Metagenome / Metatranscriptome Family F034608

Basic Information
Family ID	F034608
Family Type	Metagenome / Metatranscriptome
Number of Sequences	174
Average Sequence Length	43 residues
Representative Sequence	VTKLLIILLFGGALANSLASANSEPPLLIDSQPAPASLDASN
Number of Associated Samples	122
Number of Associated Scaffolds	174

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	16.86 %
% of genes near scaffold ends (potentially truncated)	22.41 %
% of genes from short scaffolds (< 2000 bps)	79.31 %
Associated GOLD sequencing projects	96
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Bacteria (90.805 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (15.517 % of family members)
Environment Ontology (ENVO)	Unclassified (54.598 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (67.816 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 28.57% β-sheet: 0.00% Coil/Unstructured: 71.43%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 174 Family Scaffolds
PF04551	GcpE	39.66
PF00892	EamA	33.33
PF07077	DUF1345	9.20
PF01425	Amidase	2.30
PF13650	Asp_protease_2	1.15
PF08937	DUF1863	1.15
PF13374	TPR_10	0.57
PF13676	TIR_2	0.57
PF12697	Abhydrolase_6	0.57
PF00893	Multi_Drug_Res	0.57
PF05299	Peptidase_M61	0.57
PF04343	DUF488	0.57
PF13975	gag-asp_proteas	0.57
PF04339	FemAB_like	0.57

COG ID	Name	Functional Category	% Frequency in 174 Family Scaffolds
COG0821	4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE	Lipid transport and metabolism [I]	39.66
COG4291	Uncharacterized membrane protein	Function unknown [S]	9.20
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	2.30
COG0308	Aminopeptidase N, contains DUF3458 domain	Amino acid transport and metabolism [E]	0.57
COG2076	Multidrug transporter EmrE and related cation transporters	Defense mechanisms [V]	0.57
COG3146	Predicted N-acyltransferase	General function prediction only [R]	0.57
COG3189	Uncharacterized conserved protein YeaO, DUF488 family	Function unknown [S]	0.57
COG3975	Predicted metalloprotease, contains C-terminal PDZ domain	General function prediction only [R]	0.57

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	90.80 %
Unclassified	root	N/A	9.20 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	90.80 %
Unclassified	root	N/A	9.20 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	90.80 %
Unclassified	root	N/A	9.20 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	90.80 %
Unclassified	root	N/A	9.20 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	90.23 %
Unclassified	root	N/A	9.20 %

Name	Rank	Taxonomy	Distribution
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	79.31 %
Unclassified	root	N/A	9.20 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	4.02 %
Caulobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales	4.02 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.57 %

Name	Rank	Taxonomy	Distribution
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	78.74 %
Unclassified	root	N/A	9.20 %
unclassified Caulobacterales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales	4.02 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	4.02 %
Azospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae	0.57 %

Name	Rank	Taxonomy	Distribution
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	74.14 %
Unclassified	root	N/A	9.20 %
Caulobacterales bacterium 32-67-6	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	4.02 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	4.02 %
Azospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum	0.57 %

Name	Rank	Taxonomy	Distribution
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	24.14 %
Sphingomonas segetis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	12.07 %
Unclassified	root	N/A	9.20 %
Caulobacterales bacterium 32-67-6	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	4.02 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	4.02 %
Azospirillum thermophilum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum thermophilum	0.57 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples	0.57 %

Name	Rank	Taxonomy	Distribution
Sphingomonas segetis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	12.07 %
Sphingomonas sp. URHD0007	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	10.92 %
Unclassified	root	N/A	9.20 %
Sphingomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	6.90 %
Sphingomonas sp. URHD0057	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	6.32 %
Caulobacterales bacterium 32-67-6	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	4.02 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	4.02 %
uncultured Sphingomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples → uncultured Sphingomonas sp.	0.57 %
Azospirillum thermophilum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum thermophilum	0.57 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908016\|OU_2_1_1_newblercontig03737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	903	Open in IMG/M
2228664022\|INPgaii200_c0735795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	738	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101470223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1072	Open in IMG/M
3300001979\|JGI24740J21852_10007234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	4525	Open in IMG/M
3300003323\|rootH1_10026065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1955	Open in IMG/M
3300004081\|Ga0063454_101602316	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	562	Open in IMG/M
