NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035383

Metagenome / Metatranscriptome Family F035383

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035383
Family Type Metagenome / Metatranscriptome
Number of Sequences 172
Average Sequence Length 100 residues
Representative Sequence MSSSSPEHTAVRSPSENCARIKELGYIVGKHINLYGEHMELVSDPFEEGDCVAVHAISSSNPTVRTIELPVSILAGWEDLFQELANPTASELTAKTPLPGPAE
Number of Associated Samples 126
Number of Associated Scaffolds 172

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.57 %
% of genes near scaffold ends (potentially truncated) 29.07 %
% of genes from short scaffolds (< 2000 bps) 67.44 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.488 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(18.023 % of family members)
Environment Ontology (ENVO) Unclassified
(47.674 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.535 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.03%    β-sheet: 19.08%    Coil/Unstructured: 64.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 172 Family Scaffolds
PF00072Response_reg 2.33
PF13545HTH_Crp_2 2.33
PF00005ABC_tran 2.33
PF00689Cation_ATPase_C 2.33
PF00702Hydrolase 1.74
PF00144Beta-lactamase 1.74
PF08240ADH_N 1.74
PF04191PEMT 1.16
PF01850PIN 1.16
PF00563EAL 1.16
PF02517Rce1-like 1.16
PF00224PK 1.16
PF00690Cation_ATPase_N 1.16
PF08241Methyltransf_11 1.16
PF07883Cupin_2 1.16
PF01790LGT 0.58
PF05532CsbD 0.58
PF00582Usp 0.58
PF00501AMP-binding 0.58
PF13432TPR_16 0.58
PF08666SAF 0.58
PF00034Cytochrom_C 0.58
PF13439Glyco_transf_4 0.58
PF13346ABC2_membrane_5 0.58
PF00027cNMP_binding 0.58
PF00486Trans_reg_C 0.58
PF02698DUF218 0.58
PF14559TPR_19 0.58
PF13460NAD_binding_10 0.58
PF03861ANTAR 0.58
PF03965Penicillinase_R 0.58
PF13560HTH_31 0.58
PF13181TPR_8 0.58
PF03706LPG_synthase_TM 0.58
PF13533Biotin_lipoyl_2 0.58
PF13683rve_3 0.58
PF00487FA_desaturase 0.58
PF07690MFS_1 0.58
PF13231PMT_2 0.58
PF05157T2SSE_N 0.58
PF12867DinB_2 0.58
PF13567DUF4131 0.58
PF03786UxuA 0.58
PF00459Inositol_P 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 172 Family Scaffolds
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 3.49
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.74
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.74
COG2367Beta-lactamase class ADefense mechanisms [V] 1.74
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 1.16
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 1.16
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 1.16
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 1.16
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 1.16
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 1.16
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 1.16
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.58
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.58
COG1312D-mannonate dehydrataseCarbohydrate transport and metabolism [G] 0.58
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.58
COG1434Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 familyCell wall/membrane/envelope biogenesis [M] 0.58
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.58
COG2949Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycinCell wall/membrane/envelope biogenesis [M] 0.58
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.58
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.58
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 0.58
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.49 %
UnclassifiedrootN/A21.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004082|Ga0062384_100814584Not Available653Open in IMG/M
3300004152|Ga0062386_101414019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7579Open in IMG/M
3300005435|Ga0070714_100199372Not Available1830Open in IMG/M
3300005435|Ga0070714_101268258Not Available719Open in IMG/M
3300005529|Ga0070741_10678318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7911Open in IMG/M
3300005534|Ga0070735_10012009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6569Open in IMG/M
3300005534|Ga0070735_10462926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7757Open in IMG/M
3300005538|Ga0070731_10013157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5986Open in IMG/M
3300006176|Ga0070765_100121570All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2290Open in IMG/M
3300006176|Ga0070765_100663334Not Available985Open in IMG/M
3300006804|Ga0079221_10075945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp.1584Open in IMG/M
3300009623|Ga0116133_1040793All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus necator1149Open in IMG/M
3300009624|Ga0116105_1053517Not Available932Open in IMG/M
3300009624|Ga0116105_1081919All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7785Open in IMG/M
3300009624|Ga0116105_1105872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7708Open in IMG/M
3300009635|Ga0116117_1092143Not Available756Open in IMG/M
3300009640|Ga0116126_1178418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7695Open in IMG/M
3300009643|Ga0116110_1197684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7653Open in IMG/M
3300009644|Ga0116121_1174342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7681Open in IMG/M
3300009665|Ga0116135_1169460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7823Open in IMG/M
3300010152|Ga0126318_10576603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola985Open in IMG/M
3300010339|Ga0074046_10775027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7561Open in IMG/M
3300010339|Ga0074046_10861763Not Available528Open in IMG/M
