NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034199

Metagenome / Metatranscriptome Family F034199

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034199
Family Type Metagenome / Metatranscriptome
Number of Sequences 175
Average Sequence Length 152 residues
Representative Sequence FALAALCATSTSAIKIEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Number of Associated Samples 135
Number of Associated Scaffolds 175

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.47 %
% of genes near scaffold ends (potentially truncated) 70.86 %
% of genes from short scaffolds (< 2000 bps) 98.86 %
Associated GOLD sequencing projects 128
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.857 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(36.000 % of family members)
Environment Ontology (ENVO) Unclassified
(73.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(80.571 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.93%    β-sheet: 7.07%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.86 %
UnclassifiedrootN/A1.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002186|JGI24539J26755_10214124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300006356|Ga0075487_1488309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300006403|Ga0075514_1824071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300007955|Ga0105740_1056203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300008958|Ga0104259_1037277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300008993|Ga0104258_1078656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300009022|Ga0103706_10120818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300009071|Ga0115566_10250277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1061Open in IMG/M
3300009193|Ga0115551_1155956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1044Open in IMG/M
3300009193|Ga0115551_1346811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300009434|Ga0115562_1190976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium739Open in IMG/M
3300009434|Ga0115562_1227486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300009440|Ga0115561_1163757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium864Open in IMG/M
3300009442|Ga0115563_1218832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium723Open in IMG/M
3300009498|Ga0115568_10331983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300009507|Ga0115572_10270247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium969Open in IMG/M
3300009507|Ga0115572_10427755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium739Open in IMG/M
3300009543|Ga0115099_10012303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300009592|Ga0115101_1661262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300009599|Ga0115103_1750438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300009606|Ga0115102_10214797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium676Open in IMG/M
3300009606|Ga0115102_10234423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300009677|Ga0115104_10398992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300010985|Ga0138326_12129754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300010987|Ga0138324_10502676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300012415|Ga0138263_1119501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300012419|Ga0138260_11136021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300012504|Ga0129347_1005161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300012504|Ga0129347_1148389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium829Open in IMG/M
3300012518|Ga0129349_1003387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300012518|Ga0129349_1223849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium870Open in IMG/M
3300012523|Ga0129350_1433786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300012523|Ga0129350_1450390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300012525|Ga0129353_1326318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300012935|Ga0138257_1036272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300012954|Ga0163111_11470972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300012965|Ga0129346_1012492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300012965|Ga0129346_1131739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300012966|Ga0129341_1076201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300013010|Ga0129327_10311507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium817Open in IMG/M
3300016732|Ga0182057_1515837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300016751|Ga0182062_1191169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300017755|Ga0181411_1194578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300017818|Ga0181565_10987439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300017951|Ga0181577_10531906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300017986|Ga0181569_10929716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300018428|Ga0181568_10465764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1011Open in IMG/M