3300004114\|Ga0062593_100150079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1766	Open in IMG/M
3300004114\|Ga0062593_101196442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	797	Open in IMG/M
3300004479\|Ga0062595_100324578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1054	Open in IMG/M
3300004479\|Ga0062595_101073458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	701	Open in IMG/M
3300005093\|Ga0062594_100543891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	998	Open in IMG/M
3300005165\|Ga0066869_10040907	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	785	Open in IMG/M
3300005168\|Ga0066809_10143904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	614	Open in IMG/M
3300005290\|Ga0065712_10617267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	583	Open in IMG/M
3300005327\|Ga0070658_10010869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	7299	Open in IMG/M
3300005327\|Ga0070658_10471812	Not Available	1082	Open in IMG/M
3300005327\|Ga0070658_10506791	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1043	Open in IMG/M
3300005327\|Ga0070658_10620127	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	938	Open in IMG/M
3300005327\|Ga0070658_11319871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	626	Open in IMG/M
3300005327\|Ga0070658_11564303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	571	Open in IMG/M
3300005329\|Ga0070683_100264071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	1638	Open in IMG/M
3300005331\|Ga0070670_100534865	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	1044	Open in IMG/M
3300005335\|Ga0070666_10004402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	8579	Open in IMG/M
3300005335\|Ga0070666_10316767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1112	Open in IMG/M
3300005336\|Ga0070680_100202776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1673	Open in IMG/M
3300005339\|Ga0070660_101305915	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	616	Open in IMG/M
3300005344\|Ga0070661_100104378	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2111	Open in IMG/M
3300005354\|Ga0070675_101201217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	698	Open in IMG/M
3300005355\|Ga0070671_100008840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	8083	Open in IMG/M
3300005355\|Ga0070671_100016044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	6053	Open in IMG/M
3300005355\|Ga0070671_100058291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3215	Open in IMG/M
3300005355\|Ga0070671_101009923	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	729	Open in IMG/M
3300005355\|Ga0070671_101774654	Not Available	548	Open in IMG/M
3300005364\|Ga0070673_102367661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	505	Open in IMG/M
3300005367\|Ga0070667_100360338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	1318	Open in IMG/M
3300005435\|Ga0070714_100047169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	3659	Open in IMG/M
3300005435\|Ga0070714_100068115	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3070	Open in IMG/M
3300005435\|Ga0070714_100854584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	882	Open in IMG/M
3300005436\|Ga0070713_100122390	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2284	Open in IMG/M
3300005436\|Ga0070713_100152499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2057	Open in IMG/M
3300005455\|Ga0070663_100057309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	2795	Open in IMG/M
3300005455\|Ga0070663_100455913	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1055	Open in IMG/M
3300005455\|Ga0070663_100747298	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	835	Open in IMG/M
3300005457\|Ga0070662_100309441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1286	Open in IMG/M
3300005457\|Ga0070662_101253901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	638	Open in IMG/M
3300005458\|Ga0070681_10639379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	979	Open in IMG/M
3300005529\|Ga0070741_10077134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	3697	Open in IMG/M
3300005530\|Ga0070679_100818026	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	875	Open in IMG/M
3300005532\|Ga0070739_10014011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	7219	Open in IMG/M
3300005544\|Ga0070686_101666235	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	541	Open in IMG/M
3300005546\|Ga0070696_100145960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	1733	Open in IMG/M
3300005563\|Ga0068855_101088600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	836	Open in IMG/M
3300005564\|Ga0070664_101562851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	625	Open in IMG/M
3300005568\|Ga0066703_10265482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1041	Open in IMG/M
3300005574\|Ga0066694_10301956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	762	Open in IMG/M
3300005578\|Ga0068854_102078958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	524	Open in IMG/M
3300005614\|Ga0068856_100632447	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1091	Open in IMG/M
3300005614\|Ga0068856_100956697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	875	Open in IMG/M
3300005616\|Ga0068852_100372254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1400	Open in IMG/M
