ga0265314_10003261183300031711RhizosphereMGYWSSPRSIDYGWAIDYAWLRGDDRSDMESTSHSSEALPQSQIGASRSSSLPPSDSPLTKVFLGQYVSSLTQETITYLRLSYSDLALLMFIPEMVLRDAVEGKMGLTRGQWVRLGQELELPTTYQLRPAERDGAPCWEICFPPVSLMANKT
Ga0265314_1043621013300031711RhizosphereSSSLPPSDSPLTLMFLGQYVSKLMQETIAYLKLPYDKLAHEMSVPEMVLRDAVEGKMGLTRGQWVKFGRLLGLPTTYILRPGERDGIPCWEICFPPVSLVANKR
Ga0302321_10253200513300031726FenPEALAFRNMTHSSSLPPSDSPLTLMFLGQYVSKLMQETITYCKQPYDKLAHEMSIPELVLRDAVEGRMGLTRGQWVKFGRLLGMPTAYELRPGEREGRPYWEICFPPVSFVAHKTVESGATPLDSLSPGRHS
Ga0302319_1084760713300031788BogSDSPLTKVFLGQYVSSLIQETITYLQLPYGRLAQDMSIPEMVLRDAVEGKLGLTRGQWVRLGQMLDLPTTYELRPGERNDAACWELCFPPVHVTIDKAKPPASRR
Ga0302319_1140878913300031788BogRIGTSESLSEGPKAMTHSSCMPPRDSPLTTVFAGQYVSSLMLEEIKYLKLSYEGLAHEMSIPEIVLRDAVEGKMGLTRGQWVKLGQRLSLPTTYELLPGERDGAPCWEVCFPPVQVPMGK
Ga0311301_10003011493300032160Peatlands SoilMKRSSSLPPSDSPLTMMFLGQYVSSLMQETITYRKLPYGGLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGVPTTYELRPGERDGRPCWEICFPPVSLTANRT
Ga0311301_1035785153300032160Peatlands SoilMKVHTLTHSSSLPPSDSPLTTMFLGQYVSKLIQETIAYLELPYDKLAHQMSIPEMVLRDAVEGKMGLTRGQWIRLGKMLGLPTSYQLRPGERDGIPCWEICFPPVSLMANKT
Ga0335085_100003131323300032770SoilMQETITYLKKSYRGLAQEMSIPEMVLLDAVQGKLGLTRGQWLKLGQLLGLATTFDLRPSERIGTPCWEVCYAPIPSKSDDK
Ga0334790_007848_1610_18853300033887SoilMFLGQYVSKLMQETIRYLKLPYDTLAHEMSIPELVLRDAVEGKMGLTRGQWVKFGRLLGLPTIYQLRPGERDGTPCWEICFPPVALTANKT
Ga0334792_017558_206_5443300033888SoilMEGHTLTHPSSLPPSDSPLTLMFLGQYVSKLMQETIAYLKLPYDKLAHEMSIPELVLRDGVEGKMGLTRGQWVKFGRLLGLPTTYALRPGEQDGVPCWEICFPPVSLVANKK
Ga0334792_023363_687_9413300033888SoilMFLGQYVSKLMQETITYLKLPYDTLAHEMSVPEMVLHDAVEGKMGLTRRQWVRLGRMPGLPTTYILRRGERDGQVYLLISVILQ
Ga0334811_119510_56_3313300033891SoilMFLGEYVSKLMLETISYLKLSYDGLAHEMSIPEMVLRDAIEGKMGLTRGRWVRLGKVLGLPTTYKLRPAERDGTPCWEICFPPVSVVENKT
Ga0334822_088803_334_6513300034070SoilMESTSHSSEALPQSQIGASRSSSLPPSDSPLTKVFLGQYVSSLIQETITYLKLSYSDLALLMFIPEMVLRDAVEGKMGLTRGQWVRLGQELELPTTYQLRPAERDG
Ga0370515_0059687_24_2693300034163Untreated Peat SoilMQETIAYLKLPYDKLALDMSIPEMVLRDAVEGKMGLTRGQWVKCGRLLALPTTYVLRPAERDGTPCWEVCFPPVSLWTNKT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.