Metagenome / Metatranscriptome Family F033069

Basic Information
Family ID	F033069
Family Type	Metagenome / Metatranscriptome
Number of Sequences	178
Average Sequence Length	37 residues
Representative Sequence	LSHEPVDEPLQLLEEEARAAGTKDRVVVLEEGVTRFF
Number of Associated Samples	150
Number of Associated Scaffolds	178

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	98.88 %
% of genes from short scaffolds (< 2000 bps)	87.64 %
Associated GOLD sequencing projects	147
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Most Common Taxonomy
Group	Bacteria (75.843 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.551 % of family members)
Environment Ontology (ENVO)	Unclassified (19.663 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (44.944 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 26.15% β-sheet: 0.00% Coil/Unstructured: 73.85%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 178 Family Scaffolds
PF00903	Glyoxalase	28.65
PF05161	MOFRL	10.67
PF13660	DUF4147	7.30
PF12681	Glyoxalase_2	5.62
PF11954	DUF3471	3.93
PF13180	PDZ_2	2.25
PF13185	GAF_2	2.25
PF00487	FA_desaturase	1.69
PF05016	ParE_toxin	1.12
PF03720	UDPG_MGDP_dh_C	1.12
PF00120	Gln-synt_C	0.56
PF01804	Penicil_amidase	0.56
PF17209	Hfq	0.56
PF12695	Abhydrolase_5	0.56
PF11937	DUF3455	0.56
PF07704	PSK_trans_fac	0.56
PF09844	DUF2071	0.56
PF00595	PDZ	0.56
PF01026	TatD_DNase	0.56
PF12706	Lactamase_B_2	0.56
PF02743	dCache_1	0.56
PF00248	Aldo_ket_red	0.56
PF07731	Cu-oxidase_2	0.56
PF03190	Thioredox_DsbH	0.56
PF03721	UDPG_MGDP_dh_N	0.56
PF13181	TPR_8	0.56
PF07676	PD40	0.56
PF12762	DDE_Tnp_IS1595	0.56
PF06172	Cupin_5	0.56
PF01016	Ribosomal_L27	0.56
PF12838	Fer4_7	0.56
PF02823	ATP-synt_DE_N	0.56
PF00326	Peptidase_S9	0.56
PF07885	Ion_trans_2	0.56

COG ID	Name	Functional Category	% Frequency in 178 Family Scaffolds
COG2379	Glycerate-2-kinase	Carbohydrate transport and metabolism [G]	10.67
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	1.69
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	1.69
COG0211	Ribosomal protein L27	Translation, ribosomal structure and biogenesis [J]	0.56
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.56
COG0355	FoF1-type ATP synthase, epsilon subunit	Energy production and conversion [C]	0.56
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.56
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.56
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	0.56
COG1331	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains	General function prediction only [R]	0.56
COG1893	Ketopantoate reductase	Coenzyme transport and metabolism [H]	0.56
COG2132	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)	Cell cycle control, cell division, chromosome partitioning [D]	0.56
COG2366	Acyl-homoserine lactone (AHL) acylase PvdQ	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.56
COG2972	Sensor histidine kinase YesM	Signal transduction mechanisms [T]	0.56
COG3542	Predicted sugar epimerase, cupin superfamily	General function prediction only [R]	0.56
COG4423	Uncharacterized conserved protein	Function unknown [S]	0.56

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	75.84 %
Unclassified	root	N/A	24.16 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	75.84 %
Unclassified	root	N/A	24.16 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	75.84 %
Unclassified	root	N/A	24.16 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	43.26 %
Unclassified	root	N/A	24.16 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.69 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.12 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.56 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.16 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	12.36 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	10.11 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.69 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.12 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.56 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.16 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	11.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.30 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	2.81 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1.69 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1.12 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.56 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.56 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.16 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	9.55 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.30 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	2.81 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	1.69 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	1.69 %
Thermoleophilales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales	1.12 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.56 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.56 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.16 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.30 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	5.06 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	2.81 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.69 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	1.69 %
Thermoleophilaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae	1.12 %
Candidatus Sulfotelmatobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter	0.56 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.56 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.56 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.16 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.30 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	2.81 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2.25 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.69 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	1.69 %
unclassified Thermoleophilaceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae	1.12 %