3300005618\|Ga0068864_101656367	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	644	Open in IMG/M
3300005764\|Ga0066903_100818645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1669	Open in IMG/M
3300005841\|Ga0068863_100036522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	4681	Open in IMG/M
3300005843\|Ga0068860_102273122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	563	Open in IMG/M
3300005844\|Ga0068862_101821970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	618	Open in IMG/M
3300006237\|Ga0097621_100807969	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	869	Open in IMG/M
3300006358\|Ga0068871_100180250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	1815	Open in IMG/M
3300006880\|Ga0075429_100457276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1119	Open in IMG/M
3300006880\|Ga0075429_100746020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	858	Open in IMG/M
3300006893\|Ga0073928_10370240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1056	Open in IMG/M
3300006954\|Ga0079219_11021062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	689	Open in IMG/M
3300009093\|Ga0105240_10574271	Not Available	1245	Open in IMG/M
3300009174\|Ga0105241_12171585	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	550	Open in IMG/M
3300009176\|Ga0105242_12671549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	549	Open in IMG/M
3300009177\|Ga0105248_10121456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	2947	Open in IMG/M
3300009545\|Ga0105237_11925780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	599	Open in IMG/M
3300010039\|Ga0126309_10739370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	636	Open in IMG/M
3300010042\|Ga0126314_10594880	Not Available	807	Open in IMG/M
3300010373\|Ga0134128_10079622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3742	Open in IMG/M
3300010373\|Ga0134128_12775358	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	540	Open in IMG/M
3300010375\|Ga0105239_10211166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2176	Open in IMG/M
3300010397\|Ga0134124_10831897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	925	Open in IMG/M
3300012212\|Ga0150985_120299606	Not Available	762	Open in IMG/M
3300012960\|Ga0164301_11046605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum thermophilum	645	Open in IMG/M
3300013100\|Ga0157373_10321932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1100	Open in IMG/M
3300013105\|Ga0157369_10006184	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	13896	Open in IMG/M
3300013105\|Ga0157369_10898941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	908	Open in IMG/M
3300013105\|Ga0157369_12022555	Not Available	584	Open in IMG/M
3300013296\|Ga0157374_10198721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1963	Open in IMG/M
3300015372\|Ga0132256_102431742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	626	Open in IMG/M
3300015373\|Ga0132257_103491108	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	572	Open in IMG/M
3300015374\|Ga0132255_105680624	Not Available	528	Open in IMG/M
3300018433\|Ga0066667_10403666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1105	Open in IMG/M
3300018468\|Ga0066662_10857486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	888	Open in IMG/M
3300018476\|Ga0190274_10556275	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1163	Open in IMG/M
3300018920\|Ga0190273_10154851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1375	Open in IMG/M
3300020069\|Ga0197907_10322507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	934	Open in IMG/M
3300020082\|Ga0206353_11165868	Not Available	858	Open in IMG/M
3300020082\|Ga0206353_11536035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	510	Open in IMG/M
3300021363\|Ga0193699_10445485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	533	Open in IMG/M
3300021445\|Ga0182009_10084632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1419	Open in IMG/M
3300021445\|Ga0182009_10118851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1226	Open in IMG/M
3300021445\|Ga0182009_10141305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1137	Open in IMG/M
3300025321\|Ga0207656_10082672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1446	Open in IMG/M
3300025321\|Ga0207656_10191291	Not Available	985	Open in IMG/M
3300025903\|Ga0207680_10567535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	811	Open in IMG/M
3300025904\|Ga0207647_10225268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1080	Open in IMG/M
3300025904\|Ga0207647_10256750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	1001	Open in IMG/M
3300025904\|Ga0207647_10368804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	812	Open in IMG/M
3300025904\|Ga0207647_10392788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	782	Open in IMG/M
3300025909\|Ga0207705_10047500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3087	Open in IMG/M
3300025909\|Ga0207705_10462924	All Organisms → cellular organisms → Bacteria → Proteobacteria	984	Open in IMG/M
3300025911\|Ga0207654_10564831	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	809	Open in IMG/M
3300025917\|Ga0207660_10271323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1344	Open in IMG/M
3300025919\|Ga0207657_10026544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	5320	Open in IMG/M
3300025919\|Ga0207657_10659921	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	814	Open in IMG/M