3300018599|Ga0188834_1030103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300018617|Ga0193133_1026405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300018628|Ga0193355_1019826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300018655|Ga0192846_1026870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300018658|Ga0192906_1041125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300018692|Ga0192944_1063333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300018742|Ga0193138_1044474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300018742|Ga0193138_1044619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300018742|Ga0193138_1044911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300018745|Ga0193000_1062306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300018749|Ga0193392_1056337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300018759|Ga0192883_1057163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300018763|Ga0192827_1072006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300018765|Ga0193031_1067038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300018765|Ga0193031_1077206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300018766|Ga0193181_1068447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300018787|Ga0193124_1060677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300018787|Ga0193124_1065460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300018806|Ga0192898_1090931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300018823|Ga0193053_1069465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300018823|Ga0193053_1070026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300018830|Ga0193191_1083405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300018831|Ga0192949_1108875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300018832|Ga0194240_1011936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300018832|Ga0194240_1014906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium682Open in IMG/M
3300018832|Ga0194240_1034500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300018842|Ga0193219_1072030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300018899|Ga0193090_1111701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300018905|Ga0193028_1116662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300018913|Ga0192868_10048237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300018913|Ga0192868_10065431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300018955|Ga0193379_10194149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300018967|Ga0193178_10048103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300018967|Ga0193178_10070382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M
3300018967|Ga0193178_10077624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300018980|Ga0192961_10175033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300018989|Ga0193030_10209711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300018989|Ga0193030_10262030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300019010|Ga0193044_10278142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300019021|Ga0192982_10320499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300019025|Ga0193545_10108412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300019032|Ga0192869_10252350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium763Open in IMG/M
3300019032|Ga0192869_10336475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300019036|Ga0192945_10209376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300019036|Ga0192945_10215315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300019036|Ga0192945_10232007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300019037|Ga0192886_10306036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300019055|Ga0193208_10673428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300019081|Ga0188838_110534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300019095|Ga0188866_1029106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300019097|Ga0193153_1026962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300019097|Ga0193153_1028952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300019103|Ga0192946_1046032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300019108|Ga0192972_1094594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300019116|Ga0193243_1045348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300019116|Ga0193243_1052489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300019116|Ga0193243_1053682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300019125|Ga0193104_1053960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300019129|Ga0193436_1074309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300019153|Ga0192975_10316668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300019272|Ga0182059_1182523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300019272|Ga0182059_1221738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300019276|Ga0182067_1462926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300019283|Ga0182058_1259272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300021378|Ga0213861_10473654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300021389|Ga0213868_10358177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium818Open in IMG/M
3300021872|Ga0063132_107195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300021872|Ga0063132_109684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300021889|Ga0063089_1035062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300021912|Ga0063133_1017862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300021912|Ga0063133_1023310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300021924|Ga0063085_1021449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300021930|Ga0063145_1050850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300021932|Ga0063872_1032662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300021941|Ga0063102_1026295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300021954|Ga0063755_1024263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300023110|Ga0255743_10355411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium737Open in IMG/M
3300025620|Ga0209405_1113981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium752Open in IMG/M
3300025626|Ga0209716_1115622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300025699|Ga0209715_1182394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300025712|Ga0209305_1123464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium808Open in IMG/M
3300025881|Ga0209309_10403355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300026495|Ga0247571_1121588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300027849|Ga0209712_10433618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium739Open in IMG/M