3300010373|Ga0134128_10599566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71226Open in IMG/M
3300010379|Ga0136449_100339940All Organisms → cellular organisms → Bacteria2706Open in IMG/M
3300010396|Ga0134126_10547071All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300011120|Ga0150983_11604188Not Available745Open in IMG/M
3300011120|Ga0150983_13393621All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia541Open in IMG/M
3300011411|Ga0153933_1004297All Organisms → cellular organisms → Bacteria → Acidobacteria3833Open in IMG/M
3300013307|Ga0157372_11157724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7894Open in IMG/M
3300014151|Ga0181539_1336444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7548Open in IMG/M
3300014153|Ga0181527_1119290Not Available1204Open in IMG/M
3300014153|Ga0181527_1360622Not Available561Open in IMG/M
3300014155|Ga0181524_10020126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium4917Open in IMG/M
3300014167|Ga0181528_10040024All Organisms → cellular organisms → Bacteria2629Open in IMG/M
3300014167|Ga0181528_10280027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7901Open in IMG/M
3300014167|Ga0181528_10674043Not Available576Open in IMG/M
3300014168|Ga0181534_10556210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7655Open in IMG/M
3300014169|Ga0181531_10014691All Organisms → cellular organisms → Bacteria → Acidobacteria4488Open in IMG/M
3300014199|Ga0181535_10002835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae20658Open in IMG/M
3300014199|Ga0181535_10006595All Organisms → cellular organisms → Bacteria11912Open in IMG/M
3300014199|Ga0181535_10586124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7640Open in IMG/M
3300014200|Ga0181526_10034255All Organisms → cellular organisms → Bacteria3274Open in IMG/M
3300014489|Ga0182018_10036383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA73089Open in IMG/M
3300014493|Ga0182016_10000030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae146014Open in IMG/M
3300014493|Ga0182016_10025787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685083Open in IMG/M
3300014495|Ga0182015_10011195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8097Open in IMG/M
3300014496|Ga0182011_10089977All Organisms → cellular organisms → Bacteria2145Open in IMG/M
3300014498|Ga0182019_10224382All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71225Open in IMG/M
3300014501|Ga0182024_10290580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2167Open in IMG/M
3300014638|Ga0181536_10340900Not Available684Open in IMG/M
3300014838|Ga0182030_10000315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae85886Open in IMG/M
3300014839|Ga0182027_10000705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae57009Open in IMG/M
3300014839|Ga0182027_10695723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71078Open in IMG/M
3300017935|Ga0187848_10059343All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71817Open in IMG/M
3300017935|Ga0187848_10280690Not Available698Open in IMG/M
3300017946|Ga0187879_10540725Not Available647Open in IMG/M
3300017948|Ga0187847_10013167All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5366Open in IMG/M
3300017948|Ga0187847_10031605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3146Open in IMG/M
3300017948|Ga0187847_10390299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7764Open in IMG/M
3300017948|Ga0187847_10731716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia557Open in IMG/M
3300017988|Ga0181520_10006030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae18837Open in IMG/M
3300017988|Ga0181520_10180584All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1679Open in IMG/M
3300017988|Ga0181520_10272836Not Available1281Open in IMG/M
3300017996|Ga0187891_1002718All Organisms → cellular organisms → Bacteria13144Open in IMG/M
3300017996|Ga0187891_1098165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71111Open in IMG/M
3300018002|Ga0187868_1314415All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7514Open in IMG/M
3300018003|Ga0187876_1054855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71624Open in IMG/M
3300018008|Ga0187888_1357765Not Available555Open in IMG/M
3300018014|Ga0187860_1049977All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2120Open in IMG/M
3300018014|Ga0187860_1264891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7677Open in IMG/M
3300018016|Ga0187880_1173840All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7994Open in IMG/M
3300018016|Ga0187880_1261508All Organisms → cellular organisms → Bacteria → Acidobacteria759Open in IMG/M
3300018025|Ga0187885_10507960All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7537Open in IMG/M
3300018030|Ga0187869_10595371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7523Open in IMG/M
3300018034|Ga0187863_10002616All Organisms → cellular organisms → Bacteria13599Open in IMG/M
3300018034|Ga0187863_10007183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia7545Open in IMG/M
3300018035|Ga0187875_10662158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7549Open in IMG/M
3300018037|Ga0187883_10614581Not Available564Open in IMG/M
3300018037|Ga0187883_10722300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7520Open in IMG/M
3300018038|Ga0187855_10510776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii700Open in IMG/M
3300018038|Ga0187855_10569963Not Available659Open in IMG/M
3300018042|Ga0187871_10083110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71864Open in IMG/M
3300018043|Ga0187887_10070432All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72123Open in IMG/M