3300025919\|Ga0207657_10736706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	764	Open in IMG/M
3300025919\|Ga0207657_10806758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	725	Open in IMG/M
3300025920\|Ga0207649_10740673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	764	Open in IMG/M
3300025920\|Ga0207649_11356702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	562	Open in IMG/M
3300025923\|Ga0207681_11487017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	568	Open in IMG/M
3300025925\|Ga0207650_11333362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	611	Open in IMG/M
3300025928\|Ga0207700_10084776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2485	Open in IMG/M
3300025929\|Ga0207664_10167332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1879	Open in IMG/M
3300025929\|Ga0207664_11153074	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	692	Open in IMG/M
3300025930\|Ga0207701_10161990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1979	Open in IMG/M
3300025930\|Ga0207701_11401903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	569	Open in IMG/M
3300025931\|Ga0207644_10028106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3889	Open in IMG/M
3300025931\|Ga0207644_10404389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1116	Open in IMG/M
3300025931\|Ga0207644_11702581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	528	Open in IMG/M
3300025932\|Ga0207690_10018740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	4248	Open in IMG/M
3300025932\|Ga0207690_11137107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	651	Open in IMG/M
3300025933\|Ga0207706_11151344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	646	Open in IMG/M
3300025934\|Ga0207686_10308023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1179	Open in IMG/M
3300025941\|Ga0207711_10402182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1272	Open in IMG/M
3300025944\|Ga0207661_11568183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	603	Open in IMG/M
3300025945\|Ga0207679_10109106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2180	Open in IMG/M
3300025949\|Ga0207667_10138590	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2505	Open in IMG/M
3300025960\|Ga0207651_11423508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	624	Open in IMG/M
3300025972\|Ga0207668_12021029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples → uncultured Sphingomonas sp.	519	Open in IMG/M
3300026067\|Ga0207678_10051206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	3565	Open in IMG/M
3300026078\|Ga0207702_10574442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1105	Open in IMG/M
3300026088\|Ga0207641_10035577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	4150	Open in IMG/M
3300026121\|Ga0207683_11770834	Not Available	567	Open in IMG/M
3300026142\|Ga0207698_10733799	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	985	Open in IMG/M
3300026527\|Ga0209059_1079233	Not Available	1395	Open in IMG/M
3300027766\|Ga0209796_10005465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	4238	Open in IMG/M
3300027766\|Ga0209796_10014549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2411	Open in IMG/M
3300027766\|Ga0209796_10055211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1197	Open in IMG/M
3300027773\|Ga0209810_1044498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2408	Open in IMG/M
3300027775\|Ga0209177_10267346	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	638	Open in IMG/M
3300027880\|Ga0209481_10476998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	643	Open in IMG/M
3300028380\|Ga0268265_11798601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	619	Open in IMG/M
3300031231\|Ga0170824_128319032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16	978	Open in IMG/M
3300031548\|Ga0307408_100537867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1029	Open in IMG/M
3300031548\|Ga0307408_100628372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	957	Open in IMG/M
3300031731\|Ga0307405_10016814	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3998	Open in IMG/M
3300031852\|Ga0307410_11789318	Not Available	545	Open in IMG/M
3300031901\|Ga0307406_10083836	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2126	Open in IMG/M
3300031903\|Ga0307407_10828762	Not Available	705	Open in IMG/M
3300031903\|Ga0307407_11429197	Not Available	545	Open in IMG/M
3300031938\|Ga0308175_100021750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	5134	Open in IMG/M
3300031938\|Ga0308175_100651991	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1138	Open in IMG/M
3300031938\|Ga0308175_102008236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	648	Open in IMG/M
3300031938\|Ga0308175_102329685	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	600	Open in IMG/M
3300031939\|Ga0308174_10173752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1624	Open in IMG/M
3300031996\|Ga0308176_10217169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1810	Open in IMG/M
3300031996\|Ga0308176_10510880	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1221	Open in IMG/M
3300031996\|Ga0308176_11689173	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	675	Open in IMG/M
3300032074\|Ga0308173_10251926	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1496	Open in IMG/M