3300028137|Ga0256412_1166795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium813Open in IMG/M
3300028137|Ga0256412_1290111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300028137|Ga0256412_1361829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300028137|Ga0256412_1392609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300028282|Ga0256413_1196071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300028282|Ga0256413_1295531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300028290|Ga0247572_1177099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300028672|Ga0257128_1117456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300030715|Ga0308127_1039865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300030723|Ga0308129_1030557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300030729|Ga0308131_1129556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300030956|Ga0073944_11401237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300031037|Ga0073979_10008767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300031522|Ga0307388_10951552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300031597|Ga0302116_1115063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium871Open in IMG/M
3300031621|Ga0302114_10215714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium797Open in IMG/M
3300031621|Ga0302114_10238947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium741Open in IMG/M
3300031638|Ga0302125_10204707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300031725|Ga0307381_10323230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300032463|Ga0314684_10401224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium805Open in IMG/M
3300032463|Ga0314684_10708778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300032463|Ga0314684_10869262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300032481|Ga0314668_10318967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium804Open in IMG/M
3300032492|Ga0314679_10212505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium883Open in IMG/M
3300032517|Ga0314688_10782236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300032519|Ga0314676_10769260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300032519|Ga0314676_10870279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300032522|Ga0314677_10185259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1048Open in IMG/M
3300032615|Ga0314674_10424041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300032615|Ga0314674_10426110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300032708|Ga0314669_10406503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300032709|Ga0314672_1336643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300032709|Ga0314672_1337068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300032713|Ga0314690_10595019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300032723|Ga0314703_10468524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300032724|Ga0314695_1251882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300032724|Ga0314695_1303414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300032732|Ga0314711_10658705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300032742|Ga0314710_10385680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300032742|Ga0314710_10484828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300032748|Ga0314713_10241020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium767Open in IMG/M
3300032754|Ga0314692_10369233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium777Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine36.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.86%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater13.14%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine8.57%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.86%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.29%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.71%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.29%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.71%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.71%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.14%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.57%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.57%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002186Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M MetagenomeEnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018749Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789662-ERR1719448)EnvironmentalOpen in IMG/M
3300018759Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000759 (ERX1789554-ERR1719287)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018806Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000722 (ERX1789621-ERR1719484)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019081Metatranscriptome of marine microbial communities from Baltic Sea - GS676_3p0_dTEnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030729Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1108_32.2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031597Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCMEnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24539J26755_1021412413300002186MarineIQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQPK*
Ga0075487_148830913300006356AqueousMKYTLAIAALFATSNAIKIEGDYFKPGDHGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGADLTTYLNTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK*
Ga0075514_182407113300006403AqueousSRPPYQSAAQLAESESDSDSSDDEESLVMTQGDYFKPGHSGMIGANAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDAAAATAASREVLCTHKSICGADLDTYMSTYFQKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK*
Ga0105740_105620313300007955Estuary WaterMKFFALAALCATSTTAIKIEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDSYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0104259_103727713300008958Ocean WaterMQVDASDSESDSSDDEEANIQLGAGDFFKPGFSGTVGAAAYSRVMPERFASDDDDIFMRSMIATYALEAQDKDGAPTGAFWMDKASAKAAAEEVLCTHKKICGAELTAYLDAYLSKAWGHFDVNQTGSIE