3300018046|Ga0187851_10059043All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2476Open in IMG/M
3300018047|Ga0187859_10069461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71856Open in IMG/M
3300019082|Ga0187852_1067378All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300019787|Ga0182031_1287941Not Available583Open in IMG/M
3300019788|Ga0182028_1189947All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. EB881521Open in IMG/M
3300020582|Ga0210395_10055246Not Available2909Open in IMG/M
3300020582|Ga0210395_10245153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 831346Open in IMG/M
3300020582|Ga0210395_11127365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7578Open in IMG/M
3300020583|Ga0210401_11423064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7551Open in IMG/M
3300021180|Ga0210396_10402046All Organisms → cellular organisms → Bacteria → Acidobacteria1204Open in IMG/M
3300021180|Ga0210396_10897117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7756Open in IMG/M
3300021401|Ga0210393_10613425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7888Open in IMG/M
3300021403|Ga0210397_10246365All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300021404|Ga0210389_11076414All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7622Open in IMG/M
3300021405|Ga0210387_10513867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1065Open in IMG/M
3300021406|Ga0210386_10351732All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300021407|Ga0210383_10962516All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300021420|Ga0210394_10472802All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300021420|Ga0210394_10881928All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7779Open in IMG/M
3300021433|Ga0210391_10833356All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7720Open in IMG/M
3300021479|Ga0210410_11519354Not Available563Open in IMG/M
3300022861|Ga0224528_1000258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE006844142Open in IMG/M
3300023088|Ga0224555_1000744All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae49636Open in IMG/M
3300023090|Ga0224558_1018942All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3586Open in IMG/M
3300023090|Ga0224558_1042868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1923Open in IMG/M
3300023250|Ga0224544_1017684Not Available979Open in IMG/M
3300024295|Ga0224556_1002066All Organisms → cellular organisms → Bacteria5685Open in IMG/M
3300025928|Ga0207700_11433995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7613Open in IMG/M
3300025929|Ga0207664_10005024All Organisms → cellular organisms → Bacteria8998Open in IMG/M
3300025929|Ga0207664_10131328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2108Open in IMG/M
3300025929|Ga0207664_11165166Not Available688Open in IMG/M
3300026078|Ga0207702_11370661All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7701Open in IMG/M
3300026142|Ga0207698_11424064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7708Open in IMG/M
3300027879|Ga0209169_10265281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7900Open in IMG/M
3300027908|Ga0209006_10181249All Organisms → cellular organisms → Bacteria1837Open in IMG/M
3300027986|Ga0209168_10005711All Organisms → cellular organisms → Bacteria → Acidobacteria7999Open in IMG/M
3300028087|Ga0255354_1051297Not Available877Open in IMG/M
3300028090|Ga0255349_1069515Not Available674Open in IMG/M
3300028566|Ga0302147_10035620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis1785Open in IMG/M
3300028747|Ga0302219_10199083Not Available773Open in IMG/M
3300028798|Ga0302222_10155629All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7900Open in IMG/M
3300028800|Ga0265338_10001506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae37692Open in IMG/M
3300028906|Ga0308309_10707161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7876Open in IMG/M
3300029882|Ga0311368_10289942All Organisms → cellular organisms → Bacteria1245Open in IMG/M
3300029919|Ga0302141_1211094Not Available527Open in IMG/M
3300029920|Ga0302142_1272364Not Available510Open in IMG/M
3300029943|Ga0311340_10248715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas ginsenosidivorax1738Open in IMG/M
3300029944|Ga0311352_10396461Not Available1131Open in IMG/M
3300029952|Ga0311346_10541122All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300029956|Ga0302150_10215740All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300029999|Ga0311339_11244930Not Available678Open in IMG/M
3300030057|Ga0302176_10375432All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7573Open in IMG/M
3300030399|Ga0311353_10020632All Organisms → cellular organisms → Bacteria7280Open in IMG/M
3300030503|Ga0311370_11729256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7640Open in IMG/M
3300030580|Ga0311355_10396669All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300030580|Ga0311355_11060704All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7724Open in IMG/M
3300031053|Ga0074018_1772518All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7540Open in IMG/M
3300031234|Ga0302325_12771458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7575Open in IMG/M
3300031236|Ga0302324_100108623All Organisms → cellular organisms → Bacteria4672Open in IMG/M
3300031236|Ga0302324_100657088All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300031259|Ga0302187_10086390All Organisms → cellular organisms → Bacteria1825Open in IMG/M
3300031261|Ga0302140_10243255All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300031524|Ga0302320_10064917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6269Open in IMG/M
3300031524|Ga0302320_11808022Not Available582Open in IMG/M
3300031525|Ga0302326_11110196All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71098Open in IMG/M
3300031670|Ga0307374_10002419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae33200Open in IMG/M
3300031712|Ga0265342_10123997All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300032739|Ga0315741_11773788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7546Open in IMG/M
3300032756|Ga0315742_11974872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7648Open in IMG/M
3300033402|Ga0326728_10001091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae98573Open in IMG/M
3300033402|Ga0326728_10029623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9371Open in IMG/M
3300033402|Ga0326728_10102455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3442Open in IMG/M
3300033402|Ga0326728_10145865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2590Open in IMG/M
3300033402|Ga0326728_10151678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2509Open in IMG/M
3300033402|Ga0326728_10578360Not Available883Open in IMG/M
3300033405|Ga0326727_10017910All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae14576Open in IMG/M
3300033405|Ga0326727_11124551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7556Open in IMG/M
3300033887|Ga0334790_019611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3084Open in IMG/M
3300033887|Ga0334790_022458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2798Open in IMG/M
3300033888|Ga0334792_009810All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA73860Open in IMG/M
3300033983|Ga0371488_0040357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3018Open in IMG/M
3300034065|Ga0334827_049694All Organisms → cellular organisms → Bacteria → Proteobacteria1549Open in IMG/M
3300034163|Ga0370515_0272983Not Available716Open in IMG/M
3300034282|Ga0370492_0003180All Organisms → cellular organisms → Bacteria → Acidobacteria6620Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland18.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.47%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog9.88%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.30%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil6.98%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.23%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.23%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil5.23%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.49%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.33%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.91%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.74%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.16%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.16%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.16%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.16%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.16%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.16%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.16%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.16%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.58%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.58%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.58%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.58%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.58%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011411Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022861Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028087Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T50EnvironmentalOpen in IMG/M
3300028090Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v15EnvironmentalOpen in IMG/M
3300028566Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029919Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2EnvironmentalOpen in IMG/M
3300029920Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031053Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062384_10081458423300004082Bog Forest SoilMYSSSPEHKAVSSPSENCTRIKKLGYIVGKHMNLYGEHLELVSDPFVEDDCVAVHVISSSNPTVRRIKLPVSILAGWEDLFQELANPTASELTATTRLPGPAEAQ*
Ga0062386_10141401923300004152Bog Forest SoilVRSPSENCARIKKLGYIVGKHVNLYGEHMELVSDPFEEGDGIAVRAVSASDPTERTIDLPVSLLSGWEDLFEEPADPIASELPAKAPLPGSARQTA*
Ga0070714_10019937213300005435Agricultural SoilMSISSPAHAVVRSPSAKCARIKELGYIAGKHVNLYGERMEFVSDPFEDGDCVAVLAVSTTNPTLRTINLPVSILPLWEDLLPKLANPPAPELTAMAPPSRADGTTAA*
Ga0070714_10126825813300005435Agricultural SoilMSFSSPEHIDARSSCDNCARIKKLGYVAGKHVDLYGEHLELVSDPFEEGDFVAVHAFSSSNTTVRTIKLPVSILTGWEDLFQ*
Ga0070741_1067831813300005529Surface SoilMSLSSPDHIVLRSPCENCARIKKLGYVAGKHMDLYGEHMELVSDPFEEGDCVAVHAFSSSNTTVRTIKLPVSILTGWEDLFQ*
Ga0070735_1001200943300005534Surface SoilMSISSPEHAVVRSPSKCARIKELGYIPGKHVNLYGERMEFVSDPFEDGDCVAVLAFSTTNSTVRTINLPVYILSFWEDLLPTLATLPAPKLTVMASLSRTEGTAPA*
Ga0070735_1046292623300005534Surface SoilMSISSPAHAVVRSPSAKCARIKELGYIAGKHMNLYGERMEFVSDPFEDGDCVAVRAFSTTSPTVRTINLPISILPLWEDLLPKLANPPAPELTAMAPPSRADGTTAA*
Ga0070731_1001315733300005538Surface SoilMSFSSPEPVAAHSLSENCERIRKLGYIVGKHMNLYGEHMELVSDPFVEGDCVAVHAISSSNSTVRTIELPVSILAGWEELFQELADPAASELTVKTSLPGSAEAE*
Ga0070765_10012157023300006176SoilMSSSSPEPRAVRSPSENCTRIKSLGYIVGKHMNLYGEHMEMVSDPFVEGDCVAVHAISSSNPTVRTIELPVSILAGWEDLFQELADPTASEFPAKIPLPEAAGRRRSKP*
Ga0070765_10066333423300006176SoilMYSSSLEHKAVSSPSENCTRIKKLGYIVGKHMNLYGEHMELVSDPFVEDDCVAVHAISSSDPTVRRIKLPVSILAGWEDLFRELANPTASELTATTRLPGPAEAQ*