3300032074\|Ga0308173_11796833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	578	Open in IMG/M
3300032074\|Ga0308173_12150612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	526	Open in IMG/M
3300032080\|Ga0326721_10132591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1240	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	59.20%
Environmental	Environmental	40.80%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	59.20%
Terrestrial	Environmental → Terrestrial	39.66%
Aquatic	Environmental → Aquatic	0.57%
Unclassified	Environmental → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	40.80%
Soil	Environmental → Terrestrial → Soil	39.66%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.94%
Phylloplane	Host-Associated → Plants → Phylloplane	1.72%
Roots	Host-Associated → Plants → Roots	1.15%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.57%
Unclassified	Environmental → Unclassified → Unclassified	0.57%
Rhizome	Host-Associated → Plants → Rhizome	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	29.31%
Soil	Host-Associated → Plants → Rhizosphere → Soil	27.01%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.79%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.07%
Loam	Environmental → Terrestrial → Soil → Loam	10.34%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.30%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	1.72%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.15%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.57%
Unclassified	Environmental → Unclassified → Unclassified → Unclassified	0.57%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.57%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	27.01%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.79%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	12.07%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.07%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.20%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	6.90%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.17%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.30%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	1.72%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.15%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.57%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.57%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.57%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.57%
Unclassified	Environmental → Unclassified → Unclassified → Unclassified → Unclassified	0.57%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.57%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	15.52%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	10.34%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	8.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	6.90%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	4.02%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.87%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	2.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.87%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.30%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.30%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.72%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.72%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.72%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.72%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.72%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	1.72%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.15%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.15%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	1.15%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.15%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.15%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.15%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.15%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.57%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.57%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.57%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.57%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.57%
	Environmental → Unclassified → Unclassified → Unclassified → Unclassified →	0.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.57%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.57%
Sugarcane Root And Bulk Soil	Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil	0.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.57%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.57%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908016	Sample 642	Environmental	Open in IMG/M
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Host-Associated	Open in IMG/M
3300003323	Sugarcane root Sample H1	Host-Associated	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005165	Soil and rhizosphere microbial communities from Laval, Canada - mgHMC	Environmental	Open in IMG/M
3300005168	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005532	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026527	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)	Environmental	Open in IMG/M
3300027766	Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)	Host-Associated	Open in IMG/M
3300027773	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032080	Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F034608

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