Ga0104258_107865613300008993Ocean WaterFNGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPANYVSDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0103706_1012081823300009022Ocean WaterMASILCTQDHGTLGTLHPNVEMFLASSFASSNAIKIEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEAAAKAAASEVLCTHKGICGGDLATYLGTYFSKAWGHFDVNRTGYIEVIKMPQFIRFIASDQYFQFIQPK*
Ga0115566_1025027723300009071Pelagic MarineMIKGRAINFYNKFNGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPAHFASDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0115551_115595623300009193Pelagic MarineMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPAHFASDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0115551_134681113300009193Pelagic MarineDSSDDEEANVQLQGDYFKPGFSGTIGAAAYSRVMPERFASDDDDIFMRSMIAKYALEAQDKDGAPTGAFWMDEFAAKAAASEVLCTHKKICGDELTSYLGTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK*
Ga0115562_119097613300009434Pelagic MarineMKFFALAALCATSTTAIKVEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK*
Ga0115562_122748623300009434Pelagic MarineMKFVFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALEAKDKDGVPTGAFWVDEFAAKAASSEVLCTHKKICGADLQSYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK*
Ga0115561_116375713300009440Pelagic MarineAIKVEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK*
Ga0115563_121883213300009442Pelagic MarineMKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALEAKDKDGVPTGAFWVDEFAAKAASSEVLCTHKKICGADLQSYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK*
Ga0115568_1033198313300009498Pelagic MarineGTIGASAYDREPRMPVHFASDDDDIFMRSMIENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK*
Ga0115572_1027024723300009507Pelagic MarineMKYAFAIAALCATSNAIQVEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK*
Ga0115572_1042775513300009507Pelagic MarineMKFFALAALCATSTTAIKVEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK*
Ga0115099_1001230313300009543MarineGNPDFFFPGDDKTLGESAYKRVIPVRFESDDDDIFMRSMYENYAYEEKTPKTKTDAGGAPTGHFWMVKTQAYAAAQEVLSTHKGMSGAALQKYLDTYFEKAWGHFDVNLTG*
Ga0115101_166126213300009592MarineMKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALESKDKEGAPTGAFWVDEFAAKAASSEVLCTHKKICGADLQAYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK*
Ga0115103_175043813300009599MarineLLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRVPANYVSDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0115102_1021479713300009606MarineIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDSYFQKAWGHFDVNRTGYIEVIKMPSFIRFLASDQYFQFIQPK*
Ga0115102_1023442313300009606MarineGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRVPANYVSDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0115104_1039899213300009677MarineFALAALCATSTSAIKIEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK*
Ga0138326_1212975413300010985MarineLCATSTSAIKIEGDYFKPGFSGTIGASAYERQTTARFAGDDDDIFMRSMIENYALEEKTAEDKKTGYAGGEPTGKFWMDEAAAKAAASEVLCTHKAICGADLSAYLGTYFSKAWGHFDVNRTGFIEVIKMPMFIRFLASDQYMSLQ*
Ga0138324_1050267613300010987MarineMVQTAKEGDYFAAGFSGTIGAAAYERAIPDRFSSDSDDLFMRSMITTYALEAKDKDGAPTGAFWMDKAQATAAAREVLCTHKKICDGALDAYLGTYFSKAWGHFDVNQTGYIEVIKMPMFIRFLA
Ga0138265_132525513300012408Polar MarineENIQLAGDYFKPGFSGTVGAAAYARVMPERFSTDDDDIFMRSMIASYALEAQDKDGAPTGAFWMDKLSATAAAKEVLCTHKKICGAELESYLGTYMSKAWGHFDVNQTGYIEVIKMP*
Ga0138263_111950113300012415Polar MarineQVDESDSESDSSDDEESNVQLAGDYFKPGFSGTVGAAAYARVMPERFASDDDDIFMRSMIATYALEAQDKDGAPTGAFWMDKTSATAAAKEVLCTHKKICDAELESYLTSYFSKAWGHFDVNQTGYIEVIKMPMFIRFLASDQYFQFIQPK*
Ga0138260_1113602113300012419Polar MarineKIMKYTFVLAALVATSSAITVEKKSEKADYFIPGDSGMIGAGPYARTTPLRFASDEDDIFMRSMIEQYSLEAKDKEGNPTGAFWMDEFATKAAASEVLCTHKKICDADLASYLDLYFAKAWGHFDVNRTGYVEVIKMPQFMRFLASDQYFSLQP*
Ga0129347_100516113300012504AqueousKFFALAALCATSTSAIKIEGDYFKPGDHGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLNTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0129347_114838913300012504AqueousMKYTLAIAALFATSNAIKIEGDYFKPGDHGMIGANAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGADLTTYLNTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK*
Ga0129349_100338713300012518AqueousKFFALAALCATSTSAIKIEGDYFKPGDHGTIGASAYDREPRMPAQFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLNTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0129349_122384913300012518AqueousMTQGDYFKPGHSGMIGANAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDAAAATAASREVLCTHKSICGADLDTYMSTYFQKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK*
Ga0129350_143378613300012523AqueousMKYTLAIAALFATSNAIKIEGDYFKPGDHGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEAAANAAGREVLCTHKAICGAELDTYMSTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0129350_145039013300012523AqueousLCATSTSAIKIEGDYFKPGDHGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLNTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0129353_132631813300012525AqueousFALAALCATSTSAIKIEGDYFKPGDHGTIGASAYDREPRMPAQFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLNTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0138257_103627213300012935Polar MarineKYTFVLAALVATSSAITVEKKSEKADYFIPGDSGMIGAGPYARTTPLRFASDEDDIFMRSMIEQYSLEAKDKEGNPTCAFWMDEFATKAAASEVLCTHKKICDADLASYLDLYFAKAWGHFDVNRTGYVEVIKMPQFMRFLASDQYFSLQP*
Ga0163111_1147097223300012954Surface SeawaterMKYTLAIAALFASSNAIKIEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMINNYALEEKTAEDKKTGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLTTYLDTYFQKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQ*
Ga0129346_101249213300012965AqueousATSTSAIKIEGDYFKPGDHGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLNTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0129346_113173913300012965AqueousEVSDEETLEEKAEVPKAKGAASMEVDGEKAADEVALAIAALFATSNAIKIEGDYFKPGDHGMIGANAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGADLTTYLNTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK*
Ga0129341_107620113300012966AqueousMKFFALAALCATSTSAIKIEGDYFKPGDHGTIGASAYDREPRMPAQFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLNTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK*
Ga0129327_1031150713300013010Freshwater To Marine Saline GradientEEENVQIGGDYYEASFSGTTGAAAYSRVTPERFSSDDDDIFMRSMIQKYALEAHDKDGAPTGAFWMNEATAKAAAKEVLCTHKKICGGDLDTYLNTYFSKAWGHFDVNRTGTIEVIKMPMFIRFLASDQYFQFIDPK*
Ga0182057_151583713300016732Salt MarshKFFALAALCATSTSAIKIEGDYFKPGDHGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLATYLSTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0182062_119116913300016751Salt MarshMKYTLAIAALFATSNAIKIEGDYFKPGDHGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEAAASAAAREVLCTHKSICGGDLDTYMSTYFQKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0181411_119457813300017755SeawaterGFSGTIGASAYERVTTDRFAGDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDELAAKAAASEVLCTHKGICGGDLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0181423_120087013300017781SeawaterASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEAAANAAGREVLCTHKAICGAELDTYMSTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0181565_1098743913300017818Salt MarshMKFFALAALCATSTSAIKIEGDYFKPGDHGSIGASSYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEAAASAAAREVLCTHKSICGGDLDTYMSTYFQKAWGHFDVNRTG
Ga0181577_1053190613300017951Salt MarshMKFFALAALCATSTSAIKIEGDYFKPGDHGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLATYLSTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0181569_1092971613300017986Salt MarshMKYTLAIAALFATSNAIKIEGDYFKPGDHGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYAVEEKTPKTDTDDGGLPTGKFWMTKSTAYAAAQEVLATHKGLRGAELNTYLDTYFNKAWGHFDVNVVGKIE
Ga0181568_1046576423300018428Salt MarshMKFFALAALCATSTSAIKIEGDYFKPGDHGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEAAASAAAREVLCTHKSICGGDLDTYMSTYFQKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0188834_103010313300018599Freshwater LakeFFALAALCATSTTAIQLEGDYFKPGFSGTIGAAAYDRKIPAHFTSDDDDIFMRSMLENYALEEKTAEDKATGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFMRFLASDQYFQFIQPK
Ga0193133_102640513300018617MarineFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLDSYFQKAWGHFDVNRTGYIEVIKMPQFIRFIASDQYFQFIQPK
Ga0193355_101982613300018628MarineGEESLLQMRGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIANYALESKTAEDKATGYKGGEPTGQFWMDEPAANAAAREVLCTHKAICGGDLDSYMSTYFQKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK
Ga0192846_102687013300018655MarineMTKVTGDYFAAGFSGTIGASAYERVITANFEGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDEAAAKAAASEVLCTHKGICGADLSAYLGTYFSKAWGHFDVNRTGFIEVIKMPMFIRFLASDQYFQFIQPK
Ga0192906_104112513300018658MarineYFKPGSSGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEAAARAAASEVLCTHKAICGGDLATYLGTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0192944_106333313300018692MarineKVEGDYFKPGFSGTIGASAYDREPRIPAHFASDDDDIFMRSMVENYALESKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193138_104447413300018742MarineSRPPYQSAAQISESESDSDSSDDEENLVALGDYFKPGSSGMVGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGGDLTTYLDSYFSKAWGHFDVNRTGYIEVIKMPQFIRFIASDQYFQFIQPK
Ga0193138_104461913300018742MarineGILLNNLKKMKYTLAIAALFASSNAIKIENQDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFIASDQYFQFIQPK
Ga0193138_104491113300018742MarineSRPPYQSAAQISESESDSDSSDDEENLVALGDYFKPGSSGMVGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEAAAKAAASEVLCTHKGICGGDLATYLGTYFSKAWGHFDVNRTGTIEVIKMPMFIRFLASDQYFQFIQPK
Ga0193000_106230613300018745MarineESGMIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEPAANAAAREVLCTHKSICGAELDTYLGTYFQKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0193392_105633713300018749MarineMKYTLAIAALFATSNAIKLEGDYFKPGFSGTIGASAYEREITARFAGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGGDLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0192883_105716313300018759MarineAQLGESESESDSSDDEEESLLQMRGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMINNYALEEKTAEDKATGYKGGEPTGKFWMDEPAANAAAREVLCTHKNICGAEQDTYMSTYFQKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK
Ga0192827_107200613300018763MarineMTATTGDYFKPGFSGTIGASAYERVTTANFAGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDEAAARAAASEVLCTHKAICGADLSAYLGTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0193031_106703813300018765MarineMKFFALAALCATSTAIKIEGDYFKPGFSGTIGASAYARETTARFAGDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193031_107720613300018765MarineMKFFALAALCASTNAIKIEGDYFKPGFSGTIGAAAYERATPDRFASDDDDIFMRSMIENYALEGKTAEDKATGYKGGEPNGKFWMDEFAAKAAAEEVLCTHKGICGGDLATYLGSYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFI
Ga0193181_106844713300018766MarineLCASSNAVKLEGDYFKAGFSGTIGASAYERVITPNFAGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGGDLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193124_106067713300018787MarineKKMKYTLAIAALFASSNAIKIEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGGDLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0193124_106546013300018787MarineFKPGSSGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEAAAKAAASEVLCTHKAICGGDLATYLGTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0192898_109093113300018806MarineNAIKIEGDYFKPGFSGTIGASAYERVTTDRFAGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGGDLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193053_106946513300018823MarineMKYTLAIAALFATSNAIKLESEDYFKPGFSGTIGASAYSRVTTPRFAGDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDELAAKAAASEVLCTHKGICGGDLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193053_107002613300018823MarineKFFALAALCATSTNAIKLEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMINNYALEEKTAEDKKTGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193191_108340513300018830MarineLFATSNAIKIEGDYFKPGEHGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGADLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0192949_110887513300018831MarineYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPAHFASDDDDIFMRSMVENYALESKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0194240_101193613300018832MarineMTQGDYFKPGFSGTIGASAYERVTTARFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEPAANAAAREVLCTHKAICGAELDTYMSTYFQKAWGHFDVNRTGTIEVIKMP