Ga0079221_1007594513300006804Agricultural SoilMSISSPAHAAVRSPSAKCARIKELGYIAGKHVNLYGERMEFVSDPFDDGDCVAVLAVSTTNPTLRTINLPVSILPLWEDLLPKLANPPAPELTAMAPPSRADGTTAA*
Ga0116133_104079323300009623PeatlandMSSSSPEPIAVRSPSESCARIRKLGYIVGKHMNLYGEHMELVSDPFVEGDCVAVHAISSGNSTVRTIDLPVSILAGWDNLFHELADPTASELTAKTPLPGPAAAE*
Ga0116105_105351713300009624PeatlandMSSSSTEHIAVHSPSENCARIKKLGYVSGKHMNLYGEHMKLVSDPFDEGDCVAVHAISSSDPSVRTIELPVSLLAGWEDLFQELANPTASELTAKTPLPGSAGTEPE*
Ga0116105_108191923300009624PeatlandFTPPRYLMSVSSQESIAVRSPAENCARIRKLGYIAGKHVNLYGEHMELVSDPFVEGDCVAVHAISSSNPTIRTIDLPVSILAGWEDLFHNLASPTASELTRKTPGPGPAEAE*
Ga0116105_110587223300009624PeatlandMSQAPKHKSSPEPIAVRSTAENCARIKKLGYVAGKHLDLYGEHFELVSDPFEEGDCVAVHAISESHPIERTIELPISILAGWEDLFEEPADPADSLLPAKTQPAKFSA*
Ga0116117_109214313300009635PeatlandMSSSTIEPKAVRTPSENCARMKKLGYIVGKHVNLYGEHIELVSDPFEDGKCVAVHVISGSNPTKRMIDLPVTLLSGWDDLFLKPVDSAV*
Ga0116126_117841813300009640PeatlandMSSSSAEPTTARSPAQNCARIKKLGYTVGKRVDLYGEHVELVSDPFEEGDCVAVRAISGNNPTERTIELPVTLLSGWEGLFEEPADPAASELPAKTPLPASAG*
Ga0116110_119768413300009643PeatlandMSSSSAEPTTARSPAQNCARIKKLGYTVGKRVDLYGEHVELVSDPFEEGDCVAVRAISGNNPTERTIELPVTLLSGWEDLFEEPADPAASELRAKT
Ga0116121_117434213300009644PeatlandMSSSSPEPMSVLSSSENCARIKKPGYIVGKHLDLYGEHIELVSDPFVEGDCVAVHAISGNNPTVRTIDLPQSLLAGWEDLFQEPADPTASELTAKTPLPGSADKKRSNP*
Ga0116135_116946023300009665PeatlandMSSSSPGHIAVRSPAENCSRIKKLGYIVGKHMNLYGEHMELVSDPFEEGDCVAVRAVSEGNPTERTIDLPVSILAGWEDLFEELAGPTASELPAKAPLPGSAGQTE*
Ga0126318_1057660333300010152SoilYMSISSPAHAVVRSPSAKCARIKELGYIAGKHVNLYGERMEFVSDAFWHGDCVAVLAFRTTNPAVRPVNLAISILSFWEDLVPKPATLLAPELAMAPLSRIEGTEPA*
Ga0074046_1077502713300010339Bog Forest SoilMPSSSPEHIAVRSPSENCARIKKLGYIVGKHMNLYGEHMELVSDPFEQGDCVAVHAISGSNPAVRTIELPVSILAGWEDLFQELANPTASELTTNTPLPRSSGTEPE*
Ga0074046_1086176323300010339Bog Forest SoilMSSSPIELTAVRTPSENCARIKELGFVVGKHVSLYGEHMELVSDPFDDGECVAVQVVSGENPTVRTVDLPVTLLSGWEELFLDSEDPAASELPAAKLLPGSAGQKPE*
Ga0134128_1059956623300010373Terrestrial SoilMSISSPAHAAVRSPSAKCARIKELGYIAGKHVNLYGERMEFVSDPFDDGDCVAVLAVSTTNPTVRTISLPVSILSFWEDLLPKLAPLPAPELTAIGSTFSD*
Ga0136449_10033994023300010379Peatlands SoilMSSPEPEHIAVQSPSNDCARIKKLGYIVGKHVDLYGEHMELVSDPFEEGDCVAVRAVSESNPTERTIDLPVSLLSGWEDLFEEPADPTASELTAKTPFPGSAEQSRSNS*
Ga0134126_1054707123300010396Terrestrial SoilMSISSPAHAVVRSPSAKCARIKELGYIAGKHMNLYGERMEFVSDPFDDGDCVAVLAVSTTNPTVRTISLPVSILSFWEDLLPKLAPLPA
Ga0150983_1160418813300011120Forest SoilAEIIMSPASKISSPPRCHMYSSSLEHKAVSSPSENCTRIKKLGYIVGKHMNLYGEHMELVSDPFVEDDCVAVHAISSSNPTVRRIKLPVSILAGWEDLFQELANPTASELTATTRLPGPAEVQ*
Ga0150983_1339362123300011120Forest SoilLSLSTIEPIAVRTATENCARVRKLGYIVGKHMNLYGERIRLVSEPFADGECVAVRAVSESNPIVRTFDLPMTLLSGWEDLIPEPVEPSVS*
Ga0153933_100429733300011411Attine Ant Fungus GardensMPSSEPKAERSPSENCARIKKLGYISGKHMDLYGEHIELVSDPFEEGDNVAVRAVSENNPAVRTIDLPVSILSGWEDLFHELADPTASELTAKTPLPGSAGRRRSKP*
Ga0157372_1115772423300013307Corn RhizosphereMSISSPAHAVVRSPSAKCARIKELGYIAGKHMNLYGERMEFVSDPFEDGDCVAVRAFSTTNPTVRTINLPISILPLWEDLLPKRATPPAPERTAMAPPSRADGTTAA*
Ga0181539_133644423300014151BogMSSSSAEPTTARSPAQNCARIKKLGYTVGKRVDLYGEHVELVSDPFEEGDCVAVRAISGNNPTERTIELPVTLLSGWEGLFEE
Ga0181527_111929023300014153BogMSSRKPKAARSPSENCARIKKLGYIVGKHVNLYGEHMELVSDPFEEGECVAVRAVSGSNPTERTIDLPVTLLSGWEDLFEGPADPTASEFPAKTPLPAPAGQTG*
Ga0181527_136062223300014153BogSSSPLDPKAVRTPSENCARIKKLGYTVGKHVYLYGEHIELVSDPFEDGKCVAVHVVSEPNPTERTIDLPVTLLSGWEDLFLKPADPTAAALPA*
Ga0181524_1002012613300014155BogMSSISLDPVAVRMPSENCTRIKKLGYVVGKHFNLYGEHIELVSDPFEDGECVAVHVISGNNPTVRTIDLPVTLLSGWEDLFLEAADPTASELPAKTLLPGSAEQSRSNHNL*
Ga0181528_1004002423300014167BogMSSSEPTAVRSPSENCARIKKLGYIVGKHVNLYGEHMELVSDPFEEGDCIAVRAVSAGNPIERTIDLPVSLLSGWEDLFEKGADPIANELPAKNSPS*
Ga0181528_1028002723300014167BogMSSSSPEQVAVHSPSENCARIKKLGYIAGKHMNLYGEHMELVSDPFVEGECVAVHAISSSNPIVRTIDLPVSILAGWEDLFQKLANATEKR*
Ga0181528_1067404313300014167BogIPEPIAVRTPAENCARIKKLGYIVGKHVNLYGEHIELVSDPFEDGACVAVQVVSGNNPTERTIDLPLTLLSGWADLIPEPPNPSASEFPVKVPR*
Ga0181534_1055621013300014168BogTAVRSPSENCARIKKLGYIVGKHVNLYGEHMELVSDPFEEGDCIAVRAVSAGNPIERTIDLPVSLLSGWEDLFEKGADPIANELPAKNSPS*
Ga0181531_1001469153300014169BogMSASEPTAVRSSSENCERIKKLGYIVGKHVNLYGEHMELVSDPFEEGDSIAVRAVSASNPTERTIDLPVSLLSGWEELFQEPADPTAWEQVSKSAV*
Ga0181535_10002835183300014199BogMSSPESTGVSTPAENCARIKKLGYIAGKHIDLYGEHVELVSDPFEDGDCVAVRAISGNDPTERTIDLPVTLLSGWEDLFDEPADPTASELPAQAPVPEPVG*
Ga0181535_1000659543300014199BogMSSSSTEHIAVHSPSENCARIKKLGYVSGKHMNLYGEHMKLVSDPFDEGACVAVHAISSSDPTVRTIELPVSLLAGWEDLFQELANPTASELTAKTPLPGSAGTEPE*
Ga0181535_1058612423300014199BogMLSSSLEHKSLRSPSENCAHIKKLGYIAGKHMNLYGEHMELVSDPFVEGDCVAVHAISSSNHNVRTIDLPILILAGWEDLFQQPTNLEVMVAQIPLQIRR*
Ga0181526_1003425533300014200BogMSSPEPTDVRSPAENCARIKKLGYIAGKHMNLYGEHMELVSDPFEEGQCVAVRAVSGSDPTERTIDLPVSLLSGWEELLAEHADPDASEPAAKTPLPRSAK*
Ga0182018_1003638343300014489PalsaMSSSSPEHTAVRSPSENCARIKELGYIVGKHMNLYGEHMELVSDPFEEGDCVAVHAISSSNPTVRTIELPVSILAGWEDLFQELANPTASELTAKTPLPGPAEQSRSEPQL*
Ga0182016_10000030393300014493BogMSVSSQESIAVRSLAENCARIRKLGYIAGKHVNLYGEHMELVSDPFVEGDCVAAQAISSSNRTVRTIDLPVSILAGWEDLFQKLAEPTESELTAETPLPASAEAR*
Ga0182016_1002578723300014493BogMSSSPPQHIAVRSPSENCAHIKKLGYITGKHMNLYGEHMELVSDPFEAGKCVAVQAISSSNPIVRTIELPISILAGWEDLFQDLANRAASELAAKTPLPGFAGPSQTPLQL*
Ga0182017_1019214013300014494FenMSSSSAEPIAARSPAENCSRIKKLGYIVGKHVDLYGEHVELVSDPFEEGDCVAVRAVSGNNPTERTIELPVTLLSG
Ga0182015_1001119523300014495PalsaMSSSSPEPIAVRSSSENCIRIRELGYIVGKHVNLYGEHMELVSDPFVEGDCVAVHAISSSNPTIRTIDLPVSILAGWEDLFHNLASPTASELTRKTPGPGPAEAE*
Ga0182011_1008997713300014496FenPTAVRSPAENCARIKKLGYVVGKHVDLYGEHVELVSDPFEEGDCVAVRAVSGNDPTERTIDLPVTLLSGWEDLFEEPADPTASELPAQTPIPEPVG*
Ga0182019_1022438223300014498FenMSSSSAEPIAARSPAENCARIKKLGYIVGKHVDLYGEHVELVSDPFEEGDCVAVRAVSGNNPTERTIELPVTLLSGWEDLFEEPADPTASELPAQAPLPEAAG*
Ga0182024_1029058033300014501PermafrostMSSSEPMAVRSTAENCARIKKLGYIAGKHMDLYGEHLELVSDPFEEGDCVAVHAVSESNPTERTVELPISILAGWEALFQEPADPADSELPAKTQPAELST*
Ga0181536_1034090013300014638BogENCTRIKKLGYVVGKHFNLYGEHIELVSDPFEDGECVAVHVISGNNPTVRTIDLPVTLLSGWEDLFLEAADPTASELPAKTLLPGSAEQSRSNHNL*
Ga0182030_10000315593300014838BogMSSSSAEPIAVRSPAENCARIKKLGYIVGKHVDLYGEHVELVSDPFEEGDCVAVRAVSGNNPTERTIDLPVTLLSGWEDLFEEPADSSASEVPAKTSLPEPAG*
Ga0182027_10000705523300014839FenMSSTSAEPTAVRSPAENCARIKKLGYVVGKHVDLYGEHVELVSDPFEEGDCVAVRAVSGNDPTERTIDLPVTLLSGWEDLFEEPADPTASELPAQTPIPEPVG*
Ga0182027_1069572313300014839FenMPSSPPEPTALHSPSENCTRINKLGYIVGKHVNLYGEHMELVSDPFVEGECVAVHAISSNNPTIRTINLPVSLLAGWEDLFQELADHTAWDPTAKTPPPGPVGPS*
Ga0187848_1005934323300017935PeatlandMSSSSAEPTTARSPAQNCARIKKLGYTVGKRVDLYGEHVELVSDPFEEGDCVAVRAISGNNPTERTIELPVTLLSGWEGLFEEPADPAASELRAKTPLPEPAEK
Ga0187848_1028069013300017935PeatlandCRLAAEIIKWHQNLHAAEVPPMSSSSTEHIAVHSPSENCARIKKLGYVSGKHMNLYGEHMKLVLDPFDEGDCVAVHAISSSDPTVRTIELPVSLLAGWEDLFQELANPTASELTAKTPLPGSAGTEPE
Ga0187879_1054072513300017946PeatlandEIIKWHQNLHAAEVPPMSSSSTEHIAVHSTSENCARIKKLGYVSGKHMNLYGEHMKLVSDPFDEGDCVAVHAISSSDPSVRTIELPVSLLAGWEDLFQEPADPTASELTAKTPLPGSADKKRSNP
Ga0187847_1001316733300017948PeatlandMSSSSTEHIAVHSPSENCARIKKLGYVSGKHMNLYGEHMKLVSDPFDEGDCVAVHAISSSDPSVRTIELPVSLLAGWEDLFQELANPTASELTAKTPLPGSAGTEPE
Ga0187847_1003160523300017948PeatlandMSSSTIEPKAVRTPSENCARMKKLGYIVGKHVNLYGEHIELVSDPFEDGKCVAVHVISGSNPTKRMIDLPVTLLSGWDDLFLKPVDSAV
Ga0187847_1039029913300017948PeatlandMSSSEPTAVRSPSENCARIKKLGYIVGKHVNLYGEHMELVSDPFEEGDCIAVRAVSAGNPIERTIDLPVSLLSGWEDLFEKGADHIANELPAKNSPS
Ga0187847_1073171613300017948PeatlandLSLSSTEPIVVRTPQENCARIKKLGYIAGKQVNLYGERIKLVSDPFEDGNCVAVRAVSGGNPTVRTFDLPMTLLSGWHELIPEVAEPAA
Ga0181520_10006030143300017988BogMSSPESTGVSTPAENCARIKKLGYIAGKHIDLYGEHVELVSDPFEDGDCVAVRAISGNDPTERTIDLPVTLLSGWEDLFDEPADPTASELPAQAPVPEPVG
Ga0181520_1018058423300017988BogMSSSSPEPIAVRSPSENCVRIRELGYIVGKHVNLYGEHMELVSDPFVEGDCVAVNAISSSNPTIRTIDLPVSILAGWEDLFHNLASPTASELTRKTPGPGPAEAE
Ga0181520_1027283633300017988BogGREYKCRLAAGIIDWRQNLLAAEVPMSSSSTEHKAVHSPSENCARIKKLGYVSGKHMNLYGEHMKLVSDPFDEGDCVAVHAISSSDPSVRTIELPVSLLAGWEDLFQELANPTASELTAKTPLPGSAGTEPE
Ga0187891_100271853300017996PeatlandMSSPESTDVRSPAENCARIKKLGYIVGKHVDLYGEHVELVSDPFEEGDCVAVRAVSGNNPTERTIELPVTLLSGWEDLFEEPADPTASELPAKPPLPASAG
Ga0187891_109816513300017996PeatlandMSSSSAEPTTARSPAQNCARIKKLGYTVGKRVDLYGEHVELVSDPFEEGDCVAVRAISGNNPTERTIELPVTLLSGWEDLFEEPADPAASELPAKTPLPASAG
Ga0187868_131441513300018002PeatlandMSSSSPEPMSVLSSSENCARIKKLGYIVGKHVDLYGEHVELVSDPFEEGDCVAVRAVSGNNPTERTIELPVTLLSGWEDLFEEPADPAASELRAKTPLPEPAEK
Ga0187876_105485523300018003PeatlandMSSSSAEPTTARSPAQNCARIKKLGYTVGKRVDLYGEHVELVSDPFEEGDCVAVRAISGNNPTERTIELPVTLLSGWEDLFEEPADPAASELRAKTPLPEPAEK
Ga0187888_135776513300018008PeatlandMSPSSLKTKAVRTLSENCARIKKLGYIVGKHVNLYGEHIELVSDPFEDGECVAVHAVSGNNPTVRTIDLPVTLLSGWEDLLSESADPTALKPVS
Ga0187860_104997723300018014PeatlandMSSISLDPVAVRMPSENCTRIKKLGYVVGKHFNLYGEHIELVSDPFEDGECVAVHVISGNNPTVRTIDLPVTLLSGWEDLFLEAADPTASELPAKTLLPGSAEQSRSNHNL
Ga0187860_126489113300018014PeatlandMSSSSAEPTTARSPAQNCARIKKLGYTVGKRVDLYGEHVELVSDPFEEGDCVAVRAISGNNPTERTIELPVTLLSGWEDLFEEPADPAASELRAKTPLPEP
Ga0187880_117384013300018016PeatlandMSSSSAEPTTARSPAQNCARIKKLGYTVGKRVDLYGEHVELVSDPFEEGDCVAVRAISGNNPTERTIELPVTLLSGWEGLFEEPADPAASELPAKTPLPASAG
Ga0187880_126150813300018016PeatlandPPRCPIFSSSLSAEPSDVRSPAENCARIKKLGYIAGRHVNLYGEHMELVSDPFEDGECVGVRAVSGNNPTERTIDLPLSLLSGWQDLFEEPADPSASELPAKDPLPEPVEQ
Ga0187885_1050796013300018025PeatlandMSSSEPTAVRSPSENCARIKKLGYIAGKHVNLYGEHIELVSDPFEDGECVAVHAVSGNNPTVRTIELPVTLLSGWEDVLPESADPTA
Ga0187869_1059537113300018030PeatlandMSSSEPTAVRSPSENCARIKKLGYVEGKHVNLYGEHMELVSDPFEEGDCVAVRAVSEGNPTERTIDLPVSILAGWEDLFEELAGPTASELPAKAPLPGSAGQTE
Ga0187863_10002616133300018034PeatlandMSSSSTEHIAVHSPSENCARIKKLGYVSGKHMNLYGEHMKLVSDPFDEGDCVAVHAISSSDPTVRTIELPVSLLAGWEDLFQELANPTASELTAKTPLPGSAGTEPE
Ga0187863_1000718363300018034PeatlandMSSSEPTAVRSPSENCARIKKLGYIVGKHVNLYGEHMELVSDPFEEGDCIAVRAVSAGNPIERTIDLPVSLLSGWEDLFEKGADPIANELPAKNSPS
Ga0187875_1030688313300018035PeatlandMSSSAEPTAVRTPAENCARIKKLGYIAGKHVDLYGEHVELVSDPFAEGDCVAVRAVSGNNPTERTIELPITLLCRLGGSV
Ga0187875_1066215813300018035PeatlandMSSSSPEPMSVLSSSENCARIKKLGYIVGKHLDLYGERIELVSDPFVEGDCVAVHAISGNNPTVRTIDLPQSLLAGWEDLFQELANPTASELTAKT
Ga0187883_1061458113300018037PeatlandSSSAGPIAARSPAENCSRIKKLGYVVGKHVDLYGEHIELVSDPFEKGGCVAVRAVSGNNPTERTIELPVTLLSGWQDLFEEPADPTASEHPARTPLPASAG
Ga0187883_1072230013300018037PeatlandMSSSSPEPIAVRSPSESCARIRKLGYIVGKHMNLYGEHMELVSDPFVEGDCVAVHAISSGNSTVRTIDLPVSILAGWDNLFQELADPTASELTAKTPLPGPAAAE
Ga0187855_1051077623300018038PeatlandMSSSSLLPKAVRTLSENCARIKKLGYIVGKHVNLYGEHIELVSDPFEDGECIAVHAVSGDNPTVRTIDLPVTLLSGWEDLLPESADPTA
Ga0187855_1056996313300018038PeatlandMSSSSSSAGPIAARSPAENCSRIKKLGYVVGKHVDLYGEHIELVSDPFEKGGCVAVRAVSGNNPTERTIELPVTLLSGWQDLFEEPAD
Ga0187871_1008311023300018042PeatlandMSSSEPTAVRSPSENCARIKKLGYVEGKHVNLYGEHMELVSDPFEEGDCVAVRAVSEGNRTERTIDLPVSILAGWEDLFEELAGPTASELPAKAPLPGSAGQTE
Ga0187887_1007043223300018043PeatlandSLPPRCPMSSSEPTAVRSPSENCARIKKLGYVEGKHVNLYGEHMELVSDPFEEGDCVAVRAVSEGNPTERTIDLPVSILAGWEDLFEELAGPTASELPAKAPLPGSAGQTE
Ga0187851_1005904323300018046PeatlandMSSSSPEPMSVLSSSENCARIKKLGYIVGKHLDLYGERIELVSDPFVEGDCVAVHAISGNNPTVRTIDLPQSLLAGWEDLFQEPADPTASELTAKTPLPGSADKKRSNP
Ga0187859_1006946113300018047PeatlandRISLPPRCPMSSSEPTAVRSPSENCARIKKLGYVEGKHVNLYGEHMELVSDPFEEGDCVAVRAVSEGNPTERTIDLPVSILAGWEDLFEELAGPTASELPAKAPLPGSAGQTE
Ga0187852_106737813300019082PeatlandMSSSSAEPTTARSPAQNCARIKKLGYTVGKRVDLYGEHVELVSDPFEEGDCVAVRLISGNNPTDRTIELPVTLLYGWEGLFEEPADPAASELPAKTPLPASAG
Ga0182031_128794113300019787BogMSSPSPQSAAIDSSSENCSHMKKLGYIVGKHVDLYGEHMVLVSDPFDDGDCVAVRAVSESNPTERKIDLPLSLLVGLEDLFLEPADPTASEQVSRSGK