Candidatus Sulfotelmatobacter kueseliae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	0.56 %
Dyella choica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella choica	0.56 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.56 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.16 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	7.30 %
Acidobacteria bacterium 13_1_40CM_4_58_4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	2.81 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2.25 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.69 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	1.69 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.12 %
Candidatus Sulfotelmatobacter kueseliae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	0.56 %
Dyella choica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella choica	0.56 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.56 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.56 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_103583693	Not Available	538	Open in IMG/M
3300001166\|JGI12694J13545_1000178	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	5649	Open in IMG/M
3300002245\|JGIcombinedJ26739_100292856	All Organisms → cellular organisms → Bacteria	1512	Open in IMG/M
3300002245\|JGIcombinedJ26739_101760786	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	520	Open in IMG/M
3300002245\|JGIcombinedJ26739_101834834	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300003505\|JGIcombinedJ51221_10088949	All Organisms → cellular organisms → Bacteria	1220	Open in IMG/M
3300005167\|Ga0066672_10725720	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M
3300005336\|Ga0070680_101166064	All Organisms → cellular organisms → Bacteria	666	Open in IMG/M
3300005435\|Ga0070714_101087534	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	779	Open in IMG/M
3300005542\|Ga0070732_10308730	All Organisms → cellular organisms → Bacteria	950	Open in IMG/M
3300005575\|Ga0066702_10157484	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1349	Open in IMG/M
3300005607\|Ga0070740_10222584	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	781	Open in IMG/M
3300005610\|Ga0070763_10818603	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300005616\|Ga0068852_100668453	All Organisms → cellular organisms → Bacteria → Acidobacteria	1047	Open in IMG/M
3300005900\|Ga0075272_1003336	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	3384	Open in IMG/M
3300005995\|Ga0066790_10167809	All Organisms → cellular organisms → Bacteria	939	Open in IMG/M
3300006034\|Ga0066656_10709430	All Organisms → cellular organisms → Bacteria	646	Open in IMG/M
3300006052\|Ga0075029_100210188	All Organisms → cellular organisms → Bacteria	1218	Open in IMG/M
3300006052\|Ga0075029_100349739	All Organisms → cellular organisms → Bacteria	952	Open in IMG/M
3300006059\|Ga0075017_101088110	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300006059\|Ga0075017_101422235	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	546	Open in IMG/M
3300006102\|Ga0075015_100602757	Not Available	643	Open in IMG/M
3300006102\|Ga0075015_100850735	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300006162\|Ga0075030_100639953	All Organisms → cellular organisms → Bacteria → Acidobacteria	843	Open in IMG/M
3300006354\|Ga0075021_10054129	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2323	Open in IMG/M
3300006797\|Ga0066659_10483222	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	990	Open in IMG/M
3300006806\|Ga0079220_10391634	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300006871\|Ga0075434_100925689	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	886	Open in IMG/M
3300006881\|Ga0068865_100079861	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2344	Open in IMG/M
3300006893\|Ga0073928_10082061	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2759	Open in IMG/M
3300006903\|Ga0075426_11446352	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	522	Open in IMG/M
3300007258\|Ga0099793_10049467	All Organisms → cellular organisms → Bacteria	1849	Open in IMG/M
3300009012\|Ga0066710_100272113	All Organisms → cellular organisms → Bacteria	2464	Open in IMG/M
3300009088\|Ga0099830_11128089	Not Available	650	Open in IMG/M
3300009093\|Ga0105240_12222378	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300009093\|Ga0105240_12471492	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	537	Open in IMG/M
3300009148\|Ga0105243_11668867	All Organisms → cellular organisms → Bacteria	665	Open in IMG/M
3300009523\|Ga0116221_1276335	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	726	Open in IMG/M
3300009525\|Ga0116220_10605522	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300009632\|Ga0116102_1020176	Not Available	2315	Open in IMG/M
3300009665\|Ga0116135_1024672	All Organisms → cellular organisms → Bacteria	2057	Open in IMG/M
3300009665\|Ga0116135_1090586	All Organisms → cellular organisms → Bacteria	1098	Open in IMG/M
3300009762\|Ga0116130_1145588	Not Available	746	Open in IMG/M
3300009792\|Ga0126374_10428041	Not Available	933	Open in IMG/M
3300009824\|Ga0116219_10709025	Not Available	550	Open in IMG/M
3300010048\|Ga0126373_11444806	All Organisms → cellular organisms → Bacteria	753	Open in IMG/M
3300010359\|Ga0126376_11091652	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	805	Open in IMG/M
3300010359\|Ga0126376_13174368	All Organisms → cellular organisms → Bacteria → Acidobacteria	508	Open in IMG/M
3300010361\|Ga0126378_13219750	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	519	Open in IMG/M
3300010366\|Ga0126379_11139121	All Organisms → cellular organisms → Bacteria → Acidobacteria	886	Open in IMG/M
3300010371\|Ga0134125_11689817	Not Available	689	Open in IMG/M
3300010376\|Ga0126381_103277102	Not Available	639	Open in IMG/M
3300010379\|Ga0136449_100507007	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2093	Open in IMG/M