Ga0194240_101490613300018832MarineMKYTFAIAALCATSNAIKIEGDYFKPGFSGTIGASAYERVTTPRFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0194240_103450013300018832MarineMKFFALAAIAATSSAIKLESEDYFKPGFSGTIGASAYSRTTTPRFAGDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193219_107203013300018842MarineKFYALAALCATSSAIKIEGDYFKPGFSGTIGASAYERVTTPRFAGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLDTYLGTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193090_111170113300018899MarineMKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALEAKDKDGVPTGAFWVDEFAAKAASSEVLCTHKKICGADLQTYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK
Ga0193028_111666213300018905MarineSTAIKIEGDYFKPGFSGTIGASAYARETTARFAGDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0192868_1004823713300018913MarineMKFFALAALCATSTNAIKIEGDYFKPGFSGTIGSSAYERVTTERFASDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLDSYFSKAWGHFDVNRTGYIEVIKMP
Ga0192868_1006543113300018913MarineDSESDSSDDEESNIQLAGDYFKPGFSGTVGASAYARVMPERFASDDDDIFMRSMIATYALEAQDKDGAPTGAFWMDKTSATAAAKEVLCTHKQICGAELDSYLATYFSKAWGHFDVNQTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0193379_1019414913300018955MarineKEMKYTFAIAALFATSNAIKLEGDYFKPGFSGTIGASAYEREITARFAGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGGDLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFIASDQYFQFIQPK
Ga0193178_1004810313300018967MarineRKMKYTLAIAALCASSNAVKLEGDYFKAGFSGTIGASAYERVITPNFAGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGGDLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193178_1007038213300018967MarineTLAIAALFATSNAIKIEGDYFKPGEHGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGADLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0193178_1007762413300018967MarineKMKYTLAIAALFASSNAIKIEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0192961_1017503313300018980MarineMGNKFNGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPAHFASDDDDIFMRSMVENYALESKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193030_1020971113300018989MarineMKYTFAIAALFATSNAIKIEGDYFKPGFSGTIGASAYERATPDRFASDDDDIFMRSMIENYALEGKTAEDKATGYKGGEPNGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193030_1026203013300018989MarineIKIEGDYFKPGFSGTIGASAYARETTARFAGDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193044_1027814213300019010MarineDSSDDEEENVQLAGDYFVPGFSGAIGAAAYSRATPERFSADTDDIFMRSMINNYALEAKDKDGLPTGAFWVDEFAAKAAASEVLCTHKKICGEELASYLATYFSKAWGHFDVNRTGYVEVIKMPQLVRFLASDQYFQFMEPK
Ga0192982_1032049913300019021MarineLGFATESTNAVQLEGDYIIPGFSGAIGAAAYTRVTPERFAADEDDIFMRSMITQYALEAKDAAGAPSGKFWMDNFAAKAAASEVLCTHKKICGEDLTTYLGSYFSKAWGHFDVNQTGYIEVIKMPQFIRFLASDQYFQFMTPKD
Ga0193545_1010841213300019025MarineTNAIKIEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEAAAKAAASEVLCTHKAICGGDLATYLGTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0192869_1025235013300019032MarineMGSAAQISESESDSDSSDDEENLVALGDYFKPGSSGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEAAAKAAASEVLCTHKGICGGDLATYLGTYFSKAWGHFDVNRTGTIEVIKMPMFIRFLASDQYFQFIQPK
Ga0192869_1033647513300019032MarineMGKFNGILLNNLKKMKYTLAIAALFATSNAIKIEGDYFKPGFSGTIGASAYERVTTDRFAGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGGDLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFIASDQYFQFIQPK
Ga0192945_1020937613300019036MarineMKFFALAAICASTSAIKIEGDYFKPGFSGTIGASAYDREDRMPAHFASDDDDIFMRSMVNNYALEEKTAEDKATGYKGGEPTGKFWMDELAANAAASEVLCTHKAICGADLATYLDSYFSKAWGHFDVNRTGYIEVIKMPQFIRFIASDQYFQFIQPK
Ga0192945_1021531513300019036MarineMKFFALAALCATSTAIKIEGDYFKPGFSGTIGASSYARETTSRFAGDDDDIFMRSMIENFALEEKTGEDKATGYKGGEPSGKFWMDEFAAKAAAQEVLCTHKAICGADLATYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0192945_1023200713300019036MarineMKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALEAKDKDGVPTGAFWVDEFAAKAASSEVLCTHKKICGADLQSYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK
Ga0192886_1030603613300019037MarineYFKAGFSGTIGASAYERVTTANFAGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDEAAAKAAASEVLCTHKGICGGDLSAYLGTYFSKAWGHFDVNRTGFIEVIKMPMFIRFLASDQYFQFIQPK
Ga0193208_1067342813300019055MarineSDSDSSDEEQEYQFVAVDDFFKPGFSGTIGASAYERVITPNFSSDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEAAAKAAASEVLCTHKSICGAELATYLDTYFQKAWGHFDVNRTGTIEVIKMPQFIRFLASDQYF
Ga0188838_11053413300019081Freshwater LakeKFFALAALCATSTTAIQLEGDYFKPGFSGTIGAAAYDRKIPAHFTSDDDDIFMRSMLENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQPK
Ga0188866_102910613300019095Freshwater LakeILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPAHFASDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193153_102696213300019097MarineMKYTLAIAALFATSNAIKLEGDYFKPGFSGVIGASAYERVITPRFEGDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGGDLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193153_102895213300019097MarineGFSGTIGASAYARTTTPRFSGDDDDIFMRSMIENYALEEKTAEDKATGYAGGEPTGKFWMDEAAAKAAASEVLCTHKAICGADLTAYLGTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0192946_104603213300019103MarineMGNKFNGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPANYASDDDDIFMRSMVANYALESKTDEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0192972_109459413300019108MarineFKPGFSGTVGAAAYARVMPERFASDDDDIFMRSMIATYALEAQDKDGAPTGAFWMDKTSATAAAKEVLCTHKKICDAELESYLTSYFSKAWGHFDVNQTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0193243_104534813300019116MarineTMTQGDYFKPGASGAIGSAAYERVTTANFASDDDDIFMRSMIENYALEEKTAEDKKTGYKGGEPTGKFWMDEAAAKAAASEVLCTHKAICGGDLATYLGSYFSKAWGHFDVNRTGFIEVIKMPMFIRFLASDQYFQFIQPK
Ga0193243_105248913300019116MarineASAYDREPRMPAHFASDDDDIFMRSMIENYALESKTAEDKATGYKGGEPTGQFWMDEPAANAAAREVLCTHKAICGGDLDSYMSTYFQKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK
Ga0193243_105368213300019116MarineSNAIKIEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVTKMPMFIRFIASDQYFQFIQPK