OU_01349480	2124908016		LPAHDGAVTKLLFILFLGGALANGLAATHSEPPMLIDSAPTSLDAQN
INPgaii200_07357952	2228664022	Soil	ILILGGALANSLANARSEPPLLIDSQPSPPSLDAAN
INPhiseqgaiiFebDRAFT_1014702231	3300000364	Soil	LLLILILGGALANSLANARSEPPLLIDSQPSPPSLDAAN*
JGI24740J21852_100072345	3300001979	Corn Rhizosphere	VIKLLLILALGGALANGVAKSQEQPPLLIDNASSPAP
rootH1_100260653	3300003323	Sugarcane Root And Bulk Soil	VIKLLIILLFGGALANSLASASSEPPLLIDSQPSPAALDASR*
Ga0063454_1016023162	3300004081	Soil	VTKLLLILILGGVLANGLARSHEAPPLLIDDTPAPFAASK*
Ga0062593_1001500792	3300004114	Soil	VTKLLLIVLFGVVANALASPSEPPLLIDSQPAPTALDANN*
Ga0062593_1011964422	3300004114	Soil	LWAQLGAVTKLLLILLFSGALANALASQKEPPLLIDSQPAPTSLDASN*
Ga0062595_1003245781	3300004479	Soil	AAHKGAVTKLLLILFLGGALANGLAATHTDPPLLIDPAPASLDAQN*
Ga0062595_1010734582	3300004479	Soil	LWAQLRAVTKLLLILILGGALANSLASANSQPPLLIDSQPSPPSLDANN*
Ga0062594_1005438912	3300005093	Soil	VTKLLLILLVGGVLANGLAKSHSEPPLLIDSAPAGTSLDASK*
Ga0066869_100409072	3300005165	Soil	VTKLLLILILGGALANSLASSHSKPPLLIDSQPSPPSLDAAN*
Ga0066809_101439041	3300005168	Soil	VTKLLLILLFSGALVNALEANKQPPLLIDSQPSPVTLDASN*
Ga0065712_106172672	3300005290	Miscanthus Rhizosphere	LAVHHGTVTKLLLILLFGGALANALESPSEPPLLIDSQATSASLDAQN*
Ga0070658_100108692	3300005327	Corn Rhizosphere	VTKLLLILLASTALAASVAPKAEPPLLIDSQPSQPSLDANR*
Ga0070658_104718122	3300005327	Corn Rhizosphere	LSAQLGRVIKLLLILMLGGALANGVAKSQEQPPLLIDNASSPAPLDAAN*
Ga0070658_105067912	3300005327	Corn Rhizosphere	VTKLLLILLFGGALANGVARSQEQPPLLIDSQPSPTSLDANS*
Ga0070658_106201272	3300005327	Corn Rhizosphere	LAAHKGAVTKLLLILFLGGALANGLAATHTDPPLLIDPAPASLDAQN*
Ga0070658_113198712	3300005327	Corn Rhizosphere	LSAQHRAVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDGNS*
Ga0070658_115643032	3300005327	Corn Rhizosphere	LSAQHRAVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS*
Ga0070683_1002640711	3300005329	Corn Rhizosphere	PFFTLSAQHRAVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS*
Ga0070670_1005348652	3300005331	Switchgrass Rhizosphere	VTKLLLILILGGVLANGIAKSHEQPPLLIESQPSALDEGK*
Ga0070666_100044022	3300005335	Switchgrass Rhizosphere	VTKLLLILILGGALANSLASANSQPPLLIDSQPSPPSLDANN*
Ga0070666_103167672	3300005335	Switchgrass Rhizosphere	AQPRAVTKLLLILILGGALANSLASANSQPPLLIDSQPSPPSLDANN*
Ga0070680_1002027762	3300005336	Corn Rhizosphere	MAKLFLILMLGGALANGLVASKSEPPLLIDSPTSAAPLDAAH*
Ga0070660_1013059152	3300005339	Corn Rhizosphere	LSAQLGAVTKLLLILLASTALAESVAPKAEPPLLIDSQPSQPSLDADR*
Ga0070661_1001043783	3300005344	Corn Rhizosphere	VIKLLLILALGGALANGVAKSQEQPPLLIDNASSPAPLDAAN*
Ga0070675_1012012171	3300005354	Miscanthus Rhizosphere	VTKLLLILILGGVLANGIAKSNEQPPLLIESQPSALDEGK*
Ga0070671_1000088406	3300005355	Switchgrass Rhizosphere	VAKLLLILFLGGALVNSLASARAEPPLLIDSQAAPASLDANG*
Ga0070671_1000160444	3300005355	Switchgrass Rhizosphere	LAAHKCAVTKLLLILFLGGALANGLAATHTDPPLLIDPAPASLDAQN*
Ga0070671_1000582913	3300005355	Switchgrass Rhizosphere	VTKLLLILLVGGALANGLARSHSEPPLLIDSAPVGASLDASK*
Ga0070671_1010099232	3300005355	Switchgrass Rhizosphere	VTKLLLIFLFGLMANALATPAEPPLLIDSQPASASLDASN*
Ga0070671_1017746541	3300005355	Switchgrass Rhizosphere	LWAQLWPVTKLLIILLLGGALTNELARSHSEPPLLIDSQPSPTSLDASN*
Ga0070673_1023676612	3300005364	Switchgrass Rhizosphere	VTKLLLILLVGGALANSLAARSEPPLLIDTQPAPASLDAAD*
Ga0070667_1003603383	3300005367	Switchgrass Rhizosphere	LPAQHGAVVKLLIILLFGGVLANSLASAQSEPPLLIDSQPASAALDANP*
Ga0070714_1000471692	3300005435	Agricultural Soil	VTKLLLILFLGGALANGVARSQEQPPLLIDSQPSSASLDANG*
Ga0070714_1000681153	3300005435	Agricultural Soil	VTKLLLILLLGGAVANGVARSHEQPPLMIDSQPSPAGLDANS*
Ga0070714_1008545842	3300005435	Agricultural Soil	VTKLLLILLASTALAESVAPKAEPPLLIDSSPSTLDAGK*
Ga0070713_1001223902	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	VTKLFIILLFGTALADSVAPKAQPPLLIDSQPSQPSLDAAR*
Ga0070713_1001524993	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	LAAHKSAVTKLLLILFLVGALANGLAAAHSEPPLLIDPAPASLDAPN*
Ga0070663_1000573091	3300005455	Corn Rhizosphere	TKLLLILLASTALAESVAPKAEPPLLIDSQPSQPSLDADR*
Ga0070663_1004559132	3300005455	Corn Rhizosphere	FFTLPAQHGAVVKLLIILLFGGVLANSLASAQSEPPLLIDSQPASAALDANP*
Ga0070663_1007472982	3300005455	Corn Rhizosphere	VTKLLLILALSGALASGLGATSEPPLLIDNSPAPASLDANG*
Ga0070662_1003094412	3300005457	Corn Rhizosphere	LSAQHRAVFKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS*
Ga0070662_1012539012	3300005457	Corn Rhizosphere	VTKLLLILLIGTALANGLAQSQAEPPLLIDSAPSPTTAAN*
Ga0070681_106393792	3300005458	Corn Rhizosphere	MAKLFLILMLGGALANGLVASKSEPPLLIDSPTSPAPLDAAH*
Ga0070741_100771343	3300005529	Surface Soil	VTKLLLILLLGGALANGVAKSHEQPPLLIDNASSPAPLDAGN*
Ga0070679_1008180262	3300005530	Corn Rhizosphere	GRVIKLLLILMLGGALANGVAKSQEQPPLLIDNASSPAPLDAAN*
Ga0070739_100140118	3300005532	Surface Soil	VAKLLLILLFGGALANGLAASHSEPPLLIDSSPAAAHLDAQS*
Ga0070686_1016662352	3300005544	Switchgrass Rhizosphere	VKLLIILLFGGVLANSLASAQSEPPLLIDSQPASAALDANP*
Ga0070696_1001459602	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	LRHGEAVPDLILGGALANGFAASNSEPPLLIDSPVSAAPLDAAN*
Ga0068855_1010886002	3300005563	Corn Rhizosphere	VQPGRVTKLLLILLLGGALANGVARSKEQPPLLIDNASSPAPLDAGN*
Ga0070664_1015628512	3300005564	Corn Rhizosphere	LPAQDCAVTKLLLILLFGGALANGLAAPHSEPPLLIDPAPTSLDAQN*
Ga0066703_102654821	3300005568	Soil	VTKLLIMLAAFVALASGLAKAQSEPPLLIDSQPAPPSLDASN*
Ga0066694_103019561	3300005574	Soil	MIAPVIKLLVILALGGALANGFATAHSEPPLLIDSAPAALDAPR*
Ga0068854_1020789582	3300005578	Corn Rhizosphere	VIKLLLILILGGALANGLAPSRSQPPLLIDNLSAPAPLDEAD*
Ga0068856_1006324472	3300005614	Corn Rhizosphere	VTKLLLILLASTALAESLAPKAEPPLLIDSQPSQPSLDANQ*
Ga0068856_1009566972	3300005614	Corn Rhizosphere	VIKLLLIIAAAGALANSLAPKAEPPLLIDSQPAPASLDADR*
Ga0068852_1003722542	3300005616	Corn Rhizosphere	LSAQHRAVTKLLIILLFGGALAKSLAPPPLLIDAQPAPAPLDATN*
Ga0068864_1016563672	3300005618	Switchgrass Rhizosphere	VTKLLIILLFSGALLNSLAAPSEPPLLIDSPASLDASR*
Ga0066903_1008186452	3300005764	Tropical Forest Soil	MIKLLLILILGGALANGLAASHSEPPLLIDSQPAPASLDVNG*
Ga0068863_1000365223	3300005841	Switchgrass Rhizosphere	VTKLLLILILGGALANGIAKSHEQPPLLIESQPSALDEGK*
Ga0068860_1022731222	3300005843	Switchgrass Rhizosphere	VTKLLLILILGGGLANGIAKSHEQPPLLIESQPSALDEGK*
Ga0068862_1018219702	3300005844	Switchgrass Rhizosphere	VTKLLLILILGGALANGITKSHEQPPLLIESQPSALDEGK*
Ga0097621_1008079692	3300006237	Miscanthus Rhizosphere	VTKLLLIVAAFGALANGLAAFSQSQPPLLIDDGRSLDAAN*
Ga0068871_1001802502	3300006358	Miscanthus Rhizosphere	LPVHHGTVTKLLLILLFGGALANALESPSEPPLLIDSQATSASLDAQN*
Ga0079221_106101122	3300006804	Agricultural Soil	MGAVIKLLLLLAIGGAVASSLAAQSQPPLLIDSAPSPASLDANS*
Ga0075429_1004572761	3300006880	Populus Rhizosphere	RAMAKLFLILMLGGALANGLAASKSEPPLLIDSPASAVPLDAAH*
Ga0075429_1007460202	3300006880	Populus Rhizosphere	MAKLFLILMLGGALANGLAASKSEPPLLIDSPTSAAPLDAAH*
Ga0073928_103702402	3300006893	Iron-Sulfur Acid Spring	VTKLLIILALGGALANGFAHSHSEPPLLIDSKTTPNPLDAGY*
Ga0079219_110210622	3300006954	Agricultural Soil	LPAHDGAVTKLLFILFLGGALANGLAATHSEPPLLIDSAPTSLDAQN*
Ga0105240_105742712	3300009093	Corn Rhizosphere	VTKLLLILLFGGALANGVARSQEQPPLLIDSQPSPTSLDA
Ga0105241_121715852	3300009174	Corn Rhizosphere	MVKLFLILILGGALANGFAASNSEPPLLIDSPVSAAPLDAAN*
Ga0105242_126715492	3300009176	Miscanthus Rhizosphere	TKLLLILILGGALANSLASANSQPPLLIDSQPSPPSLDANN*
Ga0105248_101214563	3300009177	Switchgrass Rhizosphere	VTKLLLILFLGGALVNSLASARAEPPLLIDSQAAPASLDANG*
Ga0105237_119257802	3300009545	Corn Rhizosphere	LLIILLFGGALANSLAAPSDPPLLIDSQPAPSPLDANS*
Ga0126309_107393702	3300010039	Serpentine Soil	MIKFLLILLIGGALANGLSPKEPPLLIDTPTASGPLDAAG*
Ga0126314_105948801	3300010042	Serpentine Soil	LAAQHSAVTKILHILALAGALAQGLASGQSEPPLLID
Ga0134128_100796225	3300010373	Terrestrial Soil	VIKLLLILALSGALASGLTAQSQPPLLIDNASAPAPLDAAD*
Ga0134128_127753582	3300010373	Terrestrial Soil	VTKLLLILILGGALANGVAKSHEPPPLLIDSHPSPASLDANG*
Ga0105239_102111665	3300010375	Corn Rhizosphere	VTKLLLILLFGGALANGVARSLAQPPLLIDSQPSPTSLDANS*
Ga0134124_108318972	3300010397	Terrestrial Soil	VTKLLLILLIGTALANGLARSQAEPPLLIDPAPSPTTAAN*
Ga0150985_1202996061	3300012212	Avena Fatua Rhizosphere	VTKLLLILLVGGALANGLARSHSEPPLLIDSGPVGTSLDASK*
Ga0164301_110466051	3300012960	Soil	LSAQLGAVTKLLIILLSGGALANSLASAQSDPPLLIDSTPSAPLDATN*
Ga0157373_103219321	3300013100	Corn Rhizosphere	LFLILMLGGALANGLVASKSEPPLLIDSPTSPATLDAAH*
Ga0157369_100061849	3300013105	Corn Rhizosphere	LSAQHGAVTKLLIILLTSAALASGLSPKSDPPLLIDSQPAPASLDANN*
Ga0157369_108989412	3300013105	Corn Rhizosphere	MTKLLLILLASTALAASVAPKAEPPLLIDSQPSQPSLDANR*
Ga0157369_120225551	3300013105	Corn Rhizosphere	VTKLLLILILGGVLANGIAKSHEQPPLLIESQPSAL
Ga0157374_101987212	3300013296	Miscanthus Rhizosphere	LAAHKGAVTKLLLVLFLGGALANGLAATHTDPPLLIDPAPASLDAQN*
Ga0132256_1024317422	3300015372	Arabidopsis Rhizosphere	AQLGAVTKLLLILLIGGALANALATPSAPPLLIDSGPSPAALDVSN*
Ga0132257_1034911081	3300015373	Arabidopsis Rhizosphere	VTKLLLILLIGTALANGLAQSQAEPPLLIDSAPSPTAAN*
Ga0132255_1056806241	3300015374	Arabidopsis Rhizosphere	VTKILVILGLFGAVANALSAKAEPPLLIDSSPSPVH
Ga0066667_104036662	3300018433	Grasslands Soil	MLLLILLIGGALANSLSAHSEPPLLIDSHPASTSLDAVN
Ga0066662_108574862	3300018468	Grasslands Soil	VTKLLIILAAFGALASGLAKAQSEPPLLIDSQPAPPSLDASN
Ga0190274_105562752	3300018476	Soil	VTKLLIILLFGGALANGLAKADSEPPLLIDSQPAAALDAAN
Ga0190273_101548512	3300018920	Soil	VTKLLIILLFGGALANGLAKADSEPPLLIDSQPAAALDAGN
Ga0197907_103225072	3300020069	Corn, Switchgrass And Miscanthus Rhizosphere	LSAQLGRVIKLLLILMLGGALANGVAKSQEQPPLLIDNASSPAPLDAAN
Ga0206353_111658682	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	VIKLLLILALGGALANGVAKSQEQPPLLIDNASSPAPLDAAN
Ga0206353_115360352	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	MTKLLLILLFGGALANGVARSQEQPPLLIDSQPSPTSLDANS
Ga0193699_104454851	3300021363	Soil	LSAQLGVVTKLLLILILGGALANGVAKSHEQPPLLIDSQPAPATPLDATN
Ga0182009_100846322	3300021445	Soil	LAAQARAVTKLLLILILGGALASSLSARSDPPLLIDSAPSTALDAQS
Ga0182009_101188512	3300021445	Soil	VTKLLLILGFFGALANGLASAQSEPPLLIDSSPAATLDAQQ
Ga0182009_101413052	3300021445	Soil	LAVHHGTVTKLLLILLFGGAVANALESPSEPPLLIDSQATSASLDAQN
Ga0207656_100826723	3300025321	Corn Rhizosphere	LAVHHGTVTKLLLILLFGGALANALESPSEPPLLIDSQATSASLDAQN
Ga0207656_101912912	3300025321	Corn Rhizosphere	LSAQHRAVFKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS
Ga0207680_105675352	3300025903	Switchgrass Rhizosphere	VTKLLLILLVGGVLANGLAKSHSEPPLLIDSAPAGTSLDASK
Ga0207647_102252682	3300025904	Corn Rhizosphere	VTKLLLILILGGVLANGIAKSHEQPPLLIESQPSALDEGK
Ga0207647_102567502	3300025904	Corn Rhizosphere	VTKLLLILALSGALASGLGATSEPPLLIDNSPAPASLDANG
Ga0207647_103688042	3300025904	Corn Rhizosphere	MVKLFLILILGGALANGFAASNSEPPLLIDSPVSAAPLDAAN
Ga0207647_103927882	3300025904	Corn Rhizosphere	LSAQHRAVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS
Ga0207705_100475003	3300025909	Corn Rhizosphere	VHGCAVTKLLLILLFGGALANGFAAQSEPPLLIDAPQTLDAAN
Ga0207705_104629242	3300025909	Corn Rhizosphere	VAKLLIILLFGGALAKSLTPPREPPLLIDSQPAPAPL
Ga0207654_105648312	3300025911	Corn Rhizosphere	LSAQLGRVIKLLLILALGGALANGVAKSQEQPPLLIDNASSPAPLDAAN
Ga0207660_102713233	3300025917	Corn Rhizosphere	AHFRAMAKLFLILMLGGALANGLVASKSEPPLLIDSPTSAAPLDAAH
Ga0207657_100265447	3300025919	Corn Rhizosphere	VTKLLLIVLFGVVANALASPSEPPLLIDSQPAPTALDANN
Ga0207657_106599212	3300025919	Corn Rhizosphere	VTKLLIILLLGGALTNELARSHSEPPLLIDSQPSPTSLDASN
Ga0207657_107367062	3300025919	Corn Rhizosphere	MAKLFLILMLGGALANGLVASKSEPPLLIDSPTSAAPLDAAH
Ga0207657_108067582	3300025919	Corn Rhizosphere	LPVHHGTVTKLLLILLFGGALANALESPSEPPLLIDSQATSASLDAQN
Ga0207649_107406732	3300025920	Corn Rhizosphere	VLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDANS
Ga0207649_113567022	3300025920	Corn Rhizosphere	VTKLLIILLLGGALTNELARAHSEPPLLIDSQPSPASLDASN
Ga0207681_114870172	3300025923	Switchgrass Rhizosphere	VTKLLIILLFGALANSLASANSEPPLLIDSQPAPASLDASN
Ga0207650_113333621	3300025925	Switchgrass Rhizosphere	GQLGAVTKLLLILIIGGALANGIAKSHEQPPLLIESQPSALDEGK
Ga0207700_100847762	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	VTKLLLILFLGGALANGVARSQEQPPLLIDSQPSSASLDANG
Ga0207664_101673322	3300025929	Agricultural Soil	VTKLLLILLLGAALADSVAPKAEPPLLIDSQPSQPSLDANR
Ga0207664_111530742	3300025929	Agricultural Soil	VTKLLLILLASTALAESVAPKAEPPLLIDSSPSTLDAGK
Ga0207701_101619903	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	LPAQHGAVVKLLIILLFGGVLANSLASAQSEPPLLIDSQPASAALDANP
Ga0207701_114019031	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	VTKLLLILLVGGVLANGLAKSHSEPPLLIDSAPAGTSLDAS
Ga0207644_100281064	3300025931	Switchgrass Rhizosphere	VAKLLLILFLGGALVNSLASARAEPPLLIDSQAAPASLDANG
Ga0207644_104043892	3300025931	Switchgrass Rhizosphere	LAAHKCAVTKLLLILFLGGALANGLAATHTDPPLLIDPAPASLDAQN
Ga0207644_117025813	3300025931	Switchgrass Rhizosphere	VTKLLIILLLGGALTNELARSHSEPPLLIDSQPSPTSL
Ga0207690_100187403	3300025932	Corn Rhizosphere	MAKLFLILMLGGALANGLVASKSEPPLLIDSPTSPAPLDAAH
Ga0207690_111371072	3300025932	Corn Rhizosphere	LSAQHRAVLKLLIILLFGGALANSLAAPSDPPLLIDSQPAPAPLDGNS
Ga0207706_111513442	3300025933	Corn Rhizosphere	KLLLILLIGTALANGLAQSQAEPPLLIDSAPSPTTAAN
Ga0207686_103080231	3300025934	Miscanthus Rhizosphere	MAKLFLILMLGGALANGLVASKSEPPLLIDSPTSA
Ga0207711_104021822	3300025941	Switchgrass Rhizosphere	VTKLLLILFLGGALVNSLASARAEPPLLIDSQAAPASLDANG
Ga0207661_115681832	3300025944	Corn Rhizosphere	VTKLLLIMLFGGALANGVARSQEQPPLLIDSQPSPASLDANS
Ga0207679_101091062	3300025945	Corn Rhizosphere	LPAQDCAVTKLLLILLFGGALANGLAAPHSEPPLLIDPAPTSLDAQN
Ga0207667_101385902	3300025949	Corn Rhizosphere	VIKLLLILILGGALANGLAPSRSQPPLLIDNLSAPAPLDEAD
Ga0207651_114235082	3300025960	Switchgrass Rhizosphere	VTKLLLILLVGGALANSLAARSEPPLLIDTQPAPASLDAAD
Ga0207668_120210292	3300025972	Switchgrass Rhizosphere	LPAQHGAVVKLLIILLFGGVLANSLASAQSEPPLLIDSQPAS
Ga0207678_100512066	3300026067	Corn Rhizosphere	TKLLLILLASTALAESVAPKAEPPLLIDSQPSQPSLDADR
Ga0207702_105744422	3300026078	Corn Rhizosphere	LSAQHGVVTKLLLILLATTAIADSLAPKAEPPLLIDSQPAPASLDADR
Ga0207641_100355772	3300026088	Switchgrass Rhizosphere	VTKLLLILILGGALANGIAKSHEQPPLLIESQPSALDEGK
Ga0207683_117708341	3300026121	Miscanthus Rhizosphere	SPVRAQHGAMAKLLLILVFGGALATSLASAHSEPPLLIDSQPAPASLDATN
Ga0207698_107337991	3300026142	Corn Rhizosphere	LSAQLGAVTKLLLILLASTALAESVAPKAEPPLLIDSQPSQPSLDADR
Ga0209059_10792334	3300026527	Soil	VTKLLIILAAFGALASGLAKAQSDPPLLIDSQPAPPS
Ga0209796_100054652	3300027766	Agave	VTKLLFLLVLGGAIASSIASAQSQPPLLIDSAPSPTSVDANG
Ga0209796_100145492	3300027766	Agave	LVIVTKLLLILALGGAVASGLSAKSEPPLLIDNTASPTLDAQQ
Ga0209796_100552112	3300027766	Agave	LQAQHCAVIKLLIILILGGALASGLSAQSQPPLLIDSSPAPASLDANG
Ga0209810_10444982	3300027773	Surface Soil	VAKLLLILLFGGALANGLAASHSEPPLLIDSSPAAAHLDAQS
Ga0209177_102673462	3300027775	Agricultural Soil	LAAHKSAVTKLLLILFLVGALANGLAAAHSEPPLLIDPAPASLDAPN
Ga0209481_104769982	3300027880	Populus Rhizosphere	MAKLFLILMLGGALANGLAASKSEPPLLIDSPASAVPLDAAH
Ga0268265_117986011	3300028380	Switchgrass Rhizosphere	FLILILGGALANGFAASNSEPPLLIDSPVSAAPLDAAN
Ga0170824_1283190322	3300031231	Forest Soil	MTKLLLILFLGGALANQVAASHSEPPLLIDTSPSHPLDAGN
Ga0307408_1005378672	3300031548	Rhizosphere	VTKLLLILLFSGVLANGLVSNAEPPLLIDSAPTALDANN
Ga0307408_1006283722	3300031548	Rhizosphere	VTKLLIILLFGGALANSLASANSEPPLLIDSQPTPASLDASN
Ga0307405_100168142	3300031731	Rhizosphere	VTKLLLILLFSGALANALASNAEPPLLIDSAPTALDANN
Ga0307410_117893182	3300031852	Rhizosphere	VTKLLIILLFGGALANSLASASSEPPLLIDSQPAPA
Ga0307406_100838362	3300031901	Rhizosphere	VTKLLIILLFGGALANSLASANSEPPLLIDSQPAPASLDASN
Ga0307407_108287621	3300031903	Rhizosphere	VTKLLIILLFGGALANSLASASSEPPLLIDSQPAPASLDASN
Ga0307407_114291972	3300031903	Rhizosphere	VTKLLIILLFGGALANSLASANSEPPLLIDSQPTPASL
Ga0308175_1000217502	3300031938	Soil	VTKLLLILILGGALAHSLVSERSEPPLLIDSQPSPASLDAIN
Ga0308175_1006519912	3300031938	Soil	VTKLLIILLFGGALVNSLAKPAEPPLLIDSQPSPTALDANN
Ga0308175_1020082362	3300031938	Soil	LPAQHGAVTKLLLVLLFGGALANGLATTHSDPPLLIDPAPPPAAALDAANQ
Ga0308175_1023296851	3300031938	Soil	VTKLLIIVALAGALANGLASHKQPPLLIDNSQAPPAP
Ga0308174_101737521	3300031939	Soil	VTKLLLILLASTALAESVAPKAEPPLLIDSQPSQTSLDANR
Ga0308174_111153142	3300031939	Soil	LPAQHSAVAKLLIIICVGGALASGLSAQSQPPLLIDSAPAPAHLDAQP
Ga0308176_102171692	3300031996	Soil	MTKLLLILLASTALAASVAPKAEPPLLIDSQPSQPSLDANR
Ga0308176_105108801	3300031996	Soil	LTAAAQHRAVTKLLLILILGGALAHSLVSERSEPPLLIDSQPSPASLDAIN
Ga0308176_116891732	3300031996	Soil	MVTKLLLILLFGGALANGVARSQEQPPLLIDSQPSPTSLDANS
Ga0308173_102519262	3300032074	Soil	VQDCAVTKLLLILILSGALANGLASAHSEPPLLIDDSPSLDAAN
Ga0308173_117968332	3300032074	Soil	VTKLLLILILGGALANGVAKSHEPPPLLIDSQPSPASLDANG
Ga0308173_121506122	3300032074	Soil	VTKLLLILALSGALASGLGAKSEPPLLIDNSPAPASLDANG
Ga0326721_101325913	3300032080	Soil	KLLIILLFGGALANSLASANSEPPLLIDSQPAPASLDASN

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign