NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034784

Metagenome / Metatranscriptome Family F034784

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034784
Family Type Metagenome / Metatranscriptome
Number of Sequences 173
Average Sequence Length 98 residues
Representative Sequence MQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLNSFK
Number of Associated Samples 115
Number of Associated Scaffolds 173

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 81.88 %
% of genes near scaffold ends (potentially truncated) 63.58 %
% of genes from short scaffolds (< 2000 bps) 84.97 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (83.815 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(73.410 % of family members)
Environment Ontology (ENVO) Unclassified
(92.486 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(73.410 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 65.81%    β-sheet: 0.00%    Coil/Unstructured: 34.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 173 Family Scaffolds
PF13961DUF4219 24.86
PF14223Retrotran_gag_2 19.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.82 %
UnclassifiedrootN/A16.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005335|Ga0070666_10717824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum733Open in IMG/M
3300005355|Ga0070671_102097400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300005468|Ga0070707_102282300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300005617|Ga0068859_102069556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum628Open in IMG/M
3300005842|Ga0068858_102422890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300009976|Ga0105128_103952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum833Open in IMG/M
3300009981|Ga0105133_116650All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300009981|Ga0105133_124167All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum553Open in IMG/M
3300009981|Ga0105133_129398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300009988|Ga0105035_126239All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum563Open in IMG/M
3300009989|Ga0105131_128120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum589Open in IMG/M
3300009990|Ga0105132_145633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300009994|Ga0105126_1011551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum853Open in IMG/M
3300009995|Ga0105139_1079519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum617Open in IMG/M
3300009995|Ga0105139_1122081All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300010371|Ga0134125_12510784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum560Open in IMG/M
3300010371|Ga0134125_12564984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300010396|Ga0134126_12508915All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum560Open in IMG/M
3300010397|Ga0134124_12542399All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300013306|Ga0163162_12943213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300014968|Ga0157379_11550818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300015270|Ga0182183_1010124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum965Open in IMG/M
3300015273|Ga0182102_1015327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum677Open in IMG/M
3300015273|Ga0182102_1025007All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum598Open in IMG/M
3300015280|Ga0182100_1049038All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum643Open in IMG/M
3300015284|Ga0182101_1029428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum752Open in IMG/M
3300015284|Ga0182101_1047781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300015284|Ga0182101_1070777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300015290|Ga0182105_1058273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum626Open in IMG/M
3300015290|Ga0182105_1080315All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum561Open in IMG/M
3300015290|Ga0182105_1100383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum517Open in IMG/M
3300015293|Ga0182103_1024605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum788Open in IMG/M
3300015297|Ga0182104_1102410All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300015306|Ga0182180_1049854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum633Open in IMG/M
3300015306|Ga0182180_1075203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum547Open in IMG/M
3300015309|Ga0182098_1060933All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum653Open in IMG/M
3300015310|Ga0182162_1123030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300015312|Ga0182168_1047071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum749Open in IMG/M
3300015312|Ga0182168_1084096All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum609Open in IMG/M
3300015312|Ga0182168_1088796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum597Open in IMG/M
3300015313|Ga0182164_1085965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum604Open in IMG/M
3300015313|Ga0182164_1101748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300015315|Ga0182120_1129997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum517Open in IMG/M
3300015317|Ga0182136_1060897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum691Open in IMG/M
3300015318|Ga0182181_1039537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum726Open in IMG/M
3300015320|Ga0182165_1077832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum647Open in IMG/M
3300015324|Ga0182134_1105444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
3300015326|Ga0182166_1043956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum774Open in IMG/M
3300015327|Ga0182114_1022637All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1036Open in IMG/M
3300015327|Ga0182114_1123711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300015327|Ga0182114_1141602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300015328|Ga0182153_1110696All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300015328|Ga0182153_1132909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300015329|Ga0182135_1136675All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300015330|Ga0182152_1124832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum549Open in IMG/M
3300015332|Ga0182117_1153929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum525Open in IMG/M
3300015332|Ga0182117_1154417All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300015333|Ga0182147_1058192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum768Open in IMG/M
3300015333|Ga0182147_1107986Not Available607Open in IMG/M
3300015334|Ga0182132_1130497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum562Open in IMG/M
3300015335|Ga0182116_1030396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1004Open in IMG/M
3300015335|Ga0182116_1158492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300015336|Ga0182150_1144680All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300015337|Ga0182151_1051398Not Available787Open in IMG/M
3300015338|Ga0182137_1110357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum621Open in IMG/M
3300015338|Ga0182137_1171296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300015339|Ga0182149_1154083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300015340|Ga0182133_1144152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum571Open in IMG/M
3300015340|Ga0182133_1153321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300015340|Ga0182133_1186792All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300015349|Ga0182185_1130974All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum738Open in IMG/M
3300015349|Ga0182185_1162529Not Available668Open in IMG/M
3300015350|Ga0182163_1273401All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300015352|Ga0182169_1304300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300015353|Ga0182179_1127322All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum781Open in IMG/M
3300015353|Ga0182179_1188828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum653Open in IMG/M
3300015353|Ga0182179_1205443All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum628Open in IMG/M
3300015353|Ga0182179_1251979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300015354|Ga0182167_1326249All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015354|Ga0182167_1364365All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300017408|Ga0182197_1116480All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum557Open in IMG/M
3300017414|Ga0182195_1191584All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300017414|Ga0182195_1216187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300017421|Ga0182213_1210427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300017432|Ga0182196_1089308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum612Open in IMG/M
3300017435|Ga0182194_1066580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum687Open in IMG/M
3300017435|Ga0182194_1117048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum558Open in IMG/M
3300017439|Ga0182200_1084177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum637Open in IMG/M
3300017439|Ga0182200_1115310All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum571Open in IMG/M
3300017439|Ga0182200_1153637All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300017440|Ga0182214_1158029All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300017445|Ga0182198_1163979Not Available548Open in IMG/M
3300017447|Ga0182215_1063762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum794Open in IMG/M
3300017692|Ga0182210_1101585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum620Open in IMG/M
3300017692|Ga0182210_1104613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum612Open in IMG/M
3300017692|Ga0182210_1129530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300017693|Ga0182216_1080351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum753Open in IMG/M
3300017693|Ga0182216_1225163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300025925|Ga0207650_10856391All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum771Open in IMG/M
3300025972|Ga0207668_12068253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300028050|Ga0268328_1057003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300028051|Ga0268344_1020699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300028055|Ga0268338_1026037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum599Open in IMG/M
3300028056|Ga0268330_1036460All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum613Open in IMG/M
3300028058|Ga0268332_1035902All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum671Open in IMG/M
3300028062|Ga0268342_1040572All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300028063|Ga0268350_1053995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300028064|Ga0268340_1019553All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum839Open in IMG/M
3300028143|Ga0268348_1023250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300028149|Ga0268353_110279All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum674Open in IMG/M
3300028152|Ga0268336_1008040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum754Open in IMG/M
3300028153|Ga0268320_1000348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1765Open in IMG/M
3300028154|Ga0268341_1000562All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1706Open in IMG/M
3300028154|Ga0268341_1023793All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum553Open in IMG/M
3300028154|Ga0268341_1029973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum514Open in IMG/M
3300028248|Ga0268312_1028366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300028262|Ga0268310_1028250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum620Open in IMG/M
3300028463|Ga0268325_101484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum767Open in IMG/M
3300028468|Ga0268317_1012877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300028475|Ga0268327_1000503All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1520Open in IMG/M
3300032464|Ga0214492_1001441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2820Open in IMG/M
3300032464|Ga0214492_1060094All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum735Open in IMG/M
3300032464|Ga0214492_1075051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300032466|Ga0214503_1020194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1793Open in IMG/M
3300032490|Ga0214495_1122684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum588Open in IMG/M
3300032514|Ga0214502_1249718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum677Open in IMG/M
3300032589|Ga0214500_1203537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300032590|Ga0214489_1072062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300032591|Ga0214484_1036970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1019Open in IMG/M
3300032591|Ga0214484_1122665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300032593|Ga0321338_1299287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum577Open in IMG/M
3300032689|Ga0214497_1124469All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum545Open in IMG/M
3300032758|Ga0314746_1112519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum621Open in IMG/M
3300032822|Ga0314740_1049229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum632Open in IMG/M
3300032845|Ga0314727_1016681All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1009Open in IMG/M
3300032889|Ga0314751_1071178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum706Open in IMG/M
3300032915|Ga0314749_1042700All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum971Open in IMG/M
3300032915|Ga0314749_1083531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum689Open in IMG/M
3300032915|Ga0314749_1112236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum584Open in IMG/M
3300032916|Ga0314734_1073115All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum688Open in IMG/M
3300032959|Ga0314738_1048276All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum776Open in IMG/M
3300032970|Ga0314716_133484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum591Open in IMG/M
3300033526|Ga0314761_1031602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1135Open in IMG/M
3300033532|Ga0314767_1118663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum663Open in IMG/M
3300033534|Ga0314757_1082830All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum772Open in IMG/M
3300033537|Ga0314766_1018160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2043Open in IMG/M
3300033538|Ga0314755_1133331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum632Open in IMG/M
3300033538|Ga0314755_1166814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum560Open in IMG/M
3300033542|Ga0314769_1113297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum898Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere73.41%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere12.14%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated6.36%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.16%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009988Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028051Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028063Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028143Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028149Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028152Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028153Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028154Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028248Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028463Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028468Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028475Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028477Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032464Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032589Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032590Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032757Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032758Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032792Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032822Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032845Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032889Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032915Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032916Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032917Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032970Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033532Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033534Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033537Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033538Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070666_1071782413300005335Switchgrass RhizosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHE
Ga0070671_10209740013300005355Switchgrass RhizosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENANVLWKTISENHEGTKDVANEKYHVLIDKLN
Ga0070707_10228230013300005468Corn, Switchgrass And Miscanthus RhizosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILSSLGENVFNRVFACENAKNLWKTISENHEGTKDVA
Ga0068859_10206955613300005617Switchgrass RhizosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFAYENTKVLLKTINENHEGTKDVANKRYHVLIDKLNSFKQL
Ga0068858_10242289013300005842Switchgrass RhizosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENAKVLLKTISVNYEGTKDVANERYHVLIDKLNSFKQLDH
Ga0105128_10294523300009976Switchgrass AssociatedMQAHLQVTELNVWRVVSEGIKNNGQQEKQHDVTGKCIILSSLGDNVFNRIYSCENAKELWKTIIENHEGTEDVANERYHVLID*
Ga0105128_10395223300009976Switchgrass AssociatedMDSLGPPPRFDVTGFQRWKILMQAHLQAKGLNVWRVTSEGTKSNNQQERQYDATAKCAILTSLGENVFNRVFACENANDLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDHENAETMYS
Ga0105133_11665013300009981Switchgrass AssociatedMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGVKNNGQQEKQYDVIAKCIILSSLSDNVFNRIYSCENSKELWKTIIENHEGTEDVANERYHVLTDKLNSFK*
Ga0105133_12416713300009981Switchgrass AssociatedMDSLGPPPRFDGTGFQCWKVLMEAHLQAKGLNVWSVTSERMKGNSQQEKQHDAIAKCAILSSLGDTVFNRVFACKNAMELWKTICENHEGTKDIANEKYHVLIDKLNSFK
Ga0105133_12939813300009981Switchgrass AssociatedMLMQSHLQAKGLNIWRITSEGIKGKSQQEKQYDAIAKCAILNSLGDTVFNCVFACENAMDLWKTISENHEGTKDIANEKYHVLIDKLNSFKQLDDENTE
Ga0105035_12623913300009988Switchgrass RhizospherePLRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENTNVLWKTISENHEGTKDVANERYHVLIDKLNSFKQLDHENAKLCTHG*
Ga0105131_12812013300009989Switchgrass AssociatedMQSHLQAKGLNIWRVTSEGVKSNSQQERQYDAIAKCAILSSLGDTVFNRVFACENAKDLWKTICENHGGTKYVANEK*
Ga0105132_14563313300009990Switchgrass AssociatedMDSLGPPPRFDGTGFQRWKVLMEAHLQANGLNVWRVTSEGVKSKSQQERQYDAIAKCAILSSLGDTVFNRVFACENAKDLWNTICENHGGTKDIANEKISCSHR*
Ga0105126_101155133300009994Switchgrass AssociatedMNHFRIVPRFDGTGFQHWKILMEAHLQATGLNVWRVVSEGTKSNSQQERQYDATAKSIILSSLNENVFNCVYSCENAHKLWKTIIENHEDTEDVANERYHVLIDRLNSFKQLDYEIPNLCTHD*
Ga0105126_103701423300009994Switchgrass AssociatedMQAHLQTTGLNFWRVVSEGTKNNGHQEKQHDVTAKCIILSSLSDNVFNRIFHVKMLKKLWKTIIENNEGTEDVTNKRYHVLIDKLNSFKQLDDENAESMYS*
Ga0105139_107951913300009995Switchgrass AssociatedMLMEAHLQAKGLNVWRVTSEGMKGNSQQEKQYDAIAKCAILNSLGDNVFNRVFTCKNAKKLWKTISENQEGTKDVANKKYHVLIDKLNSFKQLDDEN
Ga0105139_112208113300009995Switchgrass AssociatedMGFQRWKVLMQSHLQAKGLNVWRVTSEGIKNNSQQEKQFDAIAKCVILSSLEDKIFNRVFVCENAKELWKAIIENHEGTKDVANERYHVLIDRLNSFKQLDHE
Ga0134125_1251078413300010371Terrestrial SoilMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANE
Ga0134125_1256498413300010371Terrestrial SoilMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVMSEGTKSNSQQEKQYDAIAKCAILSFLGENVFNRVFACENAKDLWKTICENHEGTKDVGEEKYHVLIDKL
Ga0134126_1250891513300010396Terrestrial SoilMQSHLQAKGLNVWRVTSEGMKNKGEQEKQFDTIAKCVILSSLEDKIYNHEFACENAKELWKTINENHEGTKDVANERYHVLIDRLNN
Ga0134124_1254239913300010397Terrestrial SoilVSEGVKNNGQQEKQYDVTAKCIILSSFSDNVFNRVFSCENAKKLWKTIIENHEGTEDVANEKYHVLIDKLSSFKQLDEENAESMYS*
Ga0163162_1294321313300013306Switchgrass RhizosphereMEAHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDHENAE
Ga0157379_1155081813300014968Switchgrass RhizosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGMKRKSQQEKQYDAIAKYVILNSLGDNMFNRVFACKNTKDLWKTIGENHEGTKDVANEKYHVLIDK
Ga0182183_101012413300015270Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGMKSKGQQEKQFDDIAKCVILSSLDDKIFNRVFACENAKDLWKTIKENHEGTKDVANERYHVLIDKLNIFKQLDDENA*
Ga0182183_106891313300015270Switchgrass PhyllosphereMQAHLQATGLNVWRVVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVFNRVCSCENAQKLWKTIIENHEGTEDVANERYHVLIDRLNSFEQRDDENTESMY*
Ga0182102_101532713300015273Switchgrass PhyllosphereMQSHLQAKSLNVWRVTSEGMKNKGQQEKQFNAIAKCAILSSLGENVFNYVFACENAKVLLKTISENHEGTKYVVNERYHVLIDKPNSFK*
Ga0182102_102500713300015273Switchgrass PhyllosphereMQAHLQATGLNIWRVVSEGVKNNSQQEKQNDVTAKCIILSSLSGNVFNSVYSCENAQKLWKTIIENHEGTENVANERYHVIIDKLNSFKQLDDENAESLIALSNL
Ga0182099_100744623300015278Switchgrass PhyllosphereMEAHLQTMGLNVWRVVSEGTKSNSQQERQYEATAKSIILSSLNENVFNLVYSCENSKKLWKTIIENHEVTEDVANDRYHVLIDRLNSFK*
Ga0182100_103211713300015280Switchgrass PhyllosphereMQTHLQETGLNIWRVVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVFNRVYSCENAKTLWKTIIVNHEGTEDVVNEKYHVLIDKLNSF
Ga0182100_104903813300015280Switchgrass PhyllosphereMDSLGPPPCLDGTGFQRYKILMQSHLQAKGLNVWRVTSEGVKNNGQQEKQFEAIAKCVILSSLEDNIFNRVFAFENAINANHEGTKDVGNERCHVLIDRLNSFKQFDHENAESMYSRL
Ga0182101_102942813300015284Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGMKDNSQQEKQYDAIAKCAILNSLGDNVFNRVFACENAKDLWKTISENHEGTK
Ga0182101_104778113300015284Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLNSFKQ
Ga0182101_107077713300015284Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKVLMQSQLQAKGLNVWRVTSEETKNNSQQEKQYDAIAKCAILSSLGDNVFNRVFVCKYAKDLWKTISENHESTKD
Ga0182101_108877513300015284Switchgrass PhyllosphereVSEGIKNNGQQEKQYDVTAKCIILSSLSDNVFNCVYSCENAQKLWKTIIENHEGMEDVANERYHVLIDKLNRFKQL
Ga0182105_105827313300015290Switchgrass PhyllosphereMDSLGPPPRFDGMGFQRWKIFMQSHLQAKGLNVWRVTSEGMKDNSQQEKQYDAIAKCVILNSLGDNVFNHVFACKNAKELWKTISENHEDTKDVANEKYHVLIDKINSFK
Ga0182105_108031513300015290Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDK
Ga0182105_110038313300015290Switchgrass PhyllosphereMSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENAKVLWKPISENYEGTKDVANERYHVLIDKPNSFKQLDHEN
Ga0182103_102460523300015293Switchgrass PhyllosphereGMDSLGPPSRFDGTSFQRWKILMQSHLQAKGLNIWRVTSEGVKSNSQQERQYDAIAKCAILSSLGDTVFNCVFACENAKNLWKTICENHGGTKNVANEKIPCSHR*
Ga0182104_104714033300015297Switchgrass PhyllosphereWRVTSERIKNNSQQERQYDAITKCAILSSLGDTVFNRVFACENAKDLWKTICENHGGTKDVANEK*
Ga0182104_110241013300015297Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNIWRVTSEGMKGRSQQERQYNVIAKYAILSSLGDNVFNHVFACKNAKELWKTISENHEETKDVANEKYRVLIDKLNSFKQ
Ga0182180_104985413300015306Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKSLNIWRVTSDGVKSNSQQERQYDAIAKCAILSSLDDTVFNCVFACENAKDLWKTNCENHGGTKDVANKKYHVLIDK
Ga0182180_107520323300015306Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGIKGNSQQEKQYDAIAKCAILNSLGDNVFNRVFACKNAKKLWKTISENHEGTRDVAHEKYHVL
Ga0182098_106093313300015309Switchgrass PhyllosphereMQAHLQAMDLNIWRVVSEGMKYTNQPEKQYDVTIKCIILSSLSDNVFNRVFSCENAKELWKTINENHNGTKDVANERYHILTDKLNSFKQCDDENAESM
Ga0182162_112303013300015310Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLD
Ga0182182_111507913300015311Switchgrass PhyllosphereMQTHLQATGLNVWRVVSEGVKNNGLQEKQHDVTAKCIILSSFCDNVFNRIYSCENAKTLWKTIIENHEGKEDVANKKYHVLNNKLNSFKQLDDE
Ga0182168_104707123300015312Switchgrass PhyllosphereMDSLGPPPWFDGTGFQRWKILMESHLQEKGLNIWRVTSEGMKNKSQQEKQFDAIPKCVILSSLEDKIFNRVFACENAKELWKTIIKNHEGTKDVANKKYHVLIDSLNSFKQIDHENVEAMYSRLMFL*
Ga0182168_108409613300015312Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKVLMEAHLQAKGLNVWRVTSEGMKGKSQQERQYDAIAKCAILNSLGDNVFNRVFDCKNAKELWKTISENHKGTKDVANKKISCSH*
Ga0182168_108879613300015312Switchgrass PhyllosphereMEAHLQAKGLNIWRVTSEGVKSNSQQERQYDAIAKCAILSSLGDTVFNRVFACENIKDLWKTICDNHEGTKDVANEKYHVLIDKLNRFKQL
Ga0182164_108596513300015313Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDHENAE
Ga0182164_110174813300015313Switchgrass PhyllosphereMDSLGPPTRFDGTGFQRWKILMQSHLQANGLNVWRVTSEGTKSNSQQERQYDTIANCAILSSLGDTVFNRVFACKNTKELWKTICENHGGTKDIANEKYHVLIDKLNSFK*
Ga0182120_111275613300015315Switchgrass PhyllosphereMQVHLQATGLNVWRVVSECIKNNGQQEKQHDVTAKCIILSSLSDNVFNHVYSCENTKELWKTIIENHEGTEDVANERYHVFIDKLNSFKQLDEE
Ga0182120_112999723300015315Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGVKSNSQQEKQYDAIAKCAILSSLGDTVFNRVFACENAKDLWKTICENHGGTKDVANEK*
Ga0182136_106089723300015317Switchgrass PhyllosphereMDSLGPPPQFDGTGFQRRKILMKSHLQAKGVNVWRVTSEGMKNKGQQEKQFDAITKCAILSSLGDTMFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDDEHAESM
Ga0182181_103953713300015318Switchgrass PhyllosphereMDSLGPPPRFNGTGFQRWKILMQSHLQAKGLNIWRVTSEGVKSNSQQERQYDAIAKCAILSSLGDNVFNRVFACENAKNLWKTISENHEGTKNIADEKYHVLIAKLNSFKQLDDENAESMYSR
Ga0182130_111437313300015319Switchgrass PhyllosphereMQAHLQATGLNIWRVVSEGMKNNGQQEKQHDVTAKCIILSSLSDNVFNHVYSSENAKDLWKTIIENHEGTEDVANERYHVLIDKLNSFKTW*
Ga0182165_107783213300015320Switchgrass PhyllosphereMDSLGPHPRFDGTGFQRWKILIESHLQAKGLNVWRVTSEGMKNKGQQEKQFDAIAKCVILSSLDDKIFNRVFACENAKDLWKTIKENHESTKNVANERYHVLIDRLNS
Ga0182134_110544413300015324Switchgrass PhyllosphereMDSLGPPPRFDGMGFQRWKILMESHFQAKGLNIWRVTSEGMKNKGQQEKQFDAIAKCAILTSLGDTIFNRVFACENAKDLWKTISENHEGTKRCCK*
Ga0182166_104395613300015326Switchgrass PhyllosphereMNSLGPPPRFDGMGFQHWKILMEFHLQSMGLNVWRVTSEGMKSKGQQEKQFDSIAKCVILSSLDDKIFNRVFACENAKDLWKTIKENHEGTKDVANERYHV
Ga0182114_102263723300015327Switchgrass PhyllosphereMQSHLQAKDLNVWRVTSEGVKSNSQQEKQYDAIAKCAILSSLGDTVFNRVFACENAKDLWKTICENHGGTKDVANEK*
Ga0182114_112371113300015327Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKL
Ga0182114_114160213300015327Switchgrass PhyllosphereMDSLGPPPRFDGMGFQRWKILMQSHLQAKGLNVWRVTSEGMKNNGQQEKQFDAIAKCVILSSLEDKISNRVFACENAKEPWKTINENHEGTKDVANKKYHVLIDSLNSFKQIDHENVEAMYSRLM
Ga0182153_111069613300015328Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLN
Ga0182153_113290913300015328Switchgrass PhyllosphereMQAHLQATGLDVWRVVSEGMKNTTQQEKQNDVIAKSIILFSLGDSVFNRVFSYKNAKELCKTINENHEGTKDVANERYHVLVNKLNSFKKLDDENAESMYSR
Ga0182135_113667513300015329Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGVKSNSQQERQYNAIAKCAILNSFGESVFNRVFACKNANVLWKIISENHEGTKDVANEKYHVLI
Ga0182152_112483213300015330Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENANVLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDH
Ga0182117_115392913300015332Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKIFMQSHLQAKGLNVWRVTSEGTRSNSQQEKQYDAIAVCAILNSLGENVFNCVFACENAKVLWKTISENHEGTKDVANERYHVLI
Ga0182117_115441713300015332Switchgrass PhyllosphereMDSLGPLPRFDGTGFQRWNILMQSHLQAKGLNVWRVTSEGMKGNSQQEKQYDAIAKCAILNSIGDNVFNRVFACKNAKEFWKTISENHEG
Ga0182147_105819213300015333Switchgrass PhyllosphereMGFQHWKVLMQAHLQATGLDVWRVVSEGMKNTTQQEKQNDVIAKSIILFSLGDSVFNCVVSYKNAKELCKTINENHEGTKDVANERYHVLIDKLNSFKQLDDENAKSMYS*
Ga0182147_110798613300015333Switchgrass PhyllosphereKKKGQAKGLNICRVTSEGMKSNSQQKKQYNAIAKCAILNSLGDNVFNCVFACKNANELWKTISKNYEVTKDIANEKYHVLINKLNSFNQLDHENAET*
Ga0182132_113049713300015334Switchgrass PhyllosphereMDFLGPPPRFDGTDFQRWKILMESHLQAKGLNVWRVTSEGVKNKGQQEKQFDAIAKCAILNSFGDNVFNRVFTCENAKDLCKTIKENHEGTKDVGEEKYHVLIDKLNSFKQ
Ga0182116_103039613300015335Switchgrass PhyllosphereMDPFKNAPRFDGTGFQRWKVLMQAHLQAMDLNIWRVVSEGMKYTNQQEKQYDVTIKCIIFSSFSDNVFNHVFACENAKELWKTINENHNGTKDVANERYHVLTDKLNSFKQCDDENAKSIYS*
Ga0182116_115849213300015335Switchgrass PhyllosphereMAWGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRVFACENANVLWKTISENHEGTKDVANEKYHILINKFNSSKQLDH
Ga0182150_114468013300015336Switchgrass PhyllosphereMDSLGPHPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNFLGENVFNRVFACENANVLWKTISANHEVTKDVANEKYHVLIDKLNSFKQLDHENTETMYSR
Ga0182151_105139813300015337Switchgrass PhyllosphereVSEGIKINGQQEKQYDVTVKCIILSSLSDNVFNHVYSCENAKKLWKTIIENLEATEDVANERYHFLIDKLNSFKQLDDENAESMYS*
Ga0182137_111035713300015338Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLNSFK
Ga0182137_117129613300015338Switchgrass PhyllosphereMDSLGSPPWFDGTGFQRWKILMESYLQAKGLNVWRVTSEGMKNKGQQEKQFDAIAKCAILSSLGDNMFNRVFACENAKDLWKAISENHEGTKNIGEEKYYILIDKLNSFK*
Ga0182149_111816813300015339Switchgrass PhyllosphereMQAHLQTTGLNIWRVVSEGTKNNSQQERQYGATAKSIILFSLNKNVFNRVYSCEHTHKLWKTIIENYEDTKDVANEKYH
Ga0182149_115408313300015339Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSKGVKSNSQQERQYDAIAKCAILSSLGDTVFKRVFVCENIKDLWKTICENHGGTKDVANEKYHVLIDKLNSFKQFF*
Ga0182133_103785913300015340Switchgrass PhyllosphereMQSHLQAKGLNVWRVVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVLNHVYSCANAKEL*KTIIENHEGTEDVANERYHVLIDKLNSFK*
Ga0182133_110658313300015340Switchgrass PhyllosphereMQAHLQATGLNVWRVVSEGIKTNGQQEKQYDVTAKCIILSSLSDNVFNRVYACENAKELWKTIIENYEGTEDVANERYHVLIDKLSS
Ga0182133_114415223300015340Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGMKNKGQQEKQFDAITKCAILSSLGDTVFNRVFACENAKDLWKTISENFEGTKNVANEKYHVFIDKLNSFKQLDDENAE
Ga0182133_115332113300015340Switchgrass PhyllosphereMDSLGSPPRFDGTSFQRRKILMQSHLQTNGLNVWRVTSEGVKSKSQQERQYDVIAKYAILSSLGDTIFNRVFACENAKHLWKTICENHGGTKDVANEKYHVL
Ga0182133_118679213300015340Switchgrass PhyllosphereILMQSHLQAKGVNVWRVTSEETKSNSQQEKQYDAIAKCAILNSLSDNVFNRVFACKNAKILWKTISENHEDTKDVANERYQVLIDKLNSFK*
Ga0182185_113097413300015349Switchgrass PhyllosphereMESHLQAKGLNVWRVTSEGMKNKGQQEKQFDAIAKCVILSSLGDNMFNRVFACENTKDLWKVVSENHEGTKNIGEEKYYILIDKLNSFK*
Ga0182185_116252913300015349Switchgrass PhyllosphereMDPFRNAPQFDDTGFQRWKVLMQTHLQATGLNIWRVVSEGTKSNSQQEIQYDATAKSIILSSLNENVFNCVYSCENAHKLWKTIIENHEDTEVVANERYHVLINRLNSFK*
Ga0182163_103022123300015350Switchgrass PhyllosphereVSEGIKNHAQQKKQYDVSAKRILLCSLDHNVFNHVFASENAKKLWKTINKNHGGTKDVANEKYHFLIDKLNSFKQLDH*
Ga0182163_127340113300015350Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGVKSNSQQEKQYDAIAKCAILSSLGDTVFNRVFACKNTKELWKTICENHEGTKDVGEEKYHVLIDKLNSFK
Ga0182169_114149413300015352Switchgrass PhyllosphereLNIWRVVSEGMKYTNQQEKQYDVTIKCLIFSSFSDNVFNHVFACENAKELWKTINENHNGTNDVANERYHVLTDKLNSFTQCDDENAKSIYS*
Ga0182169_125330813300015352Switchgrass PhyllosphereMQAHLQAMGLNVWSVVSEGIRNNGHQERQHDVTAKCIILSSLSDNVFNHVYSSENAKDLWKTIIENHEGTEDVANERYHVLIDKLN
Ga0182169_130430013300015352Switchgrass PhyllosphereMNSLGPPPRFDGMGFQRWKILMQSHLQTKGLNVWRVTSEGVKSNSQQERQYDAIAKCAILSSLGDTVFNCVFACENAKDLWKTICENHEGTKDVANENIIFS*
Ga0182179_112732213300015353Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGVKSNSQQERQYDAIAKCAILSSLGDTVFNRVFACENAKDLWKTICENHGGTKDVANEK*
Ga0182179_115369823300015353Switchgrass PhyllosphereVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVLNRVYSCANTKELWKTIIENHEGTEDVANERYHVLIDKVNSFK*
Ga0182179_118882813300015353Switchgrass PhyllosphereMDSLGPPPCFDGTGFQRWKILMESHLQVKGLNVWRVTSEGTKRYSQQEKQYDAIAKCAILNSLGENVFNRVFACENAKVLWKTISENHEGTKDVANERYHVLIDKLNSFKQLDHENAE
Ga0182179_120544313300015353Switchgrass PhyllosphereMNSLGPPPRSDGTVFQRWKILMQSHLQAKGLNVWRVTNEGVKRNSQQERQYDAIAKCAILSSLGDTVFNRVFACENAKDLWKTICENYGGTK
Ga0182179_125197913300015353Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGMKNNGQQEKQFDAIAKCVILSSLEDKISNHLFACENAKEPWKTINENHEGTKDVANKKYHVLIDSLNSFKQIDHENAEAMYSRLMFL*
Ga0182167_132624913300015354Switchgrass PhyllosphereMNSLGPPPRFDGTGFQRWKVLMEAHLQAKGLYFWRVTSEGMKGKSQQERQYDAIAKCAILNSLSDNVFNHVFAFKNAKDLWKTISENHEGTKDVANEKYHVFIYKLNSFKQLDDE
Ga0182167_136436513300015354Switchgrass PhyllosphereMDSLGPPPQFDGTGFQRWKVLMQSHLQAKGLNVWRVTSEGMKNKGEQEKQFDTIAKCVILSSLEDKIFNRVFACENAKELWKTIIKNHEGTKDVANERNHVLIDRLN
Ga0182197_111648013300017408Switchgrass PhyllosphereMDSLGPPPRFDGTCFQRWKILMQSHLQAKGLNVWRGTSEGTKSTNQQERQYDAIAKCAILTSLGENVFNRVFACKNANDLWKTISENHEGTKDVANERYHVLIDKL
Ga0182199_119385613300017412Switchgrass PhyllosphereAHLQATGLNVWRVVSEGVKNNGQQEKQYDVTAKYIILSSLCDNVFNRVYSYENAQKLWKTIIENHEGTKDVANERYYVLIDKLN
Ga0182195_119158413300017414Switchgrass PhyllosphereMDSLGPPPCFDGTSFQRWKILMQSHLQAKVLNIWRVTSEGMKGKSQQEKQYDAIAKCAILNSLGDIVFNRVFACKNAKELWKTISENNERTKDVANKKYHVLVDKLNSFKQLDHENAKTMYSWLNILV
Ga0182195_121618713300017414Switchgrass PhyllosphereDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVLNRVYSCANTKELWKTIIENHEGTEDVANERYHVLIDKVNSFK
Ga0182213_121042713300017421Switchgrass PhyllosphereMDSLGPSLRFDGTGFQRWKILIQSHLQVKGLNVWRVTSEGVKSNSQQERQYDAIAKCAILSSFGDTVFNRVFACKNAKELWKTISENHEGTKDVANEKYHIF
Ga0182196_108930813300017432Switchgrass PhyllosphereMESHLQAKGLNIWRVTSEGMKNKGQQEKQFDAIAKYAILSSLGDTVFYRVFACENAKDLXKTISENHEGTKNMANEKYHVFIDKLNSFKQLDDENAE
Ga0182194_106658013300017435Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKELWKTISENHEGTKDVANEKYHVL
Ga0182194_111704813300017435Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFVCKNAKVLWKTISKNHEGTKDVANKRYHVLI
Ga0182200_108417713300017439Switchgrass PhyllosphereMDSLGPPPCFDGTDFQRWEILIQSHLQVKNLNVWRVTIEGVKSNSQHEKQYDAIATCAILNSLGDNVLNRVFACENAKNLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDDENAESM
Ga0182200_111531013300017439Switchgrass PhyllosphereMETHLQTKGLNVWRVTSEGVKSKSQQERQYDVIAKCAILSSLGDTIFNRVFACENAKHLWKTICENHGGTKDVAN
Ga0182200_115363713300017439Switchgrass PhyllosphereMDSLGPPPRFDGTDFQRWMILMQSHLQAKGLNVWRVTSNGVKSNSQQEKQYDFIAKCAILSSLGNTVFNHVFACENAKDLWKTICENHEGTKDVANENIIFS
Ga0182214_115802913300017440Switchgrass PhyllosphereMEAHLQAKGLNVWRVTSEGMKGKSQQEKQYDAITKCAILNSLGDNVFNRVFACENAKDLWKTISENHEGTKDVANKKYHILIDKFNSLKQLDHENAET
Ga0182198_116397913300017445Switchgrass PhyllosphereMDSFRNAPRFDGTGFQRWNILMQIHLHVTGLEVWNVVNEGIKFKTLKEKQNDVIAKSIILSSLSDNIFNRVYSCENANKLWKSIIENHESTEDVANEKYHVLIYKLNSFK
Ga0182215_106376213300017447Switchgrass PhyllosphereMDSLGPHPCFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENAKVLWKTISENHEGTKNVTNERYHVLIDKLNSFKQLDHE
Ga0182210_110158513300017692Switchgrass PhyllosphereMDFLGPPRFDGTGFQRWKILMESHLQAKGLNVWRITSEGMKNKGQQEKQFDAIAKCVILSSLDDKIFNRVFACENDKDLWKTIKENHEGTKDLANGRYHALIDR
Ga0182210_110461313300017692Switchgrass PhyllosphereMQSHLQANGLNVWRVTSEGVKSSSQQERQYDAIAKCAILSSLGDTVFKRVFVCENIKDLWKTICENHGGTKDVANEKYHVLIDKLNSFKQLDDEN
Ga0182210_112953013300017692Switchgrass PhyllosphereSEGTKSNSQQEKQYDAIAKCAILNSLGDNVFNRVFACENVKVLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDHENAETMYSRLIFL
Ga0182216_108035123300017693Switchgrass PhyllosphereFDGMGFQRWKILMQFHFQAKGLNVWRVTSEGVKSNSQQERQYDAIAKCAILSSLGDTVFNRVFACENAKDLWKTICENHGGTKNIANEKYHVLIDKLNSFKQLDDKNAESCTHG
Ga0182216_110867723300017693Switchgrass PhyllosphereMQTHLQATGLNIWRVVSEGIKNNGHQERQCDVTAKCIILSSLSNNIFNRVYSCENAKELWKTIIENHEGTEDVANERYHVLIDKLNSFK
Ga0182216_122516313300017693Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKL
Ga0207650_1085639113300025925Switchgrass RhizosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENANVLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDHENAETMYS
Ga0207668_1206825313300025972Switchgrass RhizosphereMQSHLQAKGLNVWRVTNEGTKSNSEQEKQYDAIAKCAILNSLGENVFNRVFACENTKIDKLNSFKQLDHENAGT
Ga0268328_105700313300028050PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQTTGLNVWRVVSEGIKNNGQQEKQYDVIAKCIILSSLSYNVVNRIYSCENAKELWKTIIENHVGTEDVINERYHVLIDKLNSFRQLDDENAESM
Ga0268344_102069913300028051PhyllosphereMQSHLQAKGLNAWRVTSEGMKGNSQQEKQYDAIAKCAILNSLGDNVFNRLFACKNAKELWKTISENHEEIKDVANEKYHVLIDKLNSFKQL
Ga0268338_102603713300028055PhyllosphereMQSHLQTKGLNVWKVTSDGVKSNSQQEKQYDAIAKCAILNSLGDTVFNCVFACENAKNLWKTICENHGGTKDVVNEKYYIFIDKLNSFKQF
Ga0268330_103646013300028056PhyllosphereMDSFRPTPWFDGTGSQRWKVLMQAHLQAMGLNIWRVVSEGIKNNGHQKRQYDVTVKCIILSSLSDNIFNHVYSCKNAKELQKAIIENHEGTEDVANEKYHVLIDKLNSFKQLDDENTESMYS
Ga0268332_103590213300028058PhyllosphereQSHLQAKGLNVWRVTSEGMKGNSQQEKQYDAIAKCAILNSLDDNVFNRVFACKNAKELWKTISENYEGTKDVANEKYHIFINKLNSFK
Ga0268342_104057223300028062PhyllosphereMDSLGPPPRFDGTSFQRWKILMQPHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENAKVLWKTISENHEGTKDVANERYHVLIDKLNSFKQLDHENAETM
Ga0268350_105399513300028063PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLNSF
Ga0268340_101955323300028064PhyllosphereMDPFRPAPRFDGTSFQCWKVLMQAHLQATGLNVWRVVSEGVKNNGQQEKQYDVTAKCIILSSLSDNVLNRVYSCANTKELWKTIIENHEGTEDVANERYHVLIDKVNSFK
Ga0268348_102325013300028143PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKALWKTISEN
Ga0268353_11027913300028149PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENANVLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDHENA
Ga0268336_100804013300028152PhyllosphereFDGTGFQRWKILMQYHLQAKGLNVWRVTSEGMKNKGQQDKQFDAIAKCAILSSLGDTVFNRVFACENAKDLWKTISENYEGIKDVAN
Ga0268320_100034833300028153PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILSSLGENVFNRVFACENANVLWKTIREN
Ga0268341_100056233300028154PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLVDKLNSF
Ga0268341_102379313300028154PhyllosphereMDSLGPPPRFNGTGFQRWKILMQSHLQAKGLNIWRVTSEGMKGKSQQEKQYDAIAKCAILSSLGDNVFNRVFACENAKDLWKTISENHEDTKDVANKKYHI
Ga0268341_102997323300028154PhyllosphereMESHLQAKGLNIWRVTSEGMKNKGQQEKQFDAIAKCAILSSLGDNVFNRVFACENAKDLWKTISENHEGTKDVANKKYHILIDKFNSLKQL
Ga0268312_102836613300028248PhyllosphereMDSLEPPPQFDGTSFQRWKILMESHLQAKDLNVWRVTSEGMKNKGQQEKQFDAIAKCVILSSLDDKIFNRVFACENAKDLWKTIKENHEGTKDVANERYHVLIDKLNSFKQFD
Ga0268310_102825013300028262PhyllosphereMQSHLQAKGLNVWRVTNEGTKSNSEQEKQYDAIAKCAILNCLGENVFNRVFACENAKILXKTISENHEGTKDTANERYHVLIDKLNSFKQHDHENAETMYSLL
Ga0268325_10148413300028463PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDHENAETM
Ga0268317_101287713300028468PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLI
Ga0268327_100050323300028475PhyllosphereMDSLGPPPRFDGTGFQRWKISMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILSSLGENVFNRVFACENANVLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDHENAETM
Ga0268309_102012513300028477PhyllosphereMEAHLQATGLNVWRVVSEGTKSNSQQERQYDATTKSIILSSLNENVFNRVYSCENKKKLWKTIIENHEDTEDVANERYHVLIDRLNS
Ga0214492_100144123300032464Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGVKSNSQQERQYDAIAKCAILSSFGDTMFNRVFACENAKNLWKTICENHGGTKDVANENTMFS
Ga0214492_106009413300032464Switchgrass PhyllosphereMDSLEPPPRFDGTGFQRSKILMQSHIQAKGLNIWRVTNEGTKSNSQQKKQYDAIAKCAILYSLGENVFNRVFACENANVLWKTISENHEGTKDVANERYHVLIDKLNSFK
Ga0214492_107505113300032464Switchgrass PhyllosphereMSEGTKSNSQQERQYDAIAKCAILSSLGDIVFNRVFACKNAKELWKTICENHEGTKDVGEEKYHVLIDKLNSFKQLDHEN
Ga0214503_102019413300032466Switchgrass PhyllosphereLNICRVASEGMKKIGQQEKKYDIIAKCILLCSLDDNVFNRVFACENAKELWKTINENHGGTKDVTNE
Ga0214495_112268413300032490Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQSKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILNSLGENVFNRVFACENAKDLWKTSCENHEGTKVIANKKYLVLSVKLNSLKQLDQD
Ga0214502_124971813300032514Switchgrass PhyllosphereMQSNLQAKGLNICRVASEGMKKIGQQEKKYDIIAKCILLCSLDDNVFNRVFACENAKELWKTINENHGGTKDVTNE
Ga0214500_103337713300032589Switchgrass PhyllosphereGLNICRVASEGMKKIGQQEKKYDIIAKCILLCSLDDNVFNRVFACENAKELWKTINENHGGTKDVTNE
Ga0214500_120353713300032589Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKVLMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCDILNSLGENVFNLVFACENANVLWKTISENHEVTKDVAN
Ga0214489_107206213300032590Switchgrass PhyllosphereMDSLGPPSRFDDTAFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRVFACENANVLWKTINENHEGTKDVANERYHVA
Ga0214484_103697013300032591Switchgrass PhyllosphereMQAHLQATGLNVWRIVSECVKNNSQQEKQHDVTAKCIILSSLSDNIFNRVYSCENAKELWKTIIENHEGTEDVANEKYHVLIDNLNSFKQLNE
Ga0214484_112266513300032591Switchgrass PhyllosphereMDSLEPPPRFDGTGFQRWKILMQSHLQAKGLNIWRVTSKDMKNNDQQEKQFDAIAKCVILSSLEDNVFNRVFVXENAKELWKAINENHEGTKDVGEEKYHVLIDKLNSFKQLDHENT
Ga0321338_129928713300032593Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSEGVKNNSQQEKQNDVTAKCIILSSLSDNVFNHVYSCENTHKLWKAIIENHEDTDNVANERYHVLIDRLNSFKQLD
Ga0214497_112446913300032689Switchgrass PhyllospherePSELARLGEGMDSLGPPPRFNGTDFQRWKILIQSHLQAKGLNVWRVTSEGMKGKSQQEKQYDAIAKCAILSSLGDNVFNRVFAYENDKDLCKTISENHEGTKDVANEKYHVLIDKLNSFKQLDDENA
Ga0314753_106181213300032757Switchgrass PhyllosphereMQTHLQATGLNVWRVVSEGVKNNGQQEEQYDVTAKCIILSSLNDNVFNRVYSCANGKELWKTIIENHKGTEDVANERYHVLIDK
Ga0314746_111251913300032758Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCAILSSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVL
Ga0314744_108880313300032792Switchgrass PhyllosphereGLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSFSDNVFNRVFSCENAKKLWKTIIENHEGTEDVANERYHVLIDKLNRFK
Ga0314740_104922923300032822Switchgrass PhyllosphereGLNVWRVTSEGMKGKSQQEKQYDAIDKCAILSSFGDNVFNRVFACENAKDLWKTISENYEETKNIANEKYHVLIDKLNSFKQLDDENA
Ga0314727_101668113300032845Switchgrass PhyllosphereMDSLGPPSRFDDTAFQRWKILMQSHLQAKGLNVWRVTSEGTKSNGQQEKQYDAIAKCAILNSLGESVFNRVFACENANVLWKTISENHQGTKDVANERYHVAIDKLKSFK
Ga0314751_107117813300032889Switchgrass PhyllosphereMDSLGPPPRFDGTGFQRWKILIQSHLQAKGLNVWRVTSEGIKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENANVLWKTISENHE
Ga0314749_104270023300032915Switchgrass PhyllosphereMDFFRTAPRFDGTSFQRWKVLMQAHLQATCLNIWRVVSEGIKNDGHQEKQYDVTAKSIILSSLNENVFNRIYSCENDKKLWKTIIENHEGTEDVANERYHVLIDNLNSFKQLNE
Ga0314749_108353123300032915Switchgrass PhyllosphereWRVMSEGTKSNSQKERQYDAIAKCAILSSLGDIVFNRVFACKNAKELWKTICENHEGTKDVGEEKYHVLIDKLNSFKQLDHENTESMYS
Ga0314749_111223613300032915Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAITKCAILNSLGENVFNRVFACENAIVLWKTISENHEGTKDVANERYHVLIDK
Ga0314734_107311523300032916Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGTKSNNQQERQYDAIAKCTILNSLGENVFNRVFACENAKDLWKTISENHEGTKDVANEKYHVLIDKLNSFKQLDHENAE
Ga0314721_13092413300032917Switchgrass PhyllosphereMQAHLQAMGLNVWRVVSEGVKNNNQQGKQNDVTTKCIILSSLSDIVFNRVYSCENAKKLWQTIIENHEGMEDVANEIYHV
Ga0314738_104827623300032959Switchgrass PhyllosphereMDYLGPPSRFDDTAFQRWKILMQSHLQVKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRVFACKNTNVLWKTISENHEGTKDVANERYHVAI
Ga0314716_13348413300032970Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENGNVLWKTISENHEGTKDVAIKNYHVLIDKLNSFKQLDDESA
Ga0314761_103160223300033526Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGMKGKSQQEKQYDAIAKCAILSSLGDNVFNRVFACENAKDLWKTISENYEETKNIANEKYHVLIDKLNSFKQLDDENA
Ga0314767_111866323300033532Switchgrass PhyllosphereMDYLGPPSRFDDTAFQRWKILMQSYLQVKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRVFACKNANVLWKTISENHEGTKDVAN
Ga0314757_108283013300033534Switchgrass PhyllosphereMSEGTKSNSQKERQYDAIAKCAILSSLGDIVFNRVFACKNAKELWKTICENHEGTKDVGEEKYHVLIDKLNNFKQLDHENTESMYSR
Ga0314766_101816013300033537Switchgrass PhyllosphereMDYLGPPSRFDDTAFQRWKILMQSHLQVKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRVFACKNANVLWKTISENHEGTKDVAN
Ga0314755_113333113300033538Switchgrass PhyllosphereMDPFRPAPRFDGTGFQRWKILIQAHLQATCLNIWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNMFNRVYSCENAKELWKTIIENHEGTEDVANERYHVLIDKFNSFKQ
Ga0314755_116681423300033538Switchgrass PhyllosphereMQSHLQAKGLNVWRVTSEGMKGKSQQEKQYDVIAKCAILSSLGDNRVFACENSKDLWKPISENYEGTKYIANEKYHVLIDKLNSFKQLDDENA
Ga0314769_111329713300033542Switchgrass PhyllosphereMDSLGPPSRFDDTAFQRWKILMQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGESVFNRVFACKNANVLWKTISENHEGTKDVAN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.