Ga0193104_105396013300019125MarineLMTQGDYFKPGFSGTIGAAAYARETTARFSSDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDEAAAKAAAKEVLCTHKAICGGDLDAYLGTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0193436_107430913300019129MarineIGASAYSRVTTPRFSSDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDEAAAKAAASEVLCTHKAICGADLTAYLGTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0192975_1031666813300019153MarineDSESDSSDDEESNVQLAGDYFKPGFSGTVGAAAYARVMPERFASDDDDIFMRSMIATYALEAQDKDGAPTGAFWMDKTSATAAAKEVLCTHKKICDAELESYLTSYFSKAWGHFDVNQTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0182059_118252313300019272Salt MarshMKYTLAIAALFATSNAIKIEGDYFKPGDHGMIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDELAARAAASEVLCTHKAICGADLTTYLNTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0182059_122173813300019272Salt MarshAIKIEGDYFKPGDHGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLATYLSTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0182067_146292613300019276Salt MarshFALAALCATSTSAIKIEGDYFKPGDHGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLATYLSTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0182058_125927213300019283Salt MarshMKFFALAALCATSTSAIKIEGDYFKPGDHGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLATYLSTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQHFQFIQPK
Ga0213861_1047365413300021378SeawaterVQLEGDYFVPGFSGAIGAAAYSRAIPERFSADTDDIFMRSMLNSYALEAKDKDGVPTGAFWFDEFAAKAAASEVLCTHKKICGADLATYLSTYFSKAWGHFDVNRTGYIEAIKMPQLIRFLASDQYFQFMEPK
Ga0213868_1035817713300021389SeawaterQTTYQSAAQLAESDSESDSSDDEEANVQLQGDYFKPGFSGTVGAAAYSRVMPERFASDDDDIFMRSMIAKYALEAQDKDGAPTGAFWMDEFAAKAAASEVLCTHKKICGDELTSYLGTYFSKAWGHFDVNRTGYIEVIKMPMFIRFLASDQYFQFIQPK
Ga0063132_10719513300021872MarineLALIATASAVQLEGDFIQAGFSGTLGASAYARVMPERFSSDDDDIFMRSMIATYALEETDKDGAPVGKFWMDQAQAKAAASEVLCTHKKICGADLDAYLGTYFSKAWGHFDVNQVGKIEVIKMPMFIRFLASDQYFQFIQPK
Ga0063132_10968413300021872MarineLGESESDSDSSDDEEESLLMTQGDYFKPGFSGTIGAAAYARETTARFSSDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDEAAAKAAAKEVLCTHKAICGGDLDAYLGTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0063089_103506213300021889MarineMKYAFAIAALCATSNAIQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQPK
Ga0063133_101786213300021912MarineKFFALAALCATSTAIKIEGDYFKPGFSGTIGASAYARETTARFAGDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0063133_102331013300021912MarineARPPYQSAALLGESESDSDSSDDEEESLLMTQGDYFKPGFSGTIGASAYARETTARFSSDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPSGKFWMDEAAAKAAAKEVLCTHKAICGGDLDAYLGTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0063085_102144913300021924MarineKFFALAALCATSTTAIKVEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK
Ga0063145_105085013300021930MarineNNLKKMKYTLAIAALFATSNAIKIEGDYFKPGFSGTIGAAAYERVTTDRFAGDDDDIFMRSMIETYALEEKTAEDKKTGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGGDLTTYLDTYFSKAWGHFDVNRTGFIEVIKMPQFIRFLASDQYFQFIQPK
Ga0063872_103266213300021932MarineALCATSTTAIKVEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK
Ga0063102_102629513300021941MarineMKYAFAIAALCATSNAIQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTKEDKAIKYDGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFMRFLASDQYFQFIQPK
Ga0063755_102426313300021954MarineLCATSTTAIKVEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK
Ga0255743_1035541113300023110Salt MarshMKSTIALFLGVAAAFSSSSSGSDNEMIQLSGDYFVPGDSGMIGAKAYERVTPARFASDNDDIFMRSMIENYALEEKTKEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLATYLSTYFQKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0209405_111398123300025620Pelagic MarineDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLATYLSSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK
Ga0209716_111562213300025626Pelagic MarineMKFFALAALCATSTTAIKVEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLENYALEEKTEEDKAIKYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK
Ga0209715_118239423300025699Pelagic MarineSAMQMRESDSESDSSDEEENVQLAGDYFKPGFTGTIGASAYSRTTPERFSSDDDDIFMRSMIQTYALEAQTADGAPSGAFWMDKAAAEAAAKEVLCTHKKICGEELTSYLATYLSKAWGHFDVNQTGYIEVIKMP
Ga0209305_112346413300025712Pelagic MarineCRAINFYNKFNGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPAHFASDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0209309_1040335513300025881Pelagic MarineMIKGRAINFYNKFNGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPAHFASDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEV
Ga0247571_112158813300026495SeawaterRAINFYNKFNGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPANYVSDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0209712_1043361813300027849MarineMKFFALAALCATSTTAIQLEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYVEVTKMPMFMRFLASDQYFQFIQPK
Ga0256412_116679513300028137SeawaterMIKGRAINFYNKFNGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRVPANYVSDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0256412_129011113300028137SeawaterKFFALAAICASTSAIKIEGDYFKPGFSGTIGASAYDREDRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYIEVTKMPQFIRFIASDQYFQFIQPK
Ga0256412_136182913300028137SeawaterKMKYTLAIAALFDTSNAIKLKGDYFNPGSSGMIGSKAYERVTTANFAGDDDDIFMRSMIETYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLTTYLDTYFQKAWGHFDVNRTGTIEVIKMPQFIRFLASDQYFQFIQPK
Ga0256412_139260913300028137SeawaterLKMKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALESKDKEGAPTGAFWVDEFAAKAASSEVLCTHKKICGADLQAYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK
Ga0256413_119607113300028282SeawaterLVLIKCRAINFYNKFNGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRIPANYVSDDDDIFMRSMVENYALEAKTEEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIIPRLRPILPIHPTKVSVKV
Ga0256413_129553113300028282SeawaterMKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALESKDKEGAPTGAFWVDEFAAKAASSEVLCTHKKICGADLQAYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFIQPK
Ga0247572_117709913300028290SeawaterMKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALESKDKEGAPTGAFWVDEFAAKAASSEVLCTHKKICGADLQAYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK
Ga0257128_111745613300028672MarineGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENFALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGGDLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFMRFLASDQYFQFIQPK
Ga0308127_103986513300030715MarineMKYAFAIAALCATSNAIKIEGDYFKPGFSGTVGASAYDREPRMPAHFASDDDDIFMRSMIENFALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAASQEVLCTHKAICGADLATYLDSYFQKAWGHFDVNRTGYIEVIKMPSFIRFLASDQYFQFIQPK
Ga0308129_103055713300030723MarineMKYAFAIAALCATSNAIKIEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENFALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAASQEVLCTHKAICGADLATYLDSYFQKAWGHFDVNRTGYIEVIKMPQFIRFLSSDQYFQFIQPK
Ga0308131_112955613300030729MarineSTTAIKIEGDYFKPGFSGTVGASAYDREPRMPAHFASDDDDIFMRSMIENFALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAASQEVLCTHKAICGADLATYLDSYFQKAWGHFDVNRTGYIEVIKMPQFIRFLSSDQYFQFIQPK
Ga0073944_1140123713300030956MarineKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALESKTAEDKATGYKGGEPTGQFWMDEPAANAAAREVLCTHKAICGGDLDSYMSTYFQKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK
Ga0073979_1000876713300031037MarineGILLNNLKKMKYTLAIAALFATSNAIKIENQDYFKPGFSGTIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKKTGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLTTYLDTYFQKAWGHFDVNRTGYIEVIKMPQFIRFIASDQYFQFIQPK
Ga0307388_1095155213300031522MarineGILLNNLKKMKYTLAIAALFATSNAIKVEGDYFKPGFSGTIGASAYDREDRIPANYVSDDDDIFMRSMVENYALEAKTEEDKAIKYKGGEPTGKFWMDEFAAKAAAQEVLCTHKAICGADLTTYLDTYFSKAWGHFDVNRTGYIEVIKMPQFIRFLASDQYFQFIQPK
Ga0302116_111506323300031597MarineMKFFALAALCATSTTAIKIEGDYFKPGFSGTVGASAYDREPRMPAHFASDDDDIFMRSMIENFALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAAQEVLCTHKSICGGDLATYLDSYFQKAWGHFDVNRTGYIEVIKMPSFIRFLASDQYFQFIQPK
Ga0302114_1021571423300031621MarineMKYAFAIAALCATSNAIKIEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENFALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAASQEVLCTHKAICGADLATYLDSYFQKAWGHFDVNRTGYIEVIKMPSFIRFLASDQYFQFIQPK
Ga0302114_1023894713300031621MarineMKFFALAALCATSTTAIKIEGDYFKPGFSGTVGASAYDREPRMPAHFASDDDDIFMRSMIENFALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAASQEVLCTHKAICGADLATYLDSYFQKAWGHFDVNRTGYIEVIKMPQFIRFLSSDQYFQFIQPK
Ga0302125_1020470713300031638MarineLAGDYFVPGFSGAIGAAAYARATPERFSADTDDIFMRSMINNFALEAKDKDGLPTGAFWVDEFAAKAAASEVLCTHKKICGDELATYLSTYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK
Ga0307381_1032323013300031725MarineAAICASTSAIKIEGDYFKPGFSGTIGASAYDREDRMPAHFASDDDDIFMRSMIANYALEEKTAEDKATGYKGGEPTGKFWMDELAANAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYIEVTKMPMFIRFLASDQYFQFIQPK
Ga0314684_1040122413300032463SeawaterMKYAFAIAALCATSNAIQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQPK
Ga0314684_1070877813300032463SeawaterKFFALAALCATSTTAIQLEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLNNYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYVEVTKMPMFMRFLASDQYFQFIQPK
Ga0314684_1086926213300032463SeawaterKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALEAKDKDGVPTGAFWVDEFAAKAASSEVLCTHKKICGADLQSYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYLQFMDPKCVYF
Ga0314668_1031896713300032481SeawaterMTQGDYFKPGFSGAIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQPK
Ga0314679_1021250513300032492SeawaterMKYAFAIAALCATSNAIQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDELAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQPK
Ga0314688_1078223613300032517SeawaterMKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALEAKDKLGVPTGAFWVDEFAAKAASSEVLCTHKKICGAELQAYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK
Ga0314676_1076926013300032519SeawaterMKYAFAIAALCATSNAIQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQ
Ga0314676_1087027913300032519SeawaterLKMKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALEAKDKDGVPTGAFWVDEFAAKAASSEVLCTHKKICGADLQSYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK
Ga0314677_1018525923300032522SeawaterMTQGDYFKPGFSGAIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKATGYKGGEPTGKFWMDESAAKAAASEVLCTHKAICGGDLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQ
Ga0314674_1042404113300032615SeawaterMTQGDYFKPGFSGAIGASAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTEEDKATGYKGGEPTGKFWMDESAAKAAASEVLCTHKAICGGDLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQ
Ga0314674_1042611013300032615SeawaterMKFFALAALCATSTTAIQLEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLNNYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYVEVTKMPMFMRFLASDQYFQFIQPK
Ga0314669_1040650313300032708SeawaterQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQPK
Ga0314672_133664313300032709SeawaterMKYAFAIAALCATSNAIQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLA
Ga0314672_133706813300032709SeawaterFFALAALCATSTTAIQLEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLNNYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYVEVTKMPMFMRFLASDQYFQFIQPK
Ga0314690_1059501913300032713SeawaterKFFALAALCATSTTAIQLEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYVEVTKMPMFMRFLASDQYFQFIQPK
Ga0314703_1046852413300032723SeawaterFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALEAKDKLGVPTGAFWVDEFAAKAASSEVLCTHKKICGAELQAYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFMEPK
Ga0314695_125188213300032724SeawaterLKMKFFALAALCATSTTAIQLEGDYFKPGFSGTIGAAAYDREDRIPAHFTSDDDDIFMRSMLNNYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYVEVTKMPMFMRFLASDQYFQFIQPK
Ga0314695_130341413300032724SeawaterKMKYAFAIAALCATSNAIQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQPK
Ga0314711_1065870513300032732SeawaterMKYAFAIAALCATSNAIQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTG
Ga0314710_1038568013300032742SeawaterKMKFFALAALCATSTTAIQLEGDYFKPGFSGTIGAAAYDREDSIPAHFTSDDDDIFMRSMLENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLGSYFSKAWGHFDVNRTGYVEVTKMPMFMRFLASDQYFQFIQPK
Ga0314710_1048482813300032742SeawaterMKFAFAALIATASAINVEKADYFIPGDAGTIGAAAYSRTTPERFATDNDDIFMRSMIENYALEAKDKLGVPTGAFWVDEFAAKAASSEVLCTHKKICGADLQTYLDQYFSKAWGHFDVNRTGYVEVIKMPQLIRFLASDQYFQFIQPK
Ga0314713_1024102013300032748SeawaterCATSNAIQVEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQPK
Ga0314692_1036923313300032754SeawaterFALAALCATSTTAIQLEGDYFKPGFSGTIGAAAYDREPRMPAHFASDDDDIFMRSMIENYALEEKTAEDKATGYKGGEPTGKFWMDEFAAKAAASEVLCTHKAICGADLATYLSSYFSKAWGHFDVNRTGYVEVTKMPMFIRFLASDQYFQFIQPK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.