3300010398\|Ga0126383_12211432	Not Available	636	Open in IMG/M
3300011269\|Ga0137392_10109728	All Organisms → cellular organisms → Bacteria	2187	Open in IMG/M
3300011411\|Ga0153933_1074093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella choica	725	Open in IMG/M
3300012205\|Ga0137362_11482014	Not Available	565	Open in IMG/M
3300012206\|Ga0137380_10835243	Not Available	794	Open in IMG/M
3300012209\|Ga0137379_11688921	Not Available	530	Open in IMG/M
3300012357\|Ga0137384_11112708	Not Available	632	Open in IMG/M
3300012359\|Ga0137385_10964191	Not Available	704	Open in IMG/M
3300012359\|Ga0137385_11014132	All Organisms → cellular organisms → Bacteria	684	Open in IMG/M
3300012582\|Ga0137358_10290386	Not Available	1111	Open in IMG/M
3300012582\|Ga0137358_11089143	All Organisms → cellular organisms → Bacteria → Acidobacteria	510	Open in IMG/M
3300012683\|Ga0137398_11101688	All Organisms → cellular organisms → Bacteria → Acidobacteria	547	Open in IMG/M
3300012917\|Ga0137395_10358617	All Organisms → cellular organisms → Bacteria → Acidobacteria	1039	Open in IMG/M
3300012917\|Ga0137395_10441608	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	934	Open in IMG/M
3300012960\|Ga0164301_11543718	All Organisms → cellular organisms → Bacteria → Acidobacteria	549	Open in IMG/M
3300012984\|Ga0164309_11877745	All Organisms → cellular organisms → Bacteria → Acidobacteria	514	Open in IMG/M
3300014200\|Ga0181526_10414640	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	854	Open in IMG/M
3300014200\|Ga0181526_10697529	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	640	Open in IMG/M
3300014201\|Ga0181537_10222434	All Organisms → cellular organisms → Bacteria	1298	Open in IMG/M
3300015356\|Ga0134073_10284116	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	584	Open in IMG/M
3300016294\|Ga0182041_11326497	All Organisms → cellular organisms → Bacteria → Acidobacteria	659	Open in IMG/M
3300017927\|Ga0187824_10285170	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300017929\|Ga0187849_1088830	All Organisms → cellular organisms → Bacteria	1333	Open in IMG/M
3300017930\|Ga0187825_10147559	All Organisms → cellular organisms → Bacteria → Acidobacteria	830	Open in IMG/M
3300017943\|Ga0187819_10706456	Not Available	568	Open in IMG/M
3300017946\|Ga0187879_10880578	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	501	Open in IMG/M
3300017955\|Ga0187817_10093294	All Organisms → cellular organisms → Bacteria	1889	Open in IMG/M
3300017955\|Ga0187817_10651982	Not Available	672	Open in IMG/M
3300017966\|Ga0187776_11374717	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	537	Open in IMG/M
3300017973\|Ga0187780_11232426	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	549	Open in IMG/M
3300017975\|Ga0187782_10678685	All Organisms → cellular organisms → Bacteria → Acidobacteria	794	Open in IMG/M
3300017995\|Ga0187816_10486316	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300018006\|Ga0187804_10040560	All Organisms → cellular organisms → Bacteria	1792	Open in IMG/M
3300018006\|Ga0187804_10093435	All Organisms → cellular organisms → Bacteria → Acidobacteria	1228	Open in IMG/M
3300018007\|Ga0187805_10107170	All Organisms → cellular organisms → Bacteria	1265	Open in IMG/M
3300018007\|Ga0187805_10449830	All Organisms → cellular organisms → Bacteria → Acidobacteria	601	Open in IMG/M
3300018012\|Ga0187810_10404033	All Organisms → cellular organisms → Bacteria → Acidobacteria	574	Open in IMG/M
3300018020\|Ga0187861_10178493	All Organisms → cellular organisms → Bacteria → Acidobacteria	962	Open in IMG/M
3300018022\|Ga0187864_10102153	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1489	Open in IMG/M
3300018035\|Ga0187875_10609837	Not Available	575	Open in IMG/M
3300018042\|Ga0187871_10116589	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1528	Open in IMG/M
3300018043\|Ga0187887_10749320	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	577	Open in IMG/M
3300018044\|Ga0187890_10574492	Not Available	635	Open in IMG/M
3300018058\|Ga0187766_10011483	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	5079	Open in IMG/M
3300018058\|Ga0187766_10723399	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	689	Open in IMG/M
3300018058\|Ga0187766_10891297	All Organisms → cellular organisms → Bacteria → Acidobacteria	627	Open in IMG/M
3300018062\|Ga0187784_10288473	All Organisms → cellular organisms → Bacteria → Acidobacteria	1333	Open in IMG/M
3300018062\|Ga0187784_10844203	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	730	Open in IMG/M
3300018062\|Ga0187784_11296532	All Organisms → cellular organisms → Bacteria → Acidobacteria	577	Open in IMG/M
3300018086\|Ga0187769_10048971	All Organisms → cellular organisms → Bacteria	2930	Open in IMG/M
3300018089\|Ga0187774_10172022	All Organisms → cellular organisms → Bacteria → Acidobacteria	1158	Open in IMG/M
3300018090\|Ga0187770_10334510	All Organisms → cellular organisms → Bacteria	1182	Open in IMG/M
3300018468\|Ga0066662_10374320	All Organisms → cellular organisms → Bacteria → Acidobacteria	1238	Open in IMG/M
3300019785\|Ga0182022_1099436	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	1740	Open in IMG/M
3300019786\|Ga0182025_1256200	All Organisms → cellular organisms → Bacteria	1787	Open in IMG/M
3300020579\|Ga0210407_10768001	Not Available	745	Open in IMG/M
3300020580\|Ga0210403_10400167	All Organisms → cellular organisms → Bacteria → Acidobacteria	1121	Open in IMG/M
3300020580\|Ga0210403_10796256	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	752	Open in IMG/M
3300020581\|Ga0210399_11586709	All Organisms → cellular organisms → Bacteria → Acidobacteria	505	Open in IMG/M
3300020583\|Ga0210401_11040894	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	677	Open in IMG/M
3300020583\|Ga0210401_11212733	Not Available	613	Open in IMG/M
3300021178\|Ga0210408_10886409	Not Available	695	Open in IMG/M
3300021407\|Ga0210383_11280899	Not Available	613	Open in IMG/M
3300021420\|Ga0210394_10955096	Not Available	744	Open in IMG/M