Ga0182028_118994723300019788FenMTSSSPQPKAVRTPSENCARIKKLGYIVGKRVNLYGEHIELVSEPFEDGKCVAVHVVSGNNPTERTIDLPVTLLCGCGELFLEPEDSTA
Ga0210395_1005524633300020582SoilMFSSSPEHKAVSSPSENCTRIKKLGYIVGKHMNLYGEHMELVSDPFVEDDCVAVHAISSSNPTVRRIKLPVSILAGWEDLFQELANPTASELTATTRLPGPAEAQ
Ga0210395_1024515323300020582SoilMSSSSPEHRAVRSPSENCTRIKSLGYIVGKHMNLYGEHMEMVSDPFVEGDCVAVHAISSSNPTVRTIKLPLSILAGWEDLFQELANPTASEFTAKTPLPGSAEAQ
Ga0210395_1029902813300020582SoilMYSSSLEHKAVSSPSENCTRIKKLGYIVGKHMNLYGEHMELVSDPFVEDDCVAVHAISSSDPTVRRIKLPVSILAGWED
Ga0210395_1112736513300020582SoilVAVRSPSENCKRIKKLGYIVGKHMNLYGEHMELVSDPFVEGDCVAVHAISSSNPTVRTIELPVSILAGWEDLFQELADPTASEFPAKIPLPEAAGRRRSKP
Ga0210401_1142306423300020583SoilMSSSSPEHRAVRSPSENCARIKKLGYIVGKHMNLYGEHMEMVSDPFVEGDCVAVHAISSSNPTVRTIELPVSILAGWEDLFQELANPTASELTPKTPPLGSAEAQ
Ga0210396_1040204613300021180SoilSPSENCARIKKLGYIAGKHMDLYGEHIELVSDPFEEGDNVAVRAVSENNPAVRTIELPVSILAGWEDLFQELADPAASELTAKTPLPGSAGRRRSMP
Ga0210396_1089711713300021180SoilMFSSSPEHKAVSSPSENCTRIKKLGYIVGKHMNLYGEHMELVSDPFVEGDCVAVHAICSSNPTVRTIELPVSILAGWEDLFQELADPTASELPAKTPLPEAAGRRRSKP
Ga0210393_1061342513300021401SoilMSSSSPEQVAVRSPSENCKRIKKLGYIVGKHMNLYGEHMELVSDPFVEGDCVAVHAISSSNPTVRTIELPVSILAGWEDLFQELADPTASEFPAKIPLPEAAGRRRSKP
Ga0210397_1024636513300021403SoilMSSSSPEHRAVRSPSENCTRIKSLGYIVGKHMNLYGEHMEMVSDPFVEGDCVAVHAISSSNPTVRTIKLPLSILAGWEDLFQELANPTASEFTAK
Ga0210389_1107641423300021404SoilMSSSSPEPVAVRSPSENCTRIKKLGYIVGKHMNLYGEHMELVSDPFVEGDCVAVHAICSSNPTVRTIELPVSILAGWEDLFQELADPTASELPAKTPLPEAAGRRRSKP
Ga0210387_1051386723300021405SoilMSSSSPEPIAVRSPSENCARIRKLGYIVGKHVNLYGEHMELVSDPFEEGDCVAVHAVSESNPTVRTIKLPVSILARWKDLFQELANSTALRSLR
Ga0210386_1035173223300021406SoilMFSSSPEHKAVSSPSENCTRIKKLGYIVGKHMNLYGEHMELVSDPFVEDDCVAVHAISSSNPTVRRIKLPVSILAGWEDLFQELANPTASELTATTRLPGPAEVQ
Ga0210383_1096251613300021407SoilSSSSPEPIAVRSPSENCARIRKLGYIVGKHVNLYGEHMELVSDPFEEGDCVAVHAVSESNPTVRTIKLPVSILARWKDLFQELANSTALRSLR
Ga0210394_1047280213300021420SoilMYSSSLEHKAVSSPSENCTRIKKLGYIVGKHMNLYGEHMELVSDPFVEDDCVAVHAISSSDPTVRRIKLPVSILAGWEDLFRELANPTASELTATTRLPGPAEAQ
Ga0210394_1088192813300021420SoilMSSSSPEHRAVRSPSENCTRIKSLGYIVGKHMNLYGEHMEMVSDPFVEGDCVAVHAISSSNPTVRTIKLPLSILAGWEDLFQELANP
Ga0210391_1083335613300021433SoilMSSSSPEPRAVRSPSENCTRIKSLGYIVGKHMNLYGEHMEMVSDPFVEGDCVAVHAISSSNPTVRTIKLPLSILAGWEDLFQELANPTASEFTAKTPLPGSAEAQ
Ga0210410_1151935413300021479SoilCNMSSSSPEHRAVRSPSENCTRIKSLGYIVGKHMNLYGEHMELVSDPFVEDDCVAVHAISSSDPTVRRIKLPVSILAGWEDLFRELANPTASELTATTRLPGPAEAQ
Ga0224528_100025893300022861SoilMSSSPPQHIAVRSPSENCAHIKKLGYITGKHMNLYGEHMELVSDPFEAGKCVAVQAISSSNPIVRTIELPISILAGWEDLFQDLANRAASELAAKTPLPGFAGPSQTPLQL
Ga0224555_1000744333300023088SoilMSSSSAEPIAVRSAAENCARIKKLGYIVGKHVDLYGEHVELVSDPFEEGDCVAVRAISGNNPIERTIELPVTLLSGWEDLFEAPADPTASGLPAQAPLAEPVGQ
Ga0224558_101894233300023090SoilMSSSSAEPIAARSPAENCARIKKLGYIVGKHVDLYGEHVELVSDPFEEGDCVAVRAVSGNNPTERTIELPVTLLSGWEDLFEEPADPTASELPAQAPLPEAAG
Ga0224558_104286833300023090SoilMSSSSVEPIAGRSPAESCARIKKLGYIVGKHVDLYGEHVELVSDPFEEGDCVAVRAVSGNNPTERTIELPVTLLSGWEDLLEEPADPTASELPGLAPLPEAAG
Ga0224544_101768413300023250SoilMSSSSPQPVVVRSPSENCTRIRKLGYIVGKHMSLYGEHMELVSDPFVAGDCVAVHAISSSNPTVRTIDLPVSILAGWEDLFQELADPAASGLTAKTPLPGSAEAE
Ga0224556_100206663300024295SoilMSVSSQESIAVRSLAENCARIRKLGYIAGKHVNLYGEHMELVSDPFVEGDCVAAQAISSSNRTVRTIDLPVSILAGWEDLFQKLAEPTESELTAETPLPASAEAR
Ga0207700_1143399513300025928Corn, Switchgrass And Miscanthus RhizosphereAAVRSPSAKCARIKELGYIAGKHVNLYGERMEFVSDPFDDGDCVAVHAFSTTNPTVRTISLPISILSFWEDLLPKLAPLPAPELTAIGSTFSD
Ga0207664_1000502483300025929Agricultural SoilMSISSPAHAVVRSPSAKCARIKELGYIAGKHVNLYGERMEFVSDPFEDGDCVAVLAVSTTNPTLRTINLPVSILPLWEDLLPKLANPPAPELTAMAPPSRADGTTAA
Ga0207664_1013132823300025929Agricultural SoilMSISSPAHAAVRSPSAKCARIKELGYIAGKHVNLYGERMEFVSDPFDDGDCVAVLAVSTTNPTVRTISLPVSILSFWEDLLPKLAPLPAPELTAIGSTFSD
Ga0207664_1116516613300025929Agricultural SoilMSFSSPEHIDARSSCDNCARIKKLGYVAGKHVDLYGEHLELVSDPFEEGDFVAVHAFSSSNTTVRTIKLPVSILTGWEDLFQ
Ga0207702_1137066113300026078Corn RhizosphereMSISSPAHAAVRSPSAKCARIKELGYIAGKHVNLYGERMEFVSDPFDDGDCVAVLAVSTTNPTVRTISLPVSILSFWEDLLPKLAPLPAPELTAIGSTF
Ga0207698_1142406413300026142Corn RhizosphereMSISSPAHAVVRSPSAKCARIKELGYIAGKHVNLYGERMEFVSDPFEDGDCVAVLAVSTTNPTLRTINLPVSILPLWEDLLPKLANPPAPELTAMAPPS
Ga0209169_1026528113300027879SoilMSSSSPEQVAVRSPSENCKRIKKLGYIVGKHMNLYGEHMELVSDPFVEGDCVAVHAISSSNPTVRTIELPVSILAGWEDLFQELADPTVSGTRRSHCFGVPRKDSTS
Ga0209006_1018124913300027908Forest SoilTKHMSSPEPIAVRSTVENCARIKKLGYVAGKHMDLYGEHLELVSDPFEEGDCVAVHAVSESNPTERTIEFPISILAGWEDLFQEPADPADSELSAKTQPAELST
Ga0209168_1000571173300027986Surface SoilMSISSPEHAVVRSPSKCARIKELGYIPGKHVNLYGERMEFVSDPFEDGDCVAVLAFSTTNSTVRTINLPVYILSFWEDLLPTLATLPAPKLTVMASLSRTEGTAPA
Ga0255354_105129713300028087SoilMSSSPPQHIAVRSPSENCAHIKKLGYITGKHMNLYGEHMELVSDPFEAGKCVAVQAISSSNPIVRTIELPISILAGWEDLFQD
Ga0255349_106951513300028090SoilMSSSPPQHIAVRSPSENCAHIKKLGYITGKHMNLYGEHMELVSDPFEAGKCVAVQAISSSNPIVRTIELPISILAGWEDLFQDLANRA
Ga0302147_1003562033300028566BogLSLSTPEPIALRTPAQNCARIKKLGYIVGKRVNLYGEHIELVSDPFEDGECVAVHVVSGNNPTKRTIDLPLTLLSGWEDLIPEPADPIAS
Ga0302219_1019908323300028747PalsaMSSPETIAARSTAENCARMKKLGYIAGKHMDLYGEHLELVSDPFEEGDSVAVHAVSESNPTERTIELPISILAGWEDLFQEPADPR
Ga0302222_1015562913300028798PalsaMSSPETIAARSTAENCARMKKLGYIAGKHMDLYGEHLELVSDPFEEGDSVAVHAVSENNPTERTIELPISILAGWEDLFQEPADPR
Ga0265338_10001506163300028800RhizosphereLSLSSTEPIVVRTPQENCARIKKLGYIAGKRVNLYGERIELVSDPFEDGKCVAVRAVSGSNPTVRTFDLPMTLLSGWQELTPEAAEPAA
Ga0308309_1070716113300028906SoilMSSFSPEPVAVRSPSETCTRIKKLGYIVGKHMNLYGEHMELVSDPFVEGDCVAVHAISSSNPTVRTIELPVSILAGWEDLFQELADPTASEFPAKIPLPEVAGRRRRKP
Ga0311368_1028994223300029882PalsaMSSSSPEPIAVRSPSENCVRIRELGYIVGKHVNLYGEHMELVSDPFVEGDCVAVHAISSSNPTIRTIDLPVSILAGWEDLFHNLASPTASELTRKTPGPGPAEAE
Ga0302141_121109423300029919BogSSRPRCSLSLSTPEPIALRTPAQNCARIKKLGYIVGKRVNLYGEHIELVSDPFEDGECVAVHVVSGNNPTKRTIDLPLTLLSGWEDLIPEPADPIAS
Ga0302142_127236413300029920BogIALRTPAQNCARIKKLGYIVGKRVNLYGEHIELVSDPFEDGECVAVHVVSGNNPTKRTIDLPLTLLSGWEDLIPEPADPIAS
Ga0311340_1024871523300029943PalsaMSSPEPVAVQSTADNCARIKKLGYIGGKYMDLYGEHLELVSDPFEEGDSVAVHAVSKSDPTERTIELPVTILAGWNDLFQEPADPVDSELPAKTQPAELST
Ga0311352_1039646133300029944PalsaMSSPETIAARSTAENCARMKKLGYIAGKHMDLYGEHLELVSDPFEEGDSVAVHAVSESNPTERTIELPISILAGWEDLFQEPADPADSQLPAKTQPVELST
Ga0311346_1054112213300029952BogMPPSSPEPVAAGSSSENCTHIKKLGYIVGKHVDLYGEHMVLVSDPFDDGDCVAVQATSAIDPTVRKIELPLTILAGWEDLFLEPADPTASEP
Ga0302150_1021574023300029956BogRWPMSSPSPQSAAIDSSSENCSHMKKLGYIVGKHVDLYGEHMVLVSDPFDDGDCVAVRAVSESNPTERKIDLPLSLLVGLEDLFLEPADPTASEQVSRSGK
Ga0311339_1124493013300029999PalsaPVAVQSTADNCARIKKLGYIAGKYMDLYGEHLELVSDPFEEGDSVAVHAVSKSDPTERTIELPVTILAGWNDLFQEPADPVDSELPAKTQPAELST
Ga0302176_1037543213300030057PalsaSPETIAARSTAKNCARMKKLGYIAGKHMDLYGEHLELVSDPFEEGDSVAVHAVSENNPTERTIELPISILAGWEDLFQEPADPR
Ga0311353_1002063263300030399PalsaMSSSSPEPIAVRSSSENCIRIRELGYIVGKHVNLYGEHMELVSDPFVEGDCVAVHAISSSNPTIRTIDLPVSILAGWEDLFHNLASPTASELTRKTPGPGPAEAE
Ga0311370_1172925613300030503PalsaVAVQSTADNCARIKKLGYIAGKYMDLYGEHLELVSDPFEEGDCVAVHAVSESNPTERTIELPVSILAGWEDLLQEPADPAESELPTKTQPAELST
Ga0311355_1039666923300030580PalsaMSSSSPEPIAVRSPSENCIRIRELGYIVGKHVNLYGEHMELVSDPFVEGDCVAVHAISSSNPTIRTIDLPVSILAGWEDLFHNLASPTASELTRKTPGPGPAEAE
Ga0311355_1106070413300030580PalsaMSSPEPVAVRSTADNCVRIKKLGYIAGKHMDLYGEHLELVSDPFEEGDCVAVHAVSESNPTERTIELPVSILAGWEDLLQEPADPAESELPTKTQPAELST
Ga0074018_177251813300031053SoilMSSPEPVAVRSTADNCARIKKLGYIAGKHMDLYGEHLELVSDPFEEGDSIAVHAVSESNPTERTIELPVTILAGWEDLFQEPADPADSEL
Ga0302325_1277145813300031234PalsaRSFPGTRVSSPPRFPMSSHEPTDEPSPAENCARIKKLGYIAGKHVDLYGEHIELASDPFEDGDCIGVRATSKSDPAERTIDLPVTLLTGWKDLFEEPADPADSEPVAEGPLPESIEKEPA
Ga0302324_10010862353300031236PalsaMSSPEPVAVQSTADNCARIKKLGYIAGKYMDLYGEHLELVSDPFEEGDSVAVHAVSKSDPTERTIELPVTILAGWNDLFQEPADPVDSELPAKTQPAELST
Ga0302324_10065708823300031236PalsaMSSHEPTDEPSPAENCARIKKLGYIAGKHVDLYGEHIELASDPFEDGDCIGVRATSKSDPAERTIDLPVTLLTGWKDLFEEPADPADSEPVAEGPLPESIEKEPA
Ga0302324_10144717423300031236PalsaMSASEPTAVRSSSENCERIKKLGYIVGKHVNLYGEHMELVSDPFEEGDSIAVRAVSASNPTERTIDLPVSLLSGWEE
Ga0302187_1008639013300031259BogAAIDSSSENCSHMKKLGYIVGKHVDLYGEHMVLVSDPFDDGDCVAVRAVSESNPTERKIDLPLSLLVGLEDLFLEPADPTASEQVSRSGK
Ga0302140_1024325533300031261BogMSSPSPEPVAVGSSSENCSHMKKLGYVVGKHVDLYGEHMVLVSDPFDDGDCVAVRAVSESNPTERKIDLPLSLLTGLEDLFLEPADPTASEQVSRTGK
Ga0302320_1006491763300031524BogLSSPEPIDVRTPAENCARIKELGYIVGKHVDLYGEHIELVSDPFENGECVAVRAISGSNPTVRTFNLPVSLLSGWEDLFQEPAGPTASAHG
Ga0302320_1180802213300031524BogMSSSPPQHIAVRSPSENCAHIKKLGYITGKHMNLYGEHMELVSDPFEAGKCVAVQAISSSNPIVRTIELPISILAGWEDLFQDLANRAASELAAKTPLPGFAGPSQTPL
Ga0302326_1111019623300031525PalsaMSASEPTAVRSSSENCERIKKLGYIVGKHVNLYGEHMELVSDPFEEGDSIAVRAVSASNPTERTIDLPVSLLSGWEELFQEPADPTASEQVSKSAV
Ga0307374_10002419193300031670SoilMSPSSPEPIAARSPSENCARIKKLGYIVGKHVNLYGEHIELVSDPFEEGEYVAVHAVSESDPTVRKIGLPVSLLAGWEDLFQEPADPAPRNSPQ
Ga0265342_1012399733300031712RhizosphereFSSSPSAEPSDVRSPAENCARIKKLGYIAGKHVNLYGEHMELVSDPFEDGECVGVRAVSGNNPKERTIDLPLTLLSGWQDLFEEPADPTASEQKAPVPETAGP
Ga0315741_1177378823300032739Forest SoilMSSPEPIAARSTAENCARIKKLSYIAGKHMDLYGEHLELVSDPFEEGDSIAVHAVSESNPTERTIELPVTILAGWEDLFQEPADPADSELPAKT
Ga0315742_1197487213300032756Forest SoilQASTKHMSSPEPIAVRSTVENCARIKKLGYVAGKHMDLYGEHLELVSDPFEEGDCVAVHAVSESNPTERTIEFPISILAGWEDLFQEPADPADSELSAKTQPAELST
Ga0326728_10001091233300033402Peat SoilMSSSIPEPTDVRTPAENCARIKELGYVVGNHVNLYGEHFKLVSDPFEDGECVAVRAVSGSNPTVRTFDLPMTLLSGWEELIPAPVDSTASELPAKTLLPGSARKSRS
Ga0326728_1002962373300033402Peat SoilMSPSSTEPIAVRTPAENCARMKELGYIVGKHVNLYGEHFKLISEPFEDGGCVAVHAVSGNNPTVRTFDLPVTLLSGWEDLFLKPVDHSASELPAKTPPPGATKKSRSKPKK
Ga0326728_1010245533300033402Peat SoilMSPSSLKTKAVRTLSENCARIKKLGYIAGKHVNLYGEHIELVSDPFEDGECIAVHAVSGNNPTVRTIDLPVTLLSGWEDVLPESADPTA
Ga0326728_1014586513300033402Peat SoilMSASSAEPIAVRSLSENCARIKKLGYKVGKHVNLYGEHMELVSDPFEEGDCVAVRAVSGSNPTERTIDLPVTLLSGWEDLFQEPADPTASELTAKTPLSGSAGQTE
Ga0326728_1015167833300033402Peat SoilMTSSSPQPKAVRTPSENCARIKKLGYIVGKHVNLYGENIELVSDPFEDGKCVAVHVVSGSNPTERTIDLPVTLLSGCGELFLEPEDPAA
Ga0326728_1057836013300033402Peat SoilMSSPEPEHIAVQSLSNDCARIKKLGYIVGKHVDLYGEHMELVSDPFEEGDCVAVRAVSESNPTERTIDLPVSLLSGWEDLFEEPADPTASELTAKTPFPGSAEQSRSNS
Ga0326727_10017910123300033405Peat SoilMSPSSLDPKAVRTPSENCARIKKLGYTVGKHVYLYGEHIELVSDPFEDGKCVAVHVVSGPNPTERTIDLPVTLLSGWEELFLKPADPIAAELPA
Ga0326727_1112455123300033405Peat SoilMSSSSPERYAVRSASENCARIKKLGYIAGKHMNLYGERMELVSDPFDEGECVAVHAFSSSDPTVRTIELPVSILSGWEDLFEELANSTASKITAKNLLSGSAGQNSSNP
Ga0334790_019611_2390_27013300033887SoilMSSSSPEHTAVRSPSENCARIKELGYIVGKHINLYGEHMELVSDPFEEGDCVAVHAISSSNPTVRTIELPVSILAGWEDLFQELANPTASELTAKTPLPGPAE
Ga0334790_022458_1069_13863300033887SoilMPSSHPEPTALHSPSENCTRINKLGYIVGKHVNLYGEHMELVSDPFVEGECVAVHAISSNDPTVRTINLPVSLLAGWEDLFQELADRPAWEPTAKTPLPGAVGPS
Ga0334792_009810_111_4283300033888SoilMPSSHPEPTALHSPSENCTRINKLGYIVGKHVNLYGEHMELVSDPFVEGECVAVHAISSNDPTVRTINLPVSLLAGWKDLFQELADRPAWEPTAKTPLPGAVGPS
Ga0371488_0040357_1896_22313300033983Peat SoilMSSSLTEPLAVRTPAQNCARIKELGYVVGKQVNLYGEHFKLVSDPFEDGECVGVHAVSGSNPTVRTFDLPVTLLSGWEELFLKPVDPTVSELPAKTLLPGSARKSRSKPKP
Ga0334827_049694_1210_15063300034065SoilLSSSIPEPIGVRTPAENCARIKKLGYIVGKHVNLYGEHIELVSDPFEDGACVAVQVVSGNNPTERTIDLPLTLLSGWADLIPEPPNPSASEFPVKVPR
Ga0370515_0272983_46_3543300034163Untreated Peat SoilLSSSSPQPIAVRTPAENCARIKKLGYIVGKNVNLYGEHFKLVSDPFEDGECVAVRAVSGSNPTVRTFDLPMTLLSGWEELIPDPAVPTASELPAKTPLPGPA
Ga0370492_0003180_2036_23053300034282Untreated Peat SoilMSSSSPEHKALRSPSENCAHIKKLGYIAGKHVNLYGEHMELVSDPFVEGDCVAVHTISSSNQTVRTIDLPISILAGWEDLLEESNNLDA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.