NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032126

Metagenome / Metatranscriptome Family F032126

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032126
Family Type Metagenome / Metatranscriptome
Number of Sequences 180
Average Sequence Length 185 residues
Representative Sequence SSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Number of Associated Samples 132
Number of Associated Scaffolds 180

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.79 %
% of genes near scaffold ends (potentially truncated) 81.11 %
% of genes from short scaffolds (< 2000 bps) 99.44 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.79

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (68.889 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(75.000 % of family members)
Environment Ontology (ENVO) Unclassified
(54.444 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(80.556 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 19.07%    β-sheet: 45.12%    Coil/Unstructured: 35.81%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.79
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.23.1.2: At5g01750-liked2q4ma_2q4m0.76761
d.23.1.1: Transcriptional factor tubby, C-terminal domaind1c8za_1c8z0.75719
f.4.5.1: Autotransporterd1uynx_1uyn0.5832
f.4.2.1: Outer membrane phospholipase A (OMPLA)d1qd5a_1qd50.56803
f.4.3.4: Outer membrane protein transport proteind3pgsa13pgs0.5323


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 180 Family Scaffolds
PF04525LOR 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 180 Family Scaffolds
COG4894Putative phospholipid scramblase YxjI, Tubby2 superfamilyLipid transport and metabolism [I] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.00 %
UnclassifiedrootN/A10.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003544|Ga0007417J51691_1105751All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta560Open in IMG/M
3300004121|Ga0058882_1826077All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta591Open in IMG/M
3300004631|Ga0058899_12042375All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta589Open in IMG/M
3300009411|Ga0115017_1032022All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri710Open in IMG/M
3300009411|Ga0115017_1034184All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta704Open in IMG/M
3300009411|Ga0115017_1090085All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta699Open in IMG/M
3300009411|Ga0115017_1291523All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta ricciae953Open in IMG/M
3300010199|Ga0127508_1197859All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta ricciae534Open in IMG/M
3300010858|Ga0126345_1098812All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta634Open in IMG/M
3300010859|Ga0126352_1114136All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta674Open in IMG/M
3300010870|Ga0102750_10801391All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri627Open in IMG/M
3300011120|Ga0150983_10938458All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri649Open in IMG/M
3300011120|Ga0150983_11742773All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta501Open in IMG/M
3300011120|Ga0150983_12292346All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta613Open in IMG/M
3300012212|Ga0150985_110459793All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta733Open in IMG/M
3300019270|Ga0181512_1743400All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri627Open in IMG/M
3300020069|Ga0197907_11258216All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri648Open in IMG/M
3300020070|Ga0206356_10408806All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri602Open in IMG/M
3300020076|Ga0206355_1205859All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri654Open in IMG/M
3300020080|Ga0206350_10303594All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri617Open in IMG/M
3300022467|Ga0224712_10423562All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri637Open in IMG/M
3300022509|Ga0242649_1038389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis639Open in IMG/M
3300022510|Ga0242652_1040125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis567Open in IMG/M
3300022513|Ga0242667_1027468All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta632Open in IMG/M
3300022529|Ga0242668_1081397All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri630Open in IMG/M
3300022532|Ga0242655_10198453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis612Open in IMG/M
3300022716|Ga0242673_1062449All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta653Open in IMG/M
3300022720|Ga0242672_1064701All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri648Open in IMG/M
3300022721|Ga0242666_1096582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis679Open in IMG/M
3300022722|Ga0242657_1150548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis613Open in IMG/M
3300024480|Ga0255223_1052444All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta695Open in IMG/M
3300028554|Ga0302047_10815952All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri627Open in IMG/M
3300030526|Ga0210267_1118725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis564Open in IMG/M
3300030528|Ga0210277_10182240All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta676Open in IMG/M
3300030528|Ga0210277_10283542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis671Open in IMG/M
3300030529|Ga0210284_1938684Not Available543Open in IMG/M
3300030530|Ga0210264_1047325All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri550Open in IMG/M
3300030535|Ga0210285_1435131All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta613Open in IMG/M
3300030535|Ga0210285_1542715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis696Open in IMG/M
3300030539|Ga0210281_1192047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis644Open in IMG/M
3300030539|Ga0210281_1386735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium lundense576Open in IMG/M
3300030540|Ga0247649_1057864All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri581Open in IMG/M
3300030543|Ga0210289_1126587All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta645Open in IMG/M
3300030543|Ga0210289_1244307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis674Open in IMG/M
3300030543|Ga0210289_1331939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis654Open in IMG/M
3300030545|Ga0210271_10430076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis656Open in IMG/M
3300030546|Ga0247646_1097064All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta720Open in IMG/M
3300030553|Ga0247645_1070303All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta722Open in IMG/M
3300030558|Ga0257197_1044011All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta776Open in IMG/M
3300030559|Ga0257205_1053001All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta771Open in IMG/M
3300030559|Ga0257205_1101116All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri622Open in IMG/M
3300030562|Ga0257207_1071795All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri584Open in IMG/M
3300030564|Ga0210256_10987247Not Available519Open in IMG/M
3300030568|Ga0257206_1068303All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta701Open in IMG/M
3300030569|Ga0247628_1114434Not Available707Open in IMG/M
3300030570|Ga0247647_1091750Not Available736Open in IMG/M
3300030570|Ga0247647_1124367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora setae669Open in IMG/M
3300030570|Ga0247647_1285069All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta ricciae500Open in IMG/M
3300030571|Ga0247652_1059836Not Available711Open in IMG/M
3300030571|Ga0247652_1099933All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta630Open in IMG/M
3300030572|Ga0210258_10303263All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta684Open in IMG/M
3300030577|Ga0210260_10007595All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri1365Open in IMG/M
3300030578|Ga0210275_10126634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis735Open in IMG/M
3300030578|Ga0210275_10244453Not Available600Open in IMG/M
3300030579|Ga0247633_10106425All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri691Open in IMG/M
3300030579|Ga0247633_10197696All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta594Open in IMG/M
3300030581|Ga0210270_1178391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. OK780586Open in IMG/M
3300030582|Ga0210261_1080389All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta707Open in IMG/M
3300030585|Ga0247639_1128799All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta690Open in IMG/M
3300030588|Ga0210283_1199420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis502Open in IMG/M
3300030588|Ga0210283_1310052Not Available694Open in IMG/M
3300030589|Ga0210255_10118001Not Available716Open in IMG/M
3300030589|Ga0210255_10710237Not Available506Open in IMG/M
3300030593|Ga0210263_1068337All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta728Open in IMG/M
3300030593|Ga0210263_1190408Not Available529Open in IMG/M
3300030594|Ga0210280_1074068All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta676Open in IMG/M
3300030595|Ga0210276_10965293All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta665Open in IMG/M
3300030595|Ga0210276_11182490All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta ricciae515Open in IMG/M
3300030596|Ga0210278_1107429All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri636Open in IMG/M
3300030598|Ga0210287_1087841All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri726Open in IMG/M
3300030608|Ga0247651_10124382All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta702Open in IMG/M
3300030612|Ga0257196_1203984All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri693Open in IMG/M
3300030615|Ga0257185_10380205All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta ricciae531Open in IMG/M
3300030622|Ga0265391_10055953Not Available838Open in IMG/M
3300030624|Ga0210251_10061715Not Available670Open in IMG/M
3300030625|Ga0210259_10152341All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta610Open in IMG/M
3300030627|Ga0210269_10230978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis616Open in IMG/M
3300030628|Ga0247629_10234338All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta643Open in IMG/M
3300030629|Ga0210268_1017723All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta1223Open in IMG/M
3300030630|Ga0210282_10246115All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta605Open in IMG/M
3300030631|Ga0210279_10254352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis653Open in IMG/M
3300030631|Ga0210279_10315601All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta604Open in IMG/M
3300030738|Ga0265462_10031052All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta1621Open in IMG/M
3300030738|Ga0265462_10205132All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1094Open in IMG/M
3300030738|Ga0265462_12588771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis507Open in IMG/M
3300030740|Ga0265460_10465184All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri963Open in IMG/M
3300030740|Ga0265460_12196769All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri580Open in IMG/M
3300030741|Ga0265459_13267345Not Available567Open in IMG/M
3300030741|Ga0265459_13707164All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri536Open in IMG/M
3300030743|Ga0265461_11973609All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta664Open in IMG/M
3300030743|Ga0265461_11975608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis664Open in IMG/M
3300030748|Ga0074043_11570719All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta667Open in IMG/M
3300030751|Ga0102764_1867370All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri570Open in IMG/M
3300030758|Ga0138305_1587938All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta689Open in IMG/M
3300030776|Ga0075396_1961727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis687Open in IMG/M
3300030777|Ga0075402_12170224All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri614Open in IMG/M
3300030778|Ga0075398_10116673All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta768Open in IMG/M
3300030779|Ga0075378_11091297Not Available611Open in IMG/M
3300030784|Ga0102758_10042108All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri770Open in IMG/M
3300030804|Ga0102769_10971367All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri656Open in IMG/M
3300030839|Ga0073999_10075324All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta705Open in IMG/M
3300030841|Ga0075384_10021925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis677Open in IMG/M
3300030842|Ga0075404_10038185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis654Open in IMG/M
3300030846|Ga0075403_10036960All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta565Open in IMG/M
3300030847|Ga0075405_11764910All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta628Open in IMG/M
3300030847|Ga0075405_11899286All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri679Open in IMG/M
3300030848|Ga0075388_10059712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis645Open in IMG/M
3300030848|Ga0075388_11660201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. OK780506Open in IMG/M
3300030850|Ga0075387_10065057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis641Open in IMG/M
3300030850|Ga0075387_11442194All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta674Open in IMG/M
3300030853|Ga0075372_10130802All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta530Open in IMG/M
3300030854|Ga0075385_10066669All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta739Open in IMG/M
3300030911|Ga0102763_10938074All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri658Open in IMG/M
3300030923|Ga0138296_1884438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis672Open in IMG/M
3300030931|Ga0074006_10039150All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri628Open in IMG/M
3300030931|Ga0074006_11568474All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta620Open in IMG/M
3300030933|Ga0074039_10003755All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri565Open in IMG/M
3300030933|Ga0074039_10041165All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta753Open in IMG/M
3300030933|Ga0074039_11523640All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri596Open in IMG/M
3300030936|Ga0138306_1489960All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta612Open in IMG/M
3300030937|Ga0138302_1109537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis689Open in IMG/M
3300030938|Ga0138299_10427378All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta ricciae520Open in IMG/M
3300030938|Ga0138299_10654249All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta561Open in IMG/M
3300030939|Ga0138303_1503263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis689Open in IMG/M
3300030945|Ga0075373_10075315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis645Open in IMG/M
3300030945|Ga0075373_11530936All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri582Open in IMG/M
3300030947|Ga0075390_10053636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis572Open in IMG/M
3300030949|Ga0074031_1943526All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta568Open in IMG/M
3300030962|Ga0138297_1386442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis710Open in IMG/M
3300030972|Ga0075400_11803210Not Available616Open in IMG/M
3300030972|Ga0075400_11946440All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri676Open in IMG/M
3300030973|Ga0075395_10094984All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri764Open in IMG/M
3300030974|Ga0075371_10106875All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta605Open in IMG/M
3300030979|Ga0068589_11982982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis629Open in IMG/M
3300030980|Ga0074027_10099379Not Available670Open in IMG/M
3300030980|Ga0074027_11278894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis643Open in IMG/M
3300030980|Ga0074027_11345434All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta586Open in IMG/M
3300030992|Ga0074040_10038599All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta649Open in IMG/M
3300030997|Ga0073997_12206533All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta586Open in IMG/M
3300031008|Ga0074038_11814387All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta654Open in IMG/M
3300031008|Ga0074038_11886554All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta667Open in IMG/M
3300031022|Ga0138301_1828314All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri537Open in IMG/M
3300031029|Ga0074012_11698784All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri620Open in IMG/M
3300031030|Ga0074030_11047098All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta638Open in IMG/M
3300031031|Ga0074042_11257087All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri652Open in IMG/M
3300031031|Ga0074042_11398331All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta734Open in IMG/M
3300031050|Ga0074028_10001910Not Available522Open in IMG/M
3300031057|Ga0170834_106562531All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta631Open in IMG/M
3300031057|Ga0170834_110938769All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri587Open in IMG/M
3300031128|Ga0170823_11298090All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri681Open in IMG/M
3300031231|Ga0170824_117579849All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri554Open in IMG/M
3300031411|Ga0102761_10082851All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri639Open in IMG/M
3300031446|Ga0170820_13220012All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri648Open in IMG/M
3300031446|Ga0170820_16129127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. OK780638Open in IMG/M
3300031469|Ga0170819_12152301All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri575Open in IMG/M
3300031469|Ga0170819_12434314All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea978Open in IMG/M
3300031474|Ga0170818_100842475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. OK780641Open in IMG/M
3300031474|Ga0170818_103404478All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri583Open in IMG/M
3300032515|Ga0348332_10401761All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta645Open in IMG/M
3300032515|Ga0348332_11555373All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta561Open in IMG/M
3300032515|Ga0348332_13243815All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri644Open in IMG/M
3300032625|Ga0214501_1225585All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri595Open in IMG/M
3300032756|Ga0315742_11265280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta765Open in IMG/M
3300032756|Ga0315742_11652394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis695Open in IMG/M
3300032756|Ga0315742_11749304All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri680Open in IMG/M
3300032756|Ga0315742_11939918All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta steineri653Open in IMG/M
3300033523|Ga0314768_1205981All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta690Open in IMG/M
3300033533|Ga0314770_1208882All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta612Open in IMG/M
3300033542|Ga0314769_1294205All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta545Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil75.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil7.78%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated3.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.78%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere2.22%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.67%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.11%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.11%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.56%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003544Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004121Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009411Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010199Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum fallax MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010870Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022509Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022513Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024480Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028554Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9)EnvironmentalOpen in IMG/M
3300030525Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO037SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030526Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030530Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030539Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030540Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030546Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030553Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030558Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-2E (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030559Metatranscriptome of plant litter fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030562Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-2W (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030568Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030569Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030570Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030571Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030577Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030581Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030582Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030585Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030588Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030593Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030608Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030612Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030615Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030628Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030629Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030748Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030751Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030758Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030776Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030779Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030784Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030804Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030839Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030846Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030847Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030850Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030853Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030854Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030911Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030931Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030933Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030936Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030937Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030939Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030947Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030949Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030962Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030972Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030973Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030974Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030979Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030980Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030992Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030997Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031008Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031029Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031030Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031031Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031050Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031411Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033523Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033533Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0007417J51691_110575113300003544Avena Fatua RhizosphereSTIMQLSIFALVAFGMLLAFVQCIDKTTVAEYEIKEGLLSGGRSYEIKSKTNVPTKFTIRNELFHVGKKLILLEDGKERYIVKHDITKLMSTWTIKNPNTNQDLGTIENKLQFVGSKMDARGVFGHYTIEGNFGNHEFTIKKDGHQVAKIGKETFHIHDTYGLTVYGDTDRALMVLFTVIVDQIRE
Ga0058882_182607713300004121Forest SoilLVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAPTHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH*
Ga0058899_1204237513300004631Forest SoilILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDNVLGKIENKVRFIGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDADRALMVLFTIIVDEIREH*
Ga0115017_103202213300009411SoilMKASLFALVALAMLLAVAQSKTHSKKVAEYVIKQGLLSGGRSYEIKSKTNAPEKFTIRNELFHVGKKLFLLEDGKERYSVKHDILNLMSTWTIKETGTDREVGTIENKLRFVGSKMTANGAFGHFTINGDFGTHEYTIKKDGVKVARIHKAPLHIHDTYDLSVYGEADRALMVLFTIIVDEIRQH*
Ga0115017_103418413300009411SoilYAHYFTIHPVSSIMQSSIFALVAFGMLLALVQCVDKTHVTEYEIKQGLLSGGRSYDIKSKINAPTHFTIRNELLSVGKKLVLLEDGKERYIVKHDVLNLMSTWSIKEVGTEKELGTIENKLRFVGSKISANGVFGHYIIHGKFGNRSYNIKKDGKKVAKVEKKGAHLHDTYGLTVYGDTDRALMVLFTVIVDEIREH*
Ga0115017_109008513300009411SoilMFALVALSILLACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASTGKELGTIENKLRFVGSKMTANGAFGHYTIEGDFGNHSFTIKKEGKKVAKIEKKSFHIHDTYGLTVYGDDSRALMVLFTVIVDEIREH
Ga0115017_129152323300009411SoilMLLAFVQCDHETTVAEYEIKADLIDLGNSYQIKSKTNAPTQFSIRNKFLSVPKKFFLLENGKEVYIAKNVLTSVMSTWRIKEAGSGKELGTIENKLKFTGSEMTANGAFGNYRLEGNFGNHEFTIMKDGTKVAAIEKKIPHIHDTYDLRVYGDADRALMVLFTVIVDEIL*
Ga0127508_119785913300010199Host-AssociatedILFTLQYSIMQSTIFALVAFGMLLAFVQCADKVSMAEYEIKEGFLSGGRSYEIESKTNAASKFSIRNELFHIGRKLFLLKDGEEIYTVKHELLNLMSTWTITDSQTGKEMGTLENKLRLVGSTMEANGAFGHYRIEGDFGNHSFTIKKDGEKVATIEKKSFHLHDTYGLTVYGDANQA
Ga0126345_109881213300010858Boreal Forest SoilILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHSFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH*
Ga0126352_111413613300010859Boreal Forest SoilMQSSIFALVAFGMLLAFVQCTDKTATAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDNVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHSFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDADRALMVLFTIIVDEIREH*
Ga0102750_1080139113300010870SoilSLTMQSSHFALLAFGMLLAFVHCDKDTKVSEYVIKEGLLTGGRSYDIESKTNAPSKFIIQNELFRVGKKLTLLEDGKPRYIVTHELLNLMSTWTVKDANSDKELGTIQNQIKIIGSLIEAKGTFGYFKIEGNFGNHEFIITKDGQKLASIEKKRFHLHDTYGLSVYGDADRALMVLFTVIVDEIREH*
Ga0150983_1093845813300011120Forest SoilSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAATHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH*
Ga0150983_1174277313300011120Forest SoilIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEITSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDNVLGKIENKVRFIGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGD
Ga0150983_1229234613300011120Forest SoilSSIMQSSIFALVAFGMLFAVVQCTNTTTVAEYEIKEGLLSGGRSYEIKSKINAPTKFSVKNELLSVGKKLILLEDGKERYIVKHDVLKLMSTWTIKEAHTDKELGKIENKVKFIGSKIVAKGDFGHYTINGNFRNHEFTIKKDHHEVAKVAKKNLHVHDTYDLTVYGDTDRALMVLFTIIVDEIRQH*
Ga0150985_11045979323300012212Avena Fatua RhizosphereMQLSIFALVAFGMLLAFVQCIDKTTVAEYEIKEGLLSGGRSYEIKSKTNVPTKFTIRNELFHVGKKLILLEDGKERYIVKHDITKLMSTWTIKNPNTNQDLGTIENKLQFVGSKMDARGVFGHYTIEGNFGNHEFTIKKDGHQVAKIGKETFHIHDTYGLTVYGDTDRALMVLFTVIVDQIREH*
Ga0181512_174340013300019270PeatlandQQSSIMQSSVFALIAFGMLLAFVQCTGPTVEFEIKEGLLSGGRSYEITSKTKDAPHFTIKNELFSVGKKLDLLENGKERYTVHHDVLNLMSTWTIKDAVTGKDVGTIKNKLKFIGSKLVAEGTFGHYKIEGNFGTHHYTILKDGHKVATIEKKSFHLHDTYGLTVLGDTDRALMVLFTVIVDEIRQH
Ga0197907_1125821613300020069Corn, Switchgrass And Miscanthus RhizosphereMQSTIFALVAFGMLLTFVQCIDKTAVSEYEIKQGLLSGGRSYEIKSKINAPSHFTIRNELFSVGKKLVLLEDGKERYTVKHEILNLLSTWTIKDLISGKELGTIENKLRVVGSKIEAHGVFGHYKIEGDFGNHSFTIKKDGVKVAQIEKKSFHIHDTYGLTVYGDNDRALMVLFTIIVDEIREH
Ga0206356_1040880613300020070Corn, Switchgrass And Miscanthus RhizosphereMQSTIFALVAFGMLLTFVQCIDKTAVSEYEIKQGLLSGGRSYEIKSKINAPSHFTIRNELFSVGKKLVLLEDGKERYTVKHEILNLLSTWTIKDLISGKELGTIENKLRVVGSKIEAHGVFGHYKIEGDFGNHSFTIKKDGVKVAQIEKKSFHIHDTYGLTVFGETDRALMVLFTVIVDEIREH
Ga0206355_120585913300020076Corn, Switchgrass And Miscanthus RhizosphereMQSTIFALVAFGMLLTFVQCIDKTAVSEYEIKQVFLVEVEVMKLKAKSMHHHILQFEMNFSVLAKKLVLLEDGKERYTVKHEILNLLSTWTIKDLISGKELGTIENKLRVVGSKIEAHGVFGHYKIEGDFGNHSFTIKKDGVKVAQIEKKSFHIHDTYGLTVYGDTDRALMVLFTIIVDEIREH
Ga0206350_1030359423300020080Corn, Switchgrass And Miscanthus RhizosphereTIFALVAFGMLLTFVQCIDKTAVSEYEIKQGLLSGGRSYEIKNKINAPSHFSIRNELFSVGKKLILLEDGKERYTVKHEILNLMSTWTIKDSISGKELGTIENKIRLIGSKIEAHGVFGHYKIEGDFGNHSFTIKKDGVKVAQIEKKSFHIHDTYGLTVFGETDRALMVLFTVIVDEIRE
Ga0224712_1042356213300022467Corn, Switchgrass And Miscanthus RhizosphereYFNIQSSIMQSTIFALVAFGMLLTFVQCIDKTAVSEYEIKQGLLSGGRSYEIKNKINAPSHFSIRNELFSVGKKLILLEDGKERYTVKHEILNLMSTWTIKDSISGKELGTIENKIRLIGSKIEAHGVFGHYKIEGDFGNHSFTIKKDGVKVAQIEKKSFHIHDTYGLTVFGETDRALMVLFTVIVDEIREH
Ga0242649_103838913300022509SoilLQSSIIMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAPTHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPSTDKVLGKIENKLRFVGSKIEANGVFGHYAIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0242652_104012513300022510SoilFTLRSSIMQSSIFALVALGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKTNAATHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDNVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDADRALMVLFTIIVDEI
Ga0242667_102746813300022513SoilILFIIQSSIMQSSIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0242668_108139713300022529SoilIQHSSIMQSSVVALIAFGMLLAFVQCTGPTIEFEIKEGLLSGGRSYEITSKTKDAPHFTIKNELFSVGKKLDLLENGKERYTVHHVVLKLMSTWTIKDAVTGKDVGTIKNKLKFVGSKLVAEGTFGHYNIEGNFGTHHYNIMKDGHKVATIEKKSFHLHDTYGLTVLGDTDRALMVLFTVIVDEIRQH
Ga0242655_1019845313300022532SoilLQSSIIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPSTDKVLGKIENKLRFVGSKIEANGVFGHYAIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0242673_106244913300022716SoilLFIIQSSIMQSSIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0242672_106470113300022720SoilILFTLQSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLSGGRSYEIKSKTNAPSKFSIRNELFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHVHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0242666_109658213300022721SoilMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAATHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0242657_115054813300022722SoilLFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTKFSVKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDNVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDADRALMVLFTIIVDEIREH
Ga0255223_105244413300024480FreshwaterSNSISIMQTSIFVLVAFAMLLALVQSKKPTEKVAEFIIKQGLLSGGRSYEIKGETNAPEKFTIRNELFHVGKKLFLSEDGKERYVVKHDILNLMSTWVIKESGTEKEIGTIENKVKFVGSKITANGVFGHYTIHGKFGNHEFTIKKDGVKVARIQKKRLHLHDTYGLSVYGNADRALMVLFTIIVDEIRQH
Ga0302047_1081595213300028554SoilSLTMQSSHFALLAFGMLLAFVHCDKDTKVSEYVIKEGLLTGGRSYDIESKTNAPSKFIIQNELFRVGKKLTLLEDGKPRYIVTHELLNLMSTWTVKDANSDKELGTIQNQIKIIGSLIEAKGTFGYFKIEGNFGNHEFIITKDGQKLASIEKKRFHLHDTYGLSVYGDADRALMVLFTVIVDEIREH
Ga0210273_118919213300030525SoilFNIVFGYGRCYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0210267_111872513300030526SoilQSSIIMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAPTHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEI
Ga0210277_1018224013300030528SoilLQSSIIMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAATHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFNIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0210277_1028354213300030528SoilLQSSIIMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDADRALMVLFTIIVDEIREH
Ga0210284_193868413300030529SoilGRSYEITSKMNAPTKFSIRNELLSVGKKLALLEDDKERYIVKHDILKLMSTWTITEANTDKVLGKIEHKLKFGGSKLVAEGTFGHYIINGNFRNREVTIKKDNHLVARITQKNRLLHDTCDLLVFGDTDRALMVLFTVIGNEIRQH
Ga0210264_104732523300030530SoilFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAATHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0210285_143513113300030535SoilHNILFIQQSSIMQSSMFALVALSMLLVAVQCTDRKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNVGKKLILLEDGRERFIVKHDILNLMSTWTIKEAGTDKELGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHAFTIKKEGGKVAKIEKKSFHLHDTYGLKVYGDADQALMVLFTVIVDEIREH
Ga0210285_154271513300030535SoilHIILFIIQSSIMQSSIFALVAFGMLFAVVQCTNTTTVAEYEIKEGLLSGGRSYEIKSKTNAPTKFSVKNELLSVGKKLILLEDNKERFIVKHDVLKLMSTWTIKEADNDKVLGKIENKLKFIGSKMVAKGPFGHYTIHGNFRNHEYTIKKDNHKVAKVAKKDLHVHDTYDLTVYGDADRALMVLFTIIVDEVRQH
Ga0210281_119204713300030539SoilIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDADRALMVLFTIIVDEIREH
Ga0210281_138673513300030539SoilFIFDGKFCWSICFTFNFITTTSTKKTFFNFVFIIQSSIMQSSIFALVAFGMLFAVVQCMNTTTVAEYEIKEGLLSGGRSYEIKSKTNAPTKFSVKNELLSVGKKLMLLEDGKERFIVKHDVLKLMSTWTIKEAHTDKELGKIENKIKFVGSKIVAKGAFGHYTISGNFRNHEFTIKKDHHEVAKVAKKNLH
Ga0247649_105786413300030540SoilEFEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNAGKKLILLEDGKEVYIVKHDILNVMSTWTIKEANTGKELGTIENKLKFVGSKMTANGAFGHYTIEGNFGNHEFTIKKEGEKVAKIEKKSFHLHDTYGLRVYGEENRALMVLFTVIVDEIREH
Ga0210289_112658713300030543SoilAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0210289_124430713300030543SoilAHYIILFTLQSSIMQSSILALVAFGMLLAFVQCTDKKNMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDADRALMVLFTIIVDEIREH
Ga0210289_133193913300030543SoilIMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAPTHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0210271_1043007613300030545SoilQSSIIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDADRALMVLFTIIVDEIREH
Ga0247646_109706413300030546SoilYEHYYTHIIFIIQRLSIMQSSMFALVALSMLLACVQCTDKKNVAEFEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNAGKKLILLEDGKEVYIVKHDILNVMSTWTVKEANTGKELGTIENKLKFVGSKMTANGAFGHYTIEGNFGNHEFTIKKEGEKVAKIEKKSFHLHDTYGLRVYGEENRALMVLFTVIVDEIREH
Ga0247645_107030313300030553SoilTHIIFIIQRLSIMQSSMFALVALSMLLACVQCTDKKNVAEFEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNAGKKLILLEDGKEVYIVKHDILNVMSTWTIKEANTGKELGTIENKLKFVGSKMTANGAFGHYTIEGNFGNHEFTIKKEGEKVAKIEKKSFHLHDTYGLRVYGEENRALLVLFTVIVDEIREH
Ga0257197_104401113300030558Host-AssociatedLSIMQSSMFALVALSMLLACVQCHDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASTGKELGTIENKLRFVGSKMTANGAFGHYTIEGDFGNHSFTIKKEGKKVAKIEKKSFHIHDTYGLTVYGDDSRALMVLFTVIVDEIREH
Ga0257205_105300113300030559Host-AssociatedMQSSMFALVALSMLLACVQCHDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASTGKELGTIENKLRFVGSKMTANGAFGHYTIEGDFGNHSFTIKKEGKKVAKIEKKSFHIHDTYGLTVYGDDSRALMVLFTVIVDEIREH
Ga0257205_110111613300030559Host-AssociatedFFGMLLALVQCKHKHMGNVAEYEIKQGLLSGGRVYEVKSETNAPSHFTVRNELLSVGKKLLLLEDGKERYSVKHDILNLMSTWTIKESGTDKEVGTIENKLRLVGSKMSANGAFGHYTIEGDFGNHVFTIKKDGQEVAKIHKERLHIHDTYGLTVYGDADRALMVLFTIIVDEIREH
Ga0257207_107179513300030562Host-AssociatedNVAEYEIKQGLLSGGRHYEIKSKSNAPSRFTVRNELFKVGKKLILSEDGKERYTVKHDILNLMSTWVIKESISHKEVGTIKNKLQFVGSEIDANGVFGHYKIEGNFGNHVFNILKDGHKVAMIEKKSFHLHDTYGLTVFDNTDRALMVLFTIIVDEIRQH
Ga0210256_1098724713300030564SoilYTHYFTYPTLYSIMQSMMFALVALSMLLAFVQCSNHKLVSEYEIKEGLLSGGRSYRIKSKTNAPKQYTIQNELFKLGKALTLLENGKPIYTVKHDILNLMSTWTIKEATTDKVLGTMENKLRFVGSKMAFNGLLGHYTIHGNFGNHEYMIEKDGVKVAKIHKKNYRLHDTYD
Ga0257206_106830313300030568Host-AssociatedLTIQFILQYQIMQSSIIALVAFSMLLALVQCNHEKKVSVYEIKQGFLSGGRTYDIKGKTNAPLKFSTRNELLSVGKKLTLLEDNKERFTVKHDISNLMSTWTITESVGGKQLGTIQNKLRLVGSTIDANGEFGHYKIEGDFGNHSFTIMKDGHEVAKIAKKSFNIRDTYDLTVFGEADQALMVLFTIIVDEIREH
Ga0247628_111443413300030569SoilHIILFIIQSSIMQSSIFALVAFGMLFAVVQCANNTMNKTITVPVAEYEIKQGLLGEGRSYDITSKKNAPTKFSIRNELRSVGKKLTLLEDDKEHYMVKHDVSKLMSTWTITEANTDKVLGKIEHKLKVVGPKMDAKGTFGHYTINGQFRNHEFAIKQKNRYVAKITKKNRRLHGTYDLIVYGDTDRALMVLFTIIADEIHQH
Ga0247647_109175023300030570SoilMILQAKKNAPTKFSIRNELRSVGKKLTLLEDDKEHYMVKHDVSKLMSTWTITEANTDKVLGKIEHKLKAVGPKMDAKGTFGHYTINGQFRNHEFAIKQKNRYVAKITKKNRRLHGTYDLIVYGDTDRALMVLFTIIADEIHQH
Ga0247647_112436713300030570SoilLSSTMQSSIVTLVAFGMLLAFVQCGDKKNVAEYEIKQGLLSGGRSYEIKSKTNAPTKFTIENEFFTVGKNLTLSEDGKERYVVKHDILNLMSTWVIKEVGTDKELGTLENKLRFVGSKMEANGAFGHYTIEGDFGNHSFTIKKEGTKVAMIEKKSFHLHDTYGLTVYGDADRALMVLFSIIVDEIREH
Ga0247647_128506913300030570SoilYFTIHPVSSIMQSSIFALVAFGMLLALVQCVDKTHVTEYEIQQGLLSGGRSYDIKSKVNAPTHFTIRNELLSMGKKLVLLEDGKERYIVKHDVLNLMSTWTIKEVSTNKDLGTIENKLKFVGSKISANGVFGHYIIHGKFGNRSYTIKKDGKKVAKVEKKGAHLHD
Ga0247652_105983613300030571SoilIILFIIQSSIMQSSIFALVAFGMLFAVVQCANNTMNKTITVPVAEYEIKQGLLSEGRSYEITSKKNAPTKFSIRNELRSVGKKLTLLEDDKEHYMVKHDVSKLMSTWTITEANTDKVLGKIEHKLKAVGPKMDAKGTFGHYTINGQFRNHEFAIKQKNRYVAKITKKNRRLHGTYELIVYGDTDRALMVLFTVIADEIHHH
Ga0247652_109993313300030571SoilHIIFIIQRLSIMQSSMFALVALSMLLACVQCTDKKNVAEFEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNAGKKLILLEDGKEVYIVKHDILNVMSTWTIKEANTGKELGTIENKLKFVGSKMTANGAFGHYTIEGNFGNHEFTIKKEGEKVAKIEKKSFHLHDTYGLRVYGEENRALMVLFTVIVDEIREH
Ga0210258_1030326313300030572SoilILFIIQSSIMQSSIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYDHTDPALMVLFTIIVDEIRQH
Ga0210260_1000759523300030577SoilMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAATHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFNIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0210275_1012663413300030578SoilHDQYHQRQSNHTHIILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDADRALMVLFTIIVDEIREH
Ga0210275_1024445313300030578SoilIMQSSIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYDHTDPALMILFTIIVDEIRQH
Ga0247633_1010642513300030579SoilHIIFIIQRLSIMQSSMFALVALSMLLACVQCNDKKNVAEFEIKEGLLSGGRSYEIKSKTNAPTRFTIRNELFNAGKKLILLEDGKEVYIVKHDILNLMSTWTVKEANTGKEVGTIENKLRFVGSKITANGAFGHYNIEGNFGNHEFTIKKEGHKVAKIDKKSFHLHDTYGLKVYGEENRALMVLFTVIVDEIREH
Ga0247633_1019769613300030579SoilTHIIFIIQRLSIMQSSMFALVALSMLLACVQCTDKKNVAEFEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNAGKKLILLEDGKEVYIVKHDILNVMSTWTIKEANTGKELGTIENKLKFVGSKMTANGAFGHYTIEGNFGNHEFTIKKEGEKVAKIEKKSFHLHDTYGLRVYGEENRALMVLFTVIVDEIREH
Ga0210270_117839113300030581SoilYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVFIYNHC
Ga0210261_108038913300030582SoilMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAATHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFNIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0247639_112879913300030585SoilMQSTMFALVALSMLLACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFVIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEANNGKELGTIENKLRFVGSKITANGAFGHYTIEGNFGNHEFTIKKEGKKVAKIEKKSFHVHDTYGLTVYGEENRALLVLFTVIVDEIREH
Ga0210283_119942013300030588SoilEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDNVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0210283_131005213300030588SoilVDIILFIIQSSIMQSSIFALVAFGMLFAVVQCTNTTTVAEYEIKEGLLSGGRSYEIKSKTNAPTKFSVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEADNDKVLGKIENKLKFIGSKMVAKGPFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYDHTDPALMILFTIIVDEIRQH
Ga0210255_1011800113300030589SoilHIILFIIQSSIMQSSIFALVAFGMLFAVVQCTNSTMNKTVTVAEYIIKEGLLSGGRSYEITSKMNAPTKFSIRNELLSVGKKLALLEDDKERYIVKHDILKLMSTWTITEANTDKVLGKIEHKLKFGGSKLVAEGTFGHYIINGNFRNREVTIKKDNHLVARITQKNRLLHDTCDLLVFGDTDRALMVLFTVIGNEIRQH
Ga0210255_1071023713300030589SoilILFIIQSSIMQSSIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYD
Ga0210263_106833713300030593SoilMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAPTHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFNIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0210263_119040813300030593SoilNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0210280_107406813300030594SoilQSSIMQSSMFALVALSMLLVAVQCTDRKSVTEYEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNVGKKLILLEDGRERFIVKHDILNLMSTWTIKEAGTDKELGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHAFTIKKEGGKVAKIEKKSFHLHDTYGLKVYGDADQALMVLFTVIVDEIREH
Ga0210276_1096529313300030595SoilNILFIQQSSIMQSSMFALVALSMLLVAVQCTDRKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNVGKKLILLEDGRERFIVKHDILNLMSTWTIKEAGTDKELGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHAFTIKKEGGKVAKIEKKSFHLHDTYGLKVYGDADQALMVLFTVIVDEIREH
Ga0210276_1118249013300030595SoilRYHTHIILFTIPSSIMQSSIFALVVFGMLLAFVQCANKTVVTEYEIKEGLLSGGRSYEIKGKTNAPTKFTIKNELLSVGKKLVLLGDDKEVYIAKHDVLNLMSTWTIKEASSGKEVGTLENKLRFVGSKIIANGAFGHYTIQGDFGNHKFSIKKDGHKVAKIEKKSFHIHD
Ga0210278_110742913300030596SoilFALVSFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAPTHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFNIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0210287_108784113300030598SoilMQSSMFALVALSVLLACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPKKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASTGKEVGTIENKLRFVGSKITANGAFGRYTIEGNFGNHEFTIKKEGQKVAKIEKKSFHIHDTYGLNVYGNENPALMVLFTVIVDEIREH
Ga0247651_1012438213300030608SoilMQSTMFALVALSMLLACVQCTDKKNVAEFEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNAGKKLILLEDGKEVYIVKHDILNVMSTWTIKEANTGKELGTIENKLKFVGSKMTANGAFGHYTIEGNFGNHEFTIKKEGEKVAKIEKKSFHLHDTYGLRVYGEENRALMVLFTVIVDEIREH
Ga0257196_120398413300030612Host-AssociatedMQSSIFALVAFGMLLAFVQCTDKPNVAEYEIKQGLLSGGRHYEIKSKSNAPSRFTVRNELFKVGKKLILSEDGKERYTVKHDILNLMSTWVIKESISHKEVGTIKNKLQFVGSEIDANGVFGHYKIEGNFGNHVFNILKDGHKVAMIEKKSFHLHDTYGLTVFDNTDRALMVLFTIIVDEIRQH
Ga0257185_1038020513300030615Host-AssociatedMQSSMFALVALSMLLACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDDKEVYIVKHDILNIMSTWTIKEASTGKELGTIENKLRFVGSKMTANGAFGHYTIEGDFGNHSFTIKKEGKKVAKIEKKSFHIHDTYGLTVYGD
Ga0265391_1005595313300030622SoilIDGHFAHIHTHIFKRKKGKRFYKNIWFNVVEFHHTYIILFIIQSSIMQSSIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYDHTDPALMILFTIIVDEIRQH
Ga0210251_1006171513300030624SoilSIMQSSIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYDHTDPALMILFTIIVDEIRQH
Ga0210259_1015234113300030625SoilAFGMLLALVQCTDNTNVSEFEIKEGLLSGGRSYEIKSKKNAPTHFSIRNELFSVGKKLVLLEDGKERYIVKHDILNLMSTWTIKEVGSGRELGTIENEIRFVGSKMTANGAFGHYTIEGNFGNHEFTIKKEGVEVAKIEKKSFHIHDTYGLTVYSAADRALMVLFTIIVDEIREH
Ga0210269_1023097813300030627SoilMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAPTHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0247629_1023433813300030628SoilFIIQRLSIMQSSMFALVALSMLLACVQCTDKKNVAEFEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNAGKKLILLEDGKEVYIVKHDILNVMSTWTIKEANTGKELGTIENKLKFVGSKMTANGAFGHYTIEGNFGNHEFTIKKEGEKVAKIEKKSFHLHDTYGLRVYGEENRALMVLFTVIVDEIREH
Ga0210268_101772323300030629SoilMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAPTHFSIKNELLSVGKKLILLEDSKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFNIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0210282_1024611513300030630SoilSSIIMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAATHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFNIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0210279_1025435213300030631SoilLQSSIIMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAATHFSIKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFSIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIREH
Ga0210279_1031560113300030631SoilHNILFIQQSSIMQSSMFALVALSMLLVAVQCTDRKSVTEYEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNVGKKLILLEDGRERFIVKHDILNLMSTWTIKEAGTDKELGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHAFTIKKEGGKVAKIEKKSFHLHDTYGLKVYGDADQALMVLFTVIVDEIREH
Ga0265462_1003105233300030738SoilMQSSIFALVAFGMLLAFVQCTDMKVTAEYEIKQGLLSGGRSYEIKSKTNAATHFSIKNELLSVGKKLILIEDGKERYIVKHDILNLMSTWTIKEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGNFGNHAFRIKKDGHKVAKIEKKSFHIHDTYGLTVFGDDTDRALMVLFTIIVDEIRKH
Ga0265462_1020513213300030738SoilMHHTHIILFIIQSSIMQSSIFALVAFGMLFAVVQCTNSTMNKTVTVAEYTIKEGHLSGGRSYEIKSKTNAPTKFSVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYDHTDPALMILFTIIVDEIRQH
Ga0265462_1258877113300030738SoilEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDNVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHSFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0265460_1046518423300030740SoilFNLSNFFTIFLNSECMVTKIAFDIILFTLQSSIMQSSIFTLVAFGMLLAIVQCIDKTTVTEYEIKQGLLSGGRSYEIKGKTNAAKRFSIRNELFTVGKKKLILLEDGKERYTVKHDILNLMSTWTIKDASTGKELGTIENKLRVVGSKMEAHGAFGNYNIEGNFGNHAFTIKKDGEKVAKIEKKSFHLHDTYGLIVYGDADQALMVLFSIIVDEIREH
Ga0265460_1219676913300030740SoilHIILFNLQSSIMQSSIFTLIAFGILLVYVQCAASTEVAEYEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNVGKKLILLEDGRERFIVKHDILNLMSTWTIKEAGTDKELGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHAFTIKKEGGKVAKIEKKSFHLHDTYGLKVYGDADQALMVLFTVIVDEIR
Ga0265459_1326734513300030741SoilLLSGGRSYEITSKMNAPTKFSIRNELLSVGKKLALLEDDKERYIVKHDILKLMSTWTITEANTDKVLGKIEHKLKFGGSKLVAEGTFGHYIINGNFRNREVTIKKDNHLVARITQKNRLLHDTCDLLVFGDTDRALMVLFTVIANEIRQH
Ga0265459_1370716413300030741SoilTHIILFIQQSPIMQSSIFALVAFGMLLAFVQCTDKTSVAEYEIKQGLLSGGRSYEIKGKSNAPSRFSVRNELFHVGKKLTVLEDGKERYIVKHELLNLMSTWEIKDATTGKEVGTIKNKVKVIGSKIDANGAFGHYKIEGDFGNHAFTISKDSHKVASIQKKTFHIHDTYGLTVYGNA
Ga0265461_1197360913300030743SoilSSIMQSSMFALVALSMLLVAVQCTDRKRVTEYEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNVGKKLILLEDGRERFIVKHDILNLMSTWTIKEAGTDKELGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHAFTIKKEGGKVAKIEKKSFHLHDTYGLKVYGDADQALMVLFTVIVDEIREH
Ga0265461_1197560813300030743SoilSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDADRALMVLFTIIVDEIREH
Ga0074043_1157071913300030748SoilVILFILHSSIMQSSMFALVALSMLLVVVQCADKKTVSEYEIKEGLLSGGRSYEIKSKINAPGKFTIRNELLNVGKKLILLEDGTERYIVKHDILNLMSTWIIKEADTDKEVGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHSFTIKKEGEKVAMIEKKSFHIHDTYGLTVYGDADRALMVLFTVIVDEIREH
Ga0102764_186737013300030751SoilLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0138305_158793813300030758SoilMQSSMFALVALSMLLACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEVSTGKELGTIENKLRFVGSKITANGAFGHYTIEGNFGNHEFTIKKEGKKVAKIEKKSFHVHDTYGLTVYGEENRALLVLFTVIVDEIREH
Ga0075396_196172713300030776SoilHIILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0075402_1217022413300030777SoilLQSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0075398_1011667313300030778SoilIILFTLRSFIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0075378_1109129713300030779SoilIILFIIQSSIMQSSVFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0102758_1004210813300030784SoilFALLAFGMLLAFVHCDKDTKVSEYVIKEGLLTGGRSYDIESKTNAPSKFIIQNELFRVGKKLTLLEDGKPRYIVTHELLNLMSTWTVKDANSDKELGTIQNQIKIIGSLIEAKGTFGYFKIEGNFGNHEFIITKDGQKLASIEKKRFHLHDTYGLSVYGDADRALMVLFTVIVDEIREH
Ga0102769_1097136713300030804SoilSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0073999_1007532413300030839SoilMQSSMFALVALSIILACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASTGKELGTIENKLRFVGSKMTANGAFGHYTIEGDFGNHSFTIKKEGKKVAKIEKKSFHIHDTYGLTVYGDDSRALMVLFTVIVDEIREH
Ga0075384_1002192513300030841SoilTHIILFTLRSFIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0075404_1003818513300030842SoilSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0075403_1003696013300030846SoilHIILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTI
Ga0075405_1176491013300030847SoilFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0075405_1189928613300030847SoilIILFTLQSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0075388_1005971213300030848SoilFVCEHYHTHIILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0075388_1166020113300030848SoilYEIKEGLLSGGRSYEIKSKTNAATKFSVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0075387_1006505713300030850SoilIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0075387_1144219413300030850SoilILFIIHSSIMQSSMFALVALSMLLAVVQCADKKTVSEYEIKEGHLSGGRSYEIKSKINAPGKFTIRNELLNVGKKLILLEDGTERYIVKHDILNLMSTWTIKEASSGKELGTLENKLRFVGSKMTANGAFGHYTIQGDFGNHKFSIKKEGHKVAKIEKKSFHVHDTYGLNVYGEADRALMVLFTIIVDEIREH
Ga0075372_1013080213300030853SoilHIILFTLRSFIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGD
Ga0075385_1006666923300030854SoilMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0102763_1093807413300030911SoilSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0138296_188443813300030923SoilHIILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMVEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0074006_1003915013300030931SoilMLLALVQCKHKHMGNVAEYEIKQGLLSGGRVYEVKSETNAPSHFSVRNELLSVGKKLLLLEDGKERYSVKHDILNLMSTWTIKESGTDKEVGTIENKLRLVGSKMSANGAFGHYTIEGDFGNHVFTIKKDGQEVAKIHKERLHIHDTYGLTVYGDADRALMVLFTIIVDEIREH
Ga0074006_1156847413300030931SoilMQSSMFALVALSILLACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASTGKELGTIENKLRFVGSKITANGAFGHYTIEGNFGNHAFTIKKEGHKVAKIEKKSFHVHDTYGLTVYGEENRALMILFTVIVDEIREH
Ga0074039_1000375513300030933SoilLSILLACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASTGKELGTIENKLRFVGSKMTANGAFGHYTIEGDFGNHSFTIKKEGKKVAKIEKKSFHIHDTYGLTVYGDDSRALMVLFTVIVDEIREH
Ga0074039_1004116513300030933SoilMQSSIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0074039_1152364013300030933SoilSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHVHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0138306_148996013300030936SoilMQSTMFALVALSMLLVCVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEVSTGKEVGTIENKLRFVGSKITANGVFGHFTIEGNFGNHEFTIKKEGQKVAKIEKKSFHVHDTYGLTVYGEENRALLVLFTVIVDEIREH
Ga0138302_110953713300030937SoilHIILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGRIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0138299_1042737813300030938SoilMQSSMFALVALSILLACVQCSDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKYDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASSGKELGTIENKLRFVGSKITANGSFGKYTIEGNFGNHEFTIKKEGKKVAKIEKKSFHVHDTYGL
Ga0138299_1065424913300030938SoilMQSSMFALVALSILLACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEVSTGKELGTIENKLRFVGSKITANGAFGHYTIDGDFGNHSFTIKKEGKKVAKIEKKSFHVHDTYGLTVYGEENRALLVLF
Ga0138303_150326313300030939SoilHHTHIILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0075373_1007531513300030945SoilFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0075373_1153093613300030945SoilFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0075390_1005363613300030947SoilLRSFIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0074031_194352613300030949SoilIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0138297_138644213300030962SoilHEFVCEHYHTHIILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMVEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGRIENKLRFVGSKIEANGVFGHYTIHGDFGNHSFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0075400_1180321013300030972SoilTYIILFIIQSSIMQSSVFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0075400_1194644013300030972SoilLFTLQSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFFLNVCVXICAKGPSIYLLNKIS
Ga0075395_1009498413300030973SoilMLLAFVQCIDKTTMAEYEIKEGLLSGGRSYEIKSKTNAPTKFTIRNELFRVGKKLILLEDGKERYIVKHDITKLMSTWTIKNPDTNQDLGTIENKLQFVGSKMDARGVFGHYTIEGNFGNHEFTIKKDGHQVAKIGKETFHIHDTYGLTVYGDTDRALMVLFTVIVDQIREH
Ga0075371_1010687513300030974SoilMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTY
Ga0068589_1198298213300030979SoilLVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0074027_1009937923300030980SoilMQSSIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDT
Ga0074027_1127889413300030980SoilIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0074027_1134543413300030980SoilLHSSIMQSSMFALVALSMLLVVVQCADKKTVSEYEIKEGLLSGGRSYEIKSKINASGKFTIRNELLNVGKKLILLEDGTERYIVKHDILNLMSTWIIKEADTDKEVGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHSFTIKKEGEKVAMIEKKSFHIHDTYGLTVYGDADRALMVLFTVIVDEIREH
Ga0074040_1003859913300030992SoilMQSSMFALVALSILLACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASTGKELGTIENKLRFVGSKMTANGAFGHYTIEGDFGNHSFTIKKEGKKVAKIEKKSFHIHDTYGLTVYGDDSRALMVLFTVIVDEIREH
Ga0073997_1220653313300030997SoilLQSSIMQSSIFALVAFGMLLAFVQCTDMTATAEFEIKQGLLSGGRSYEIKSKINSPAHFSIKNELFSVGKKLILLEDGKERYIVQHDILNLMSTWTIKEVGTDHVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKNFHIHDTYGLTVYGDTDRALMVLFTIIVDEIREH
Ga0074038_1181438713300031008SoilIFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYTIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0074038_1188655413300031008SoilLPIMQSTMFALVALSILLACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTRFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASTGKELGTIENKLRFVGSKITANGAFGHFTIEGNFGNHEFTIKKEGRKVAKIEKKSFHIHDTYGLTVYGEDNRALMVLFTVIVDEIREH
Ga0138301_182831413300031022SoilHIILFIQQSPIMQSSIFALVAFGMLLAFVQCTDKTSVAEYEIKQGLLSGGRSYEIKGKSNAPSRFSVRNELFHVGKKLTLLEDGKERYIVKHELLNLMSTWEIKDATTGKEVGTIKNKVKVIGSKIDANGAFGHYKIEGDFGNHAFTISKDSHKVASIQKKTFHIHDTYGLTVYGNDD
Ga0074012_1169878413300031029SoilMQSSMFALVALSIILACVQCTDKKNVAEYEIKEGLLSGGRSYEIKSKTNAPTKFDIRNELFNAGKKLILLEDGKEVYIVKHDILNIMSTWTIKEASTGKEVGTIENKLRFVGSKITANGAFGRYTIEGNFGNHEFTIKKEGQKVAKIEKKSFHIHDTYGLNVYGNENPALMVLFTVIVDEIREH
Ga0074030_1104709813300031030SoilALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0074042_1125708713300031031SoilVNFSGALAMLLAVAQSKMHSKKVAEYVIKQGLLSGGRSYEIKSKTNAPEKFTIRNELFHVGKKLFLLEDGKERYSVKHDILNLMSTWTIKETGTDREVGTIENKLRFVGSKMTANGAFGHFTINGDFGTHEYTIKKDGVKVARIHKAPLHIHDTYDLSVYGEADQALMVLFTIIVDEIRQ
Ga0074042_1139833113300031031SoilMFALVALSMLLVVVQCADKKTVSEYEIKEGLLSGGRSYEIKSKINASGKFTIRNELLNVGKKLILLEDGTERYIVKHDILNLMSTWIIKEADTDKEVGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHSFTIKKEGEKVAMIEKKSFHIHDTYGLTVYGDADRALMVLFTVIVDEIREH
Ga0074028_1000191013300031050SoilTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0170834_10656253113300031057Forest SoilALFYYPSIHPVSSIMQSSIFALVAFGMLLALVQCVDKTHVTEYEIQQGLLSGGRSYDIKSKVNAPTHFTIRNELLSVGKKLLLLEDGKERYIVKHDILNLMSTWTIKEVGTNKDLGTIENKLKFVGSKISANGVFGHYIIHGKFGNRSYTIKKDGKKVAKVEKKGAHLHDTYGLTVYGDTDRALMVLFTVIVDEIREH
Ga0170834_11093876913300031057Forest SoilFIILFTLQSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHVHETYGLTVYGDIDQGLMVLFTVLVDEIRR
Ga0170823_1129809013300031128Forest SoilILFTLQSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHVHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0170824_11757984913300031231Forest SoilPSIILFTLQSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLM
Ga0102761_1008285113300031411SoilGIILFTVQSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0170820_1322001213300031446Forest SoilFDFKFTIILFTLQSSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0170820_1612912713300031446Forest SoilYIILFIIQSSIMQSSVFALVAFGMLFAVVQCTNTTTVTKYEIKEGLFSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0170819_1215230113300031469Forest SoilKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHLHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFFLNVCVXICAKGPSIYLLNKIS
Ga0170819_1243431423300031469Forest SoilISIIILFIIQSSIMQSSVFALVAFGMLFAVVQCTNTTTVTKYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLVDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0170818_10084247513300031474Forest SoilLSNHHTYIILFIIQSSIMQSSVFALVAFGMLFAVVQCTNTTTVTKYEIKEGLFSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDNKERYIVKHDVLKLLSTWTIKEANDDKVLGKIEHKLKFIGSKMVAKGTFGHYTIHGNLGNHEYSIKKDDHKVAKVTKKELHVHDTYDLSVYGDTDPALMVLFTIIVDEIRQH
Ga0170818_10340447813300031474Forest SoilKTAMAEYEIKQGLLSGGRSYEIKSKINTPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIIEPGTDKVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHSFNIKKDGHKVAKIEKKSFHIHDTYGLTVYGDTDRALMVLFTIIVDEIREH
Ga0348332_1040176113300032515Plant LitterILFTLQSSIMQSSIFALVAFGMLLAFVQCTDMTATAEFEIKQGLLSGGRSYEIKSKINTPAHFSIKNELFSVGKKLILLEDGKERYIVQHDILNLMSTWTIKEVGTDHVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKSFHIHDTYGLTVFGDTDRALMVLFTIIVDEIREH
Ga0348332_1155537313300032515Plant LitterIQQSSIMQSSMFALVALSMLLVAVQCTDRKNVAEYEIKEGLLSGGRSYEIKSKTNAATKFTVKNELLSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEAGTDKELGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHAFTIKKEGGKVAKIEKKSFHLHDTYGLKVYGDADQALMVLFTVIVDEI
Ga0348332_1324381513300032515Plant LitterSIQFILQYQIMQSSIVALVAFSMLLALVQCDHEKETSVYEIKQGFLSGGRTYDITGKTNAPLKFSTRNELLSVGKKLTLLENGKERYTVKHAITNVMSTWTITESVGGKQLGTIQNKLKLVGSKIDANGEFGHYKIEGDFGNHSFNIMKDSHKVAMIAKKSLHIRDTYDLTVFGEADPALMVLFTIIVDEIREH
Ga0214501_122558513300032625Switchgrass PhyllosphereFNSFSIMQSSIFALVAFAMVLATVHCAKDTKNVAEYEIKQGLLSGGRVYTVESKTNAPKNFTVRNELLSVGKKLYLLEDGEERYSVKHDILNLMSTWIITDSLAHKEVGTIENKLRFTGSKMTANGEFGHYTIHGKFGNHEYTIEKAGHKVAKIDKKRLHLHDTYGLTVYGDADRALMVLFTVIVDEIRQH
Ga0315742_1126528013300032756Forest SoilMQSSMFALVALSMLLVAVQCTDRKSVTEYEIKEGLLSGGRSYEIKSKTNAPTKFSIRNELFNVGKKLILLEDGRERFIVKHDILNLMSTWTIKEAGTDKELGTIENKLRLVGSKMTANGAFGHYTIEGDFGNHAFTIKKEGGKVAKIEKKSFHLHDTYGLKVYGDADQALMVLFTVIVDEIREH
Ga0315742_1165239413300032756Forest SoilMVILHIILFTLRSSIMQSSIFALVAFGMLLAFVQCTDKTAMAEYEIKQGLLSGGRSYEIKSKINAPTHFSIKNELFSVGKKLILLEDGKERYIVKHDILNLMSTWTIKEVGTDSVLGKIENKLRFVGSKIEANGVFGHYTIHGDFGNHAFTIKKDGHKVAKIEKKNFHIHDTYGLTVYGDTDRALMVLFSIIVDEIREH
Ga0315742_1174930413300032756Forest SoilFSIMKASIFALVALAMLLAVAQSKMHSKKVAEYVIKQGLLSGGRSYEIKSKTNAPEKFTIRNELFHVGKKLFLLEDGKERYSVKHDILNLMSTWTIKETGTDREVGTIENKLRFVGSKMTANGAFGHFTINGDFGTHEYTIKKDGVKVARIHKAPLHIHDTYDLSVYGEADRALMVLFTIIVDEIRQH
Ga0315742_1193991813300032756Forest SoilSSIMQSTIFALVAFGMLLAIVQCADPTKVTEYVIKEGLLGGGRSYEIKSKTNAPSKFTIRNEFFHVGKKLFLLEDGKERYTVKHDLLNVMSTWTITDSKSGKELGTIKNKVHVIGSKIEADGSFGKFKIEGKFGSHEFMIFKDGTKVAMVEKKSFHVHETYGLTVYGDIDQGLMVLFTVLVDEIRRHXAEYQHKFFF
Ga0314768_120598113300033523Switchgrass PhyllosphereISIMQTSIFALVAFAMLLAMVQSKKPTEKVAEFIIKQGLLSGGRSYEIKGETNAPEKFTIRNELFHVGKKLFLSEDGKERYVVKHDILNLMSTWVIKESGTEKEIGTIENKVKFVGSKITANGVFGHYTIQGKFGNHEFTIKKDGVKVARIQKKRLHLHDTYGLSVYGNADRALMVLFTIIVDEIRQH
Ga0314770_120888213300033533Switchgrass PhyllosphereHSSNSISIMQTSIFALVAFAMLLAMVQSKKPTEKVAEFIIKQGLLSGGRSYEIKGETNAPEKFTIRNELFHVGKKLFLSEDGKERYVVKHDILNLMSTWVIKESGTEKEIGTIENKVKFVGSKITANGVFGHYTIQGKFGNHEFTIKKDGVKVARIQKKRLHLHDTYGLSVYGNADRALMVLFTIIVDEIRQH
Ga0314769_129420513300033542Switchgrass PhyllosphereHSSNSISIMQTSIFALVAFAMLLAMVQSKKPTEKVAEFIIKQGLLSGGRSYEIKGETNAPEKFTIRNELFHVGKKLFLSEDGKERYVVKHDILNLMSTWVIKESGTEKEIGTIENKVKFVGSKITANGVFGHYTIQGKFGNHEFTIKKDGVKVARIQKKRLHLHDTYGLSVYGNADRALM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.