3300021432\|Ga0210384_10040225	All Organisms → cellular organisms → Bacteria	4301	Open in IMG/M
3300021433\|Ga0210391_10323563	All Organisms → cellular organisms → Bacteria	1210	Open in IMG/M
3300021478\|Ga0210402_11223360	Not Available	678	Open in IMG/M
3300021560\|Ga0126371_10174222	All Organisms → cellular organisms → Bacteria	2230	Open in IMG/M
3300022467\|Ga0224712_10183968	Not Available	943	Open in IMG/M
3300024271\|Ga0224564_1111889	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	557	Open in IMG/M
3300025414\|Ga0208935_1015864	Not Available	1009	Open in IMG/M
3300025507\|Ga0208188_1085072	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	731	Open in IMG/M
3300025911\|Ga0207654_10855508	Not Available	658	Open in IMG/M
3300025922\|Ga0207646_11025354	Not Available	728	Open in IMG/M
3300025924\|Ga0207694_11032034	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300025928\|Ga0207700_10664963	All Organisms → cellular organisms → Bacteria	929	Open in IMG/M
3300025932\|Ga0207690_11422844	All Organisms → cellular organisms → Bacteria → Acidobacteria	580	Open in IMG/M
3300025939\|Ga0207665_10793014	All Organisms → cellular organisms → Bacteria	748	Open in IMG/M
3300025941\|Ga0207711_11920830	Not Available	535	Open in IMG/M
3300025944\|Ga0207661_11621542	Not Available	592	Open in IMG/M
3300025972\|Ga0207668_11298115	All Organisms → cellular organisms → Bacteria → Acidobacteria	655	Open in IMG/M
3300025998\|Ga0208651_1022552	All Organisms → cellular organisms → Bacteria → Acidobacteria	550	Open in IMG/M
3300026078\|Ga0207702_10026982	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	4769	Open in IMG/M
3300026334\|Ga0209377_1147397	All Organisms → cellular organisms → Bacteria	896	Open in IMG/M
3300026480\|Ga0257177_1048995	Not Available	652	Open in IMG/M
3300026490\|Ga0257153_1041352	All Organisms → cellular organisms → Bacteria → Acidobacteria	950	Open in IMG/M
3300026538\|Ga0209056_10032253	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4925	Open in IMG/M
3300027629\|Ga0209422_1018296	All Organisms → cellular organisms → Bacteria → Acidobacteria	1737	Open in IMG/M
3300027696\|Ga0208696_1015730	All Organisms → cellular organisms → Bacteria → Acidobacteria	2937	Open in IMG/M
3300027698\|Ga0209446_1166174	All Organisms → cellular organisms → Bacteria → Acidobacteria	569	Open in IMG/M
3300027825\|Ga0209039_10031490	All Organisms → cellular organisms → Bacteria	2554	Open in IMG/M
3300027842\|Ga0209580_10011456	All Organisms → cellular organisms → Bacteria	3822	Open in IMG/M
3300027842\|Ga0209580_10551153	Not Available	573	Open in IMG/M
3300027889\|Ga0209380_10145830	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	1382	Open in IMG/M
3300027889\|Ga0209380_10535431	All Organisms → cellular organisms → Bacteria	681	Open in IMG/M
3300028673\|Ga0257175_1004837	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1798	Open in IMG/M
3300028860\|Ga0302199_1165812	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	684	Open in IMG/M
3300029908\|Ga0311341_10761730	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	537	Open in IMG/M
3300029914\|Ga0311359_10247703	All Organisms → cellular organisms → Bacteria	1517	Open in IMG/M
3300030053\|Ga0302177_10389101	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	731	Open in IMG/M
3300030058\|Ga0302179_10081325	All Organisms → cellular organisms → Bacteria	1434	Open in IMG/M
3300030506\|Ga0302194_10025161	All Organisms → cellular organisms → Bacteria	3193	Open in IMG/M
3300031122\|Ga0170822_11991227	Not Available	533	Open in IMG/M
3300031231\|Ga0170824_109656534	Not Available	525	Open in IMG/M
3300031231\|Ga0170824_114931749	Not Available	743	Open in IMG/M
3300031233\|Ga0302307_10057231	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4	2072	Open in IMG/M
3300031344\|Ga0265316_10813844	Not Available	655	Open in IMG/M
3300031711\|Ga0265314_10647230	Not Available	539	Open in IMG/M
3300031720\|Ga0307469_10831688	All Organisms → cellular organisms → Bacteria	850	Open in IMG/M
3300031753\|Ga0307477_10589459	All Organisms → cellular organisms → Bacteria → Acidobacteria	750	Open in IMG/M
3300031754\|Ga0307475_10929227	Not Available	686	Open in IMG/M
3300031941\|Ga0310912_10359587	All Organisms → cellular organisms → Bacteria → Acidobacteria	1131	Open in IMG/M
3300031962\|Ga0307479_10487829	All Organisms → cellular organisms → Bacteria → Acidobacteria	1216	Open in IMG/M
3300031962\|Ga0307479_10838970	All Organisms → cellular organisms → Bacteria → Acidobacteria	893	Open in IMG/M
3300031962\|Ga0307479_11386009	Not Available	662	Open in IMG/M
3300032001\|Ga0306922_11196070	Not Available	774	Open in IMG/M
3300032160\|Ga0311301_11535056	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	817	Open in IMG/M
3300032160\|Ga0311301_12507476	Not Available	576	Open in IMG/M
3300032180\|Ga0307471_100385990	All Organisms → cellular organisms → Bacteria	1523	Open in IMG/M
3300032805\|Ga0335078_10131516	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	3566	Open in IMG/M
3300032805\|Ga0335078_12035811	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300032828\|Ga0335080_11036891	All Organisms → cellular organisms → Bacteria → Acidobacteria	833	Open in IMG/M
3300032896\|Ga0335075_10652669	All Organisms → cellular organisms → Bacteria → Acidobacteria	1025	Open in IMG/M
3300032898\|Ga0335072_10485148	All Organisms → cellular organisms → Bacteria → Acidobacteria	1287	Open in IMG/M
3300033289\|Ga0310914_10506335	All Organisms → cellular organisms → Bacteria	1092	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.01%
Host-Associated	Host-Associated	8.99%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	69.10%
Aquatic	Environmental → Aquatic	21.91%
Plants	Host-Associated → Plants	8.43%
Fungi	Host-Associated → Fungi	0.56%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	65.17%
Freshwater	Environmental → Aquatic → Freshwater	16.85%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.74%
Sediment	Environmental → Aquatic → Sediment	4.49%
Peat	Environmental → Terrestrial → Peat	3.93%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.69%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.56%
Mycelium	Host-Associated → Fungi → Mycelium	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	44.38%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	16.85%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	12.36%
Loam	Environmental → Terrestrial → Soil → Loam	8.43%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.49%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.93%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.25%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.69%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.56%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.47%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	16.29%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	10.67%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	7.30%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	6.18%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.06%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.06%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.49%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.93%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	3.37%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.37%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.25%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.69%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.56%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.56%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.56%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	9.55%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.87%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	6.74%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	6.18%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	5.06%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	4.49%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	4.49%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	3.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.93%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.93%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	3.37%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	3.37%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.25%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	2.25%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.25%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.81%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.69%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.69%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.69%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.69%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	1.12%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.12%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.12%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.12%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.12%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.12%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.12%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.12%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.56%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.56%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.56%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.56%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.56%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.56%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.56%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001166	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300003505	Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005607	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005900	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404	Environmental	Open in IMG/M
3300005995	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006102	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013	Environmental	Open in IMG/M
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009523	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG	Environmental	Open in IMG/M
3300009525	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG	Environmental	Open in IMG/M
3300009632	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40	Environmental	Open in IMG/M
3300009665	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10	Environmental	Open in IMG/M
3300009762	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009824	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011411	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG	Host-Associated	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300014200	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG	Environmental	Open in IMG/M
3300014201	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG	Environmental	Open in IMG/M
3300015356	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300017927	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4	Environmental	Open in IMG/M
3300017929	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100	Environmental	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental	Open in IMG/M
3300017946	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10	Environmental	Open in IMG/M
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300017995	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1	Environmental	Open in IMG/M
3300018006	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4	Environmental	Open in IMG/M
3300018007	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5	Environmental	Open in IMG/M
3300018012	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5	Environmental	Open in IMG/M
3300018020	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100	Environmental	Open in IMG/M
3300018022	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40	Environmental	Open in IMG/M
3300018035	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10	Environmental	Open in IMG/M
3300018042	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10	Environmental	Open in IMG/M
3300018043	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10	Environmental	Open in IMG/M
3300018044	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental	Open in IMG/M
3300018090	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019785	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)	Environmental	Open in IMG/M
3300019786	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300024271	Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5	Environmental	Open in IMG/M
3300025414	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)	Environmental	Open in IMG/M
3300025507	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025998	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes)	Environmental	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026334	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)	Environmental	Open in IMG/M
3300026480	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B	Environmental	Open in IMG/M
3300026490	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027629	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)	Environmental	Open in IMG/M
3300027696	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)	Environmental	Open in IMG/M
3300027698	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027825	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027889	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)	Environmental	Open in IMG/M
3300028673	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B	Environmental	Open in IMG/M
3300028860	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3	Environmental	Open in IMG/M
3300029908	II_Bog_E1 coassembly	Environmental	Open in IMG/M
3300029914	III_Bog_E2 coassembly	Environmental	Open in IMG/M
3300030053	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2	Environmental	Open in IMG/M
3300030058	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1	Environmental	Open in IMG/M
3300030506	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1	Environmental	Open in IMG/M
3300031122	Oak Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031233	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2	Environmental	Open in IMG/M
3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Host-Associated	Open in IMG/M
3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Host-Associated	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300032896	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4	Environmental	Open in IMG/M
3300032898	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F033069

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1035836932	3300000364	Soil	PMDEPLKFLEEVAKKSGIGDRVLVLNEGVTRIFG*
JGI12694J13545_10001781	3300001166	Forest Soil	EPVEEPLQLLEQEVRAAGIEDRVVVLEEGVTRFF*
JGIcombinedJ26739_1002928561	3300002245	Forest Soil	XPVEEPLQLLEKEARAAGIEDRVVVLEEGVTRFF*
JGIcombinedJ26739_1017607862	3300002245	Forest Soil	FRLSHEPVDEPLQLLDQEARSAGMKDKVLVMEEGVTRFF*
JGIcombinedJ26739_1018348342	3300002245	Forest Soil	RLSHEPIDEPLQLLDEEARSAGIEDRVFVLEEGITRFF*
JGIcombinedJ51221_100889491	3300003505	Forest Soil	SFRLSHEPVDEPLQLLEQEAKHAGIQDRVVVLEEGVTKFF*
Ga0066672_107257201	3300005167	Soil	TFRLSHEPVDEPLQLLDQEARAAGVQDKVVVLEEGVTRFF*
Ga0070680_1011660641	3300005336	Corn Rhizosphere	FRLSHEPVDEPLQLLDQEARAAGVQDKVVVLEEGVTRFF*
Ga0070714_1010875342	3300005435	Agricultural Soil	GTFRLSHEPVDEPLQLLDQAADEAGVQDRVVVMQEGVTKFF*
Ga0070732_103087303	3300005542	Surface Soil	LSHEPIDEPLQLLDQEARLAGVRDRVFVLEEGVTKFF*
Ga0066702_101574841	3300005575	Soil	HEPMDEPTERLGEAAKLAGVSERVIVMEEGVTRFFSS*
Ga0070740_102225843	3300005607	Surface Soil	LSYEPMEEPLQRLRIAAAAAGVSDRVMVLEEGKTKIFR*
Ga0070763_108186031	3300005610	Soil	FRLSHEPVEEPLQLLDQEAVAHGIKDRVVVLEEGVTRFF*
Ga0068852_1006684531	3300005616	Corn Rhizosphere	SHEPLDEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF*
Ga0075272_10033364	3300005900	Rice Paddy Soil	LSHEPIDEPLRLLEKEAQAAGVLDRVLVLEEGVTRFF*
Ga0066790_101678093	3300005995	Soil	LSHEPMEEPLQLLSAEARVAGVEDRLLILEEGVTQLFRGRGRI*
Ga0066656_107094302	3300006034	Soil	LSHEPVDEPLQLLDQEARAAGVQDKVVVLEEGVTRFF*
Ga0075029_1002101884	3300006052	Watersheds	FRLSHEPVDEPLQLLDQEAKAAGIKDRVIVLEEGVTRFF*
Ga0075029_1003497393	3300006052	Watersheds	EPVDEPLQLLDEEARANGTKDRVVVMEEGVTRFF*
Ga0075017_1010881102	3300006059	Watersheds	TFRLSHEPVDEPLQLLEREAASAGVSEKVVVMDEGVTRFF*
Ga0075017_1014222351	3300006059	Watersheds	SHEPIEEPLQLLEQEAEAAGVSDRVVVLEEGVTRFF*
Ga0075015_1006027572	3300006102	Watersheds	TFRLSHEPVDEPLQLLEREARAAGIEDRVVVMEEGVTRFF*
Ga0075015_1008507351	3300006102	Watersheds	FKLSHEPMDEPLQLLEQEAKAAGIEDRVLVLQEGVTQFF*
Ga0075030_1006399532	3300006162	Watersheds	HEPMEEPLQLLQKEAAAAGVKHKVVVLEEGVTRFF*
Ga0075021_100541294	3300006354	Watersheds	LSHEPIDEPLQLLDQEARAAGVKDKVVVLEEGITKFF*
Ga0066659_104832222	3300006797	Soil	HEPIDEPLQLLDQAARQAGVQDRVLVLTEGVTKIF*
Ga0079220_103916342	3300006806	Agricultural Soil	EPIDEPLQLLEKEAKSAGIEDQVVVLEEGVTKFF*
Ga0075434_1009256892	3300006871	Populus Rhizosphere	LSHEPMEEPVQLLEQEAKAAGVIDRVHVLQEGVTRVF*
Ga0068865_1000798611	3300006881	Miscanthus Rhizosphere	FRLSHEPLDEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF*
Ga0073928_100820614	3300006893	Iron-Sulfur Acid Spring	SHEPMDEPLQLLEQEARAAGIEDRVFVLEEGVTRFF*
Ga0075426_114463522	3300006903	Populus Rhizosphere	PMEEPLQLLEQEARAAGVQDRVVVLEEGKTRFFKSSWY*
Ga0099793_100494671	3300007258	Vadose Zone Soil	HEPVDEPLQLLDKEARNAGIADRVVVLEEGVTQFF*
Ga0066710_1002721131	3300009012	Grasslands Soil	FRWSHEPIDEPLQLLEKEALAAGITERVLVLDEGITKIF
Ga0099830_111280891	3300009088	Vadose Zone Soil	FRLSHEPIDEPLQLLEQEARSAGIKDRVVVMEEGVTRFF*
Ga0105240_122223782	3300009093	Corn Rhizosphere	EPMDEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF*
Ga0105240_124714922	3300009093	Corn Rhizosphere	RLSHEPIDEPLQLLEQEAKKAGISDQVVVLEEGVTKLF*
Ga0105243_116688672	3300009148	Miscanthus Rhizosphere	HAPLEEPLQLLDREAAGAGVSDRVLVLPEGVTKLF*
Ga0116221_12763352	3300009523	Peatlands Soil	RLSHEPVDEPLQLLDQEAQAAGVKDRVMVMEEGVTRFF*
Ga0116220_106055221	3300009525	Peatlands Soil	TFRLSHEPVDEPLQLLDEEARAAGIKDRVVVMQEGVTRFF*
Ga0116102_10201763	3300009632	Peatland	FRLSHEPIEEPLQLLEREALKAGVKDKVLVLEEGVTRFF*
Ga0116135_10246723	3300009665	Peatland	EPIEEPLQLLGQEARKAGIEDKVVVLEEGITRLF*
Ga0116135_10905863	3300009665	Peatland	SHEPVDEPLQLLEQEARAAGIEDRVVVLEEGVTKFFGS*
Ga0116130_11455881	3300009762	Peatland	HEPIEEPLQLLEREALKAGVRDRVLVMEEGITRFF*
Ga0126374_104280411	3300009792	Tropical Forest Soil	RLSHEPIDEPLQLLDSEAKKAGVTDRVIVLEEGLTKFF*
Ga0116219_107090251	3300009824	Peatlands Soil	HEPVDEPLQLLHQEAEAAGIEDKVVVLEEGVTRFF*
Ga0126373_114448063	3300010048	Tropical Forest Soil	SHEPMDEPLQLLEREAQAAGIKDRVLVLKEGVTRIF*
Ga0126376_110916522	3300010359	Tropical Forest Soil	RLSHEPVDEPLQLLEQEAKVAGIKDRVVVLEEGVTKFF*
Ga0126376_131743682	3300010359	Tropical Forest Soil	FRLSHEPVEEPLQLLDQEARAAGIEDRVVVLEEGITRFF*
Ga0126378_132197502	3300010361	Tropical Forest Soil	FRLSHEPVDEPLQLLEKEAKHAGIQDRVVVLEEGVTRFF*
Ga0126379_111391212	3300010366	Tropical Forest Soil	GTFRLPNEPIDEPLQLLEQEDRAAGVKDQVVVLEEGVTRFF*
Ga0134125_116898172	3300010371	Terrestrial Soil	EPMEEPLQLLEQEARRAGVEDKVLVLPEGITKIF*
Ga0126381_1032771022	3300010376	Tropical Forest Soil	SHEPVEEPLQLLDQEARAAGIEDRVVVLEEGITRFF*
Ga0136449_1005070073	3300010379	Peatlands Soil	TFRLSHEPIDEPLQLLDQEARLAGVRDRVVVLEEGVTKFF*
Ga0126383_122114321	3300010398	Tropical Forest Soil	LSHEPLDEPLQLLDREARRIGIQDRVLVLQEGVTKIF*
Ga0137392_101097284	3300011269	Vadose Zone Soil	EPVDEPLQLLEQEARQAGIEDRVVVLEEGVTRFF*
Ga0153933_10740931	3300011411	Attine Ant Fungus Gardens	TFRLSHEPVDEPLQLLDQEAGSAGIKERVVVMEEGVTRFF*
Ga0137362_114820142	3300012205	Vadose Zone Soil	SHEPIEEPLQLLGQEAEAAGVKDRVVVLEEGVTHFF*
Ga0137380_108352432	3300012206	Vadose Zone Soil	LSHEPVDEPLQLLEQEADAAGTKDRVVVMEEGVTRFF*
Ga0137379_116889212	3300012209	Vadose Zone Soil	MSHEPMDEPLQLLEQEASAAGIQDRVLVLDEGITRIF*
Ga0137384_111127081	3300012357	Vadose Zone Soil	EPMDEPLQLLDQEARAAGIQDRVLVLSEGVTQIFDKS*
Ga0137385_109641912	3300012359	Vadose Zone Soil	EPMEEPLQLLEQEARAAGIHERVLVLKEGVTKIF*
Ga0137385_110141321	3300012359	Vadose Zone Soil	HEPMDEPLQLLDQEARAAGIQDRVLVLSEGVTQIFDKF*
Ga0137358_102903861	3300012582	Vadose Zone Soil	SFRLSHEPVDEPLQLLDKEARNAGIADRVVVLEEGVTQFF*
Ga0137358_110891431	3300012582	Vadose Zone Soil	LSHEPMDEPLQLLEEEAKAAGIEDRVFVLEEGVTRFF*
Ga0137398_111016882	3300012683	Vadose Zone Soil	HEHIEEPLQLLEREDQKAGVKDKVVVLEEGITRFF*
Ga0137395_103586171	3300012917	Vadose Zone Soil	FRLSHEPIEEPLQLLEREALKAGVKDKVVVLEEGVTRFF*
Ga0137395_104416081	3300012917	Vadose Zone Soil	TFRLSHEPIEEPLQLLEREALKAGVKDKVVVLEEGVTRFF*
Ga0164301_115437182	3300012960	Soil	LSQEPMDEPLQLLEKEATAAGIEDRVFVLEEGVTKFF*
Ga0164309_118777451	3300012984	Soil	EPMDEPLQLLEKEAKAAGIEDRVFVLEEGVTKFF*
Ga0181526_104146401	3300014200	Bog	HEPVEEPLQLLKKEARAAGIEDRVIVLEEGVTKFF*
Ga0181526_106975292	3300014200	Bog	GSFRLSHEPVDEPLQLLEHEAEVAGTKDRVVVMEEGVTRFF*
Ga0181537_102224343	3300014201	Bog	RLSHEPIEEPLQLLEKEARAAGIKDKVVVLEEGVTRFF*
Ga0134073_102841162	3300015356	Grasslands Soil	LSHEPMDEPLQLLDDAARQAGVQDRVLVLREGITKIF*
Ga0182041_113264972	3300016294	Soil	RLSHEPIEEPLQLLEREAKAAGIVDRVLVMEEGVTRFF
Ga0187824_102851701	3300017927	Freshwater Sediment	HEPMDEPLQLLEQEAAAAGVSDKILVLPEGVTKLF
Ga0187849_10888302	3300017929	Peatland	FRLSHEPIEEPLQLLEREALAAGVKDKVVVLEEGITRFF
Ga0187825_101475592	3300017930	Freshwater Sediment	RLSHEPVDEPLQLLEKEAATAGVRDRVVVLEEGVTRFF
Ga0187819_107064561	3300017943	Freshwater Sediment	LSHEPVDEPLQLLEEEARAAGIEDRVVVMEEGVTRFF
Ga0187879_108805782	3300017946	Peatland	TFRLSHEPVDEPLQLLAEEARAAGTKDRVVVMEEGVTRFF
Ga0187817_100932943	3300017955	Freshwater Sediment	HEPIDEPLQLLEQEAKAAGIEDRVVVLEEGVTQFF
Ga0187817_106519821	3300017955	Freshwater Sediment	HEPVDEPLQLLDEEARAAGVKDRVVVMEEGITRFF
Ga0187776_113747172	3300017966	Tropical Peatland	RLSHEPIDEPLQLLEQEAKAAGIEDRVRVLQEGVTQLF
Ga0187780_112324262	3300017973	Tropical Peatland	GSFRLSHEPVDEPLQLLEEESRAAGVEDRVVVMEEGVTRFF
Ga0187782_106786852	3300017975	Tropical Peatland	SHEPVEEPLQLLEEEVRAAGIEDRVVVMEEGVTRFF
Ga0187816_104863162	3300017995	Freshwater Sediment	LSHEPVDEPLQLLDQAVRAAGVEDRLVVMEEGVTRFF
Ga0187804_100405601	3300018006	Freshwater Sediment	RLSHEPIEEPLQLLQQEAQAAGVKDRVVVLEEGVTRFF
Ga0187804_100934352	3300018006	Freshwater Sediment	SHEPMDEPLKLLAKEARRAGVQDRVKVLPEGVTAFF
Ga0187805_101071702	3300018007	Freshwater Sediment	MFKKTALDEPLQLLKSEAKAAGIEDRVLVLQEGITRLF
Ga0187805_104498302	3300018007	Freshwater Sediment	LSHEPIDEPLQLLEQEAKAAGIEDRVKVLEEGVTQLF
Ga0187810_104040332	3300018012	Freshwater Sediment	SHEPIDEPLKLLAKEAKRAGIQDRVRVLREGVTAFF
Ga0187861_101784931	3300018020	Peatland	LSHEPIEEPLQLLEREALAAGVKDKVVVLEEGITRFF
Ga0187864_101021533	3300018022	Peatland	FRLSHEPIEEPLQLLEREALKAGVKDKVLVLEEGVTRFF
Ga0187875_106098373	3300018035	Peatland	RLSHEPIEEPLQLLEREALKAGVKDKVVVLEEGVTRFF
Ga0187871_101165893	3300018042	Peatland	FRLSHEPIDEPLQLLEREAAKAGVKDKVVVLEEGITRFF
Ga0187887_107493201	3300018043	Peatland	TFRLSHEPIDEPLQLLEREAAKAGVKDKVVVLEEGITRFF
Ga0187890_105744921	3300018044	Peatland	LSHEPIEEPLQLLEREALAAGVIDKVVVLEEGVTRFF
Ga0187766_100114835	3300018058	Tropical Peatland	LSHEPIDEPLQLLEQEAKARGIEDRVLVLEEGITQFF
Ga0187766_107233991	3300018058	Tropical Peatland	RLSHEPVDEPLQLLDREARAAGIQDRVVVMEEGITRFF
Ga0187766_108912971	3300018058	Tropical Peatland	SFRLSNEPIDEPLKLLAKEAKRAGIQDRVRVLPEGVTAFF
Ga0187784_102884733	3300018062	Tropical Peatland	GTFRLSHEPIDEPLHLLERGAKAAGIEDRVVAMEESVTQFF
Ga0187784_108442031	3300018062	Tropical Peatland	TFRLSHEPVEEPLQLLDQEARAAGIKDRVVVMEEGVTRFF
Ga0187784_112965322	3300018062	Tropical Peatland	GSFRLSHEPIDEPLKLLAKEARRAGIQERVRVLPEGVTAFF
Ga0187769_100489711	3300018086	Tropical Peatland	SHEPVEEPLQLLEQEARSAGIQDRVVVLEEGITRFF
Ga0187774_101720221	3300018089	Tropical Peatland	LSHEPIDEPLRLLAKEARRAGIQDRVRVLPEGVTAFF
Ga0187770_103345104	3300018090	Tropical Peatland	FRLSHEPVDEPLELLDQEARAAGVKDRVVVLEEGVTRLF
Ga0066662_103743202	3300018468	Grasslands Soil	SHEPIDEPLQLLQHEAEAAGIQDRVVVMEEGVTQFF
Ga0182022_10994361	3300019785	Fen	SFRLSHEPIEEPLQLLEREALKAGVKDKVVVLEEGVTRFF
Ga0182025_12562003	3300019786	Permafrost	MSLWTNRLQLLEQEAKAAGIEDRVLVLEEGVTRFF
Ga0210407_107680012	3300020579	Soil	HEPVDEPLQLLEREARAAGIEDRVVVLEEGVTKFF
Ga0210403_104001672	3300020580	Soil	AHEPVDEPLQLLEQEARSAGIADRVVVLEEGVTRFF
Ga0210403_107962561	3300020580	Soil	RLSHEPVDEPLQLLDQEAQAAGTKDRVVVMEEGVTRFF
Ga0210399_115867092	3300020581	Soil	LSHEPVDEPLRLLAQEAKAAGIEDRVRVMEEGVTQFF
Ga0210401_110408941	3300020583	Soil	FRLSHEPVDEPLQLLDQEARAAGVKDRVMVMEEGVTRFF
Ga0210401_112127332	3300020583	Soil	LSHEPIDEPLQLLDKEARQAGIRDRVVVLEEGLTKFF
Ga0210408_108864092	3300021178	Soil	LSHEPVDEPLQLLEEEARAAGTKDRVVVLEEGVTRFF
Ga0210383_112808991	3300021407	Soil	SHEPREEPLQLLEQEAKAAGIEDRVLVLEEGVTRFF
Ga0210394_109550963	3300021420	Soil	LSHEPVDEPLQLLEQEARAAGAKDRVVVMEEGVTRFF
Ga0210384_100402257	3300021432	Soil	LSHEPMEEPLQLLEQEAKAAGIEDRVLVLEEGVTRFF
Ga0210391_103235634	3300021433	Soil	LSHEPMDEPLQLLEQEAKAAGIEDRVFVMEEGVTRFF
Ga0210402_112233602	3300021478	Soil	LSHEPVDEPLQLLAEEAHSAGIEDRVLVMEEGVTRFF
Ga0126371_101742224	3300021560	Tropical Forest Soil	SHEPLDEPLQLLDREARRIGIQERVLVLQEGVTKIF
Ga0224712_101839681	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	HEPMEEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF
Ga0224564_11118891	3300024271	Soil	SHEPVDEPLQLLQQEAHAAGIEDRVVVLEEGVTRFF
Ga0208935_10158642	3300025414	Peatland	FRLSHEPVEEPLQLLEQEARMAGIRDRVLVLEEGVTRFF
Ga0208188_10850722	3300025507	Peatland	RLSHEPIEEPLQLLEQEAMAAGVKDKVVVLEEGVTHFF
Ga0207654_108555082	3300025911	Corn Rhizosphere	FRLSHEPVDEPLQLLDQEARAAGVQDKVVVLEEGVTRFF
Ga0207646_110253541	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	HEPVDEPLQLLDQEARSAGIKDRVVVMEEGVTRFF
Ga0207694_110320341	3300025924	Corn Rhizosphere	TFRLSHEPLDEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF
Ga0207700_106649631	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	SHEPMEEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF
Ga0207690_114228442	3300025932	Corn Rhizosphere	LSHEPMDEPLLLLKQEALDAGIEKKVVVMEEGVTQFF
Ga0207665_107930141	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	LSHEPMEEPLALLEKEAKAAGIQDRVLIMEEGVTKFF
Ga0207711_119208302	3300025941	Switchgrass Rhizosphere	LSHEPLDEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF
Ga0207661_116215421	3300025944	Corn Rhizosphere	HEPVDEPLQLLDQEARAAGVQDKVVVLEEGVTHFF
Ga0207668_112981151	3300025972	Switchgrass Rhizosphere	RLSHEPIDEPLQLLEKEAEAAGITDRVVVLEEGVTKFF
Ga0208651_10225521	3300025998	Rice Paddy Soil	RLSHEPIDEPLRLLEKEAQAAGVLDRVLVLEEGVTRFF
Ga0207702_100269821	3300026078	Corn Rhizosphere	SHEPVDEPLQLLDREARAAGIKDKVVVLEEGVTRFF
Ga0209377_11473973	3300026334	Soil	PMDEPLQLLDQEARAAGIQDRVLVLSEGVTQIFDKS
Ga0257177_10489951	3300026480	Soil	HEPIEEPLQLLEREALKAGVKDKVVVLEEGITRFF
Ga0257153_10413522	3300026490	Soil	RLSHEPIEEPLQLLEREAQKAGVKDKVVVLEEGITRFF
Ga0209056_100322531	3300026538	Soil	FRLSHEPIDEPLLLLDHAARQAGVQDRVLVLTEGVTKIF
Ga0209422_10182964	3300027629	Forest Soil	SHEPIEEPLQLLEREAQKAGVKDKVVVLEEGITRFF
Ga0208696_10157301	3300027696	Peatlands Soil	FRLSHEPIEEPLQLLEREALKAGVKDKVLVLEEGITRFF
Ga0209446_11661741	3300027698	Bog Forest Soil	SHEPIEEPLQLLEREAVKAGVKDKVVVLEEGITRFF
Ga0209039_100314904	3300027825	Bog Forest Soil	FRLSHEPVDEPLQLLEQEARSAGIEDRVVVMEEGVTRFF
Ga0209580_100114566	3300027842	Surface Soil	PLDEPLQLLDHEARRVGIRDRVLVLQEGVTKIFRE
Ga0209580_105511531	3300027842	Surface Soil	LSHEPIDEPLQLLDQEARLAGVRDRVFVLEEGVTKFF
Ga0209380_101458301	3300027889	Soil	QEPVDEPLQLLDQEAQAAGTKDRVVVMEEGVTRFF
Ga0209380_105354311	3300027889	Soil	RLSHEPIDEPLQLLEKEARAAGIEESVRVMEEGVTQFF
Ga0257175_10048373	3300028673	Soil	HEPMDEPLQLLEKEAKAAGIEDRVVVMEEGVTRFF
Ga0302199_11658121	3300028860	Bog	RLSHEPIEEPLQLLEREALAAGVKDKVVVLEEGITRFF
Ga0311341_107617301	3300029908	Bog	FRLSHEPVDEPLQLLEQEAREAGIEDRVVVLQEGVTRFF
Ga0311359_102477031	3300029914	Bog	FRLSHEPIEEPLQLLERAALAAGVRDKVVVLEEGVTRFF
Ga0302177_103891013	3300030053	Palsa	LSHEPIEEPLQLLEKEARAAGVKDKVVVLEEGITRFF
Ga0302179_100813251	3300030058	Palsa	HEPIEEPLQLLERAAQAAGVKDKVVVLEEGVTRFF
Ga0302194_100251616	3300030506	Bog	SFRLSHEPIEEPLQLLEREALAAGVKDKVVVLEEGITRFF
Ga0170822_119912272	3300031122	Forest Soil	FRLSHEPIDEPLQLLDEEARSHGIEDRVCVLEEGVTRFF
Ga0170824_1096565341	3300031231	Forest Soil	HEPVDEPLQLLEQEADAAGTKDRVVVMEEGVTRFF
Ga0170824_1149317491	3300031231	Forest Soil	SLSHEPIEEPLQLLEKEATAAGIKDRVLILDEGITRIF
Ga0302307_100572313	3300031233	Palsa	RLSHEPVDEPLQLLDEEARAAGTKDRVVVMEEGVTRFF
Ga0265316_108138443	3300031344	Rhizosphere	SHEPMEEPLQLLEREAKAAGVKDRVFVLEEGVTRFF
Ga0265314_106472301	3300031711	Rhizosphere	LSHEPIEEPLQLLEREAQAAGVKDRVVVLEEGITRFF
Ga0307469_108316881	3300031720	Hardwood Forest Soil	LSHEPLEEPLQLLDREARRAGIQDRVLVLEEGVTKIF
Ga0307477_105894591	3300031753	Hardwood Forest Soil	HEPVDEPLQLLDEEARTAGVKDRVIVMEEGVTRFF
Ga0307475_109292272	3300031754	Hardwood Forest Soil	SHEPIDEPLQLLEEEARYAGIEDRVVVLEEGVTKFF
Ga0310912_103595871	3300031941	Soil	SHEPIEEPLQLLEREAKAAGIVDRVLVMEEGVTRFF
Ga0307479_104878291	3300031962	Hardwood Forest Soil	FRLSREPIEEPLLLLEREAEKAGVKDKVVVLREGITRFF
Ga0307479_108389702	3300031962	Hardwood Forest Soil	HEPMEEPLQLLEKEARAAGIEDRVFVLEEGVTRFF
Ga0307479_113860091	3300031962	Hardwood Forest Soil	SHEPMDEPLQLLRAEVRAAGIEDRLAVLEEGVTRFF
Ga0306922_111960702	3300032001	Soil	HEPLDEPLQLLGQEARNAGIEDRVVVLEEGVTKFF
Ga0311301_115350562	3300032160	Peatlands Soil	HEPMDEPLQLLEQEAKAAGIEDRVLVLEEGVTRFF
Ga0311301_125074761	3300032160	Peatlands Soil	RLSHEPVDEPLQLLDQEAQAAGVKDRVMVMEEGVTRFF
Ga0307471_1003859903	3300032180	Hardwood Forest Soil	RLSHEPVDEPLELLDQEAEAAGVKDRVIVLEEGVTRFF
Ga0335078_101315161	3300032805	Soil	SHEPIDEPLQLLEQEAKAAGIEDRVRVLEEGVTQLF
Ga0335078_120358111	3300032805	Soil	RLSHEPVDEPLQLLDQEVRAAGVEDRVVVLQEGVTRFF
Ga0335080_110368911	3300032828	Soil	LSHEPIDEPLKLLAKEARRAGIQDRVRVLPEGVTAFF
Ga0335075_106526691	3300032896	Soil	FRLSHEPVEEPLQLLDREARKAGIEDKVVVMEEGVTRFF
Ga0335072_104851481	3300032898	Soil	TFRLSHEPVEEPLQLLDREARKAGIEDKVVVMEEGVTRFF
Ga0310914_105063351	3300033289	Soil	SHEPMDEPLQLLEREAQAAGIKDRVLVLKEGVTKIF